BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043G15

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    251   4e-81   Petunia x hybrida [garden petunia]
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    250   1e-80   Petunia x hybrida [garden petunia]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    246   3e-79   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AFK36660.1|  unknown                                                 246   4e-79   Lotus japonicus
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    246   4e-79   Eucalyptus grandis [rose gum]
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    246   6e-79   Solanum tuberosum [potatoes]
gb|AFK48034.1|  unknown                                                 244   2e-78   Lotus japonicus
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   Solanum tuberosum [potatoes]
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    244   2e-78   Eucalyptus globulus [blue gum]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   2e-78   Eucalyptus grandis [rose gum]
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   2e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   3e-78   Nicotiana sylvestris
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   3e-78   Solanum tuberosum [potatoes]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    243   4e-78   Solanum tuberosum [potatoes]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   4e-78   Solanum tuberosum [potatoes]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    243   4e-78   Solanum tuberosum [potatoes]
gb|AHI85721.1|  stress-induced protein 16                               243   5e-78   Capsicum annuum
gb|AAR83879.1|  Cristal-Glass1 protein                                  243   5e-78   Capsicum annuum
gb|AFK42721.1|  unknown                                                 243   5e-78   Lotus japonicus
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    243   5e-78   Solanum lycopersicum
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    243   5e-78   Solanum lycopersicum
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   5e-78   
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    243   6e-78   Capsicum annuum
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    243   6e-78   Solanum tuberosum [potatoes]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    243   7e-78   Solanum tuberosum [potatoes]
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   7e-78   
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    242   1e-77   Solanum tuberosum [potatoes]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    243   1e-77   Capsicum annuum
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   1e-77   Nicotiana sylvestris
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   1e-77   Nicotiana sylvestris
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   1e-77   Nicotiana tomentosiformis
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK33868.1|  unknown                                                 242   2e-77   Lotus japonicus
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   3e-77   Nicotiana attenuata
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    241   3e-77   Malus sp.
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    241   4e-77   Betula pendula [white birch]
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   4e-77   Solanum tuberosum [potatoes]
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    241   5e-77   Malus domestica [apple tree]
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    241   6e-77   Pyrus x bretschneideri [bai li]
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   6e-77   Nicotiana tomentosiformis
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   7e-77   Nicotiana sylvestris
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    240   8e-77   Stellaria longipes
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   1e-76   Beta vulgaris subsp. vulgaris [field beet]
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    239   1e-76   Pyrus pyrifolia [sha li]
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   Pyrus x bretschneideri [bai li]
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    239   3e-76   Ricinus communis
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   3e-76   
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   3e-76   Fragaria vesca subsp. vesca
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    239   3e-76   Solanum tuberosum [potatoes]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     238   6e-76   Malus domestica x Pyrus communis
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     238   7e-76   Eucalyptus grandis [rose gum]
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    238   8e-76   Mesembryanthemum crystallinum
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    238   9e-76   Mesembryanthemum crystallinum
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    237   1e-75   Mesembryanthemum crystallinum
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    237   1e-75   Solanum lycopersicum
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    237   2e-75   Amaranthus hypochondriacus [prince's feather]
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   2e-75   Ammopiptanthus mongolicus
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    236   3e-75   Mesembryanthemum crystallinum
gb|ABK96567.1|  unknown                                                 236   3e-75   Populus trichocarpa x Populus deltoides
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   3e-75   
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   3e-75   Corchorus olitorius [Nalta jute]
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    236   5e-75   Mesembryanthemum crystallinum
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    235   5e-75   Wolffia australiana
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   235   6e-75   Mesembryanthemum crystallinum
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    235   6e-75   Populus trichocarpa [western balsam poplar]
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    235   7e-75   Fragaria vesca subsp. vesca
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    235   7e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    235   8e-75   Nicotiana sylvestris
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    235   9e-75   Fagus crenata
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    235   9e-75   Eucalyptus globulus [blue gum]
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    234   1e-74   Blitum nuttallianum
gb|AFK40375.1|  unknown                                                 234   1e-74   Medicago truncatula
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    234   1e-74   Amaranthus hypochondriacus [prince's feather]
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    234   3e-74   Mesembryanthemum crystallinum
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    234   3e-74   Mesembryanthemum crystallinum
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    233   3e-74   Nicotiana tomentosiformis
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      233   3e-74   Medicago truncatula
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    234   3e-74   Nelumbo nucifera [Indian lotus]
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    233   4e-74   Fagus sylvatica
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    233   4e-74   Populus euphratica
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   4e-74   Coffea arabica [arabica coffee]
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    233   7e-74   Citrus sinensis [apfelsine]
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   8e-74   Panax ginseng [Asiatic ginseng]
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             232   1e-73   Citrus clementina [clementine]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    232   2e-73   Ricinus communis
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      232   2e-73   Medicago truncatula
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             232   2e-73   Prunus persica
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    231   2e-73   Helianthus annuus
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    231   2e-73   Blitum nuttallianum
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    231   2e-73   Chenopodium album [lamb's-quarters]
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    231   2e-73   Ricinus communis
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   3e-73   Prunus mume [ume]
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    231   3e-73   Amaranthus hypochondriacus [prince's feather]
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    231   4e-73   Medicago sativa [alfalfa]
ref|NP_001235314.1|  uncharacterized protein LOC100500504               231   5e-73   Glycine max [soybeans]
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    231   5e-73   Cicer arietinum [garbanzo]
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    231   5e-73   Pisum sativum [garden pea]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    230   6e-73   Glycine max [soybeans]
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    230   6e-73   Lemna gibba
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    230   6e-73   Silene latifolia subsp. alba [white campion]
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    230   6e-73   Glycine max [soybeans]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    230   7e-73   
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    230   7e-73   Lemna gibba
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    230   8e-73   Pisum sativum [garden pea]
gb|ABK95229.1|  unknown                                                 230   9e-73   Populus trichocarpa [western balsam poplar]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    229   1e-72   Glycine tabacina
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   1e-72   Cucumis melo [Oriental melon]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     229   1e-72   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           229   2e-72   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    229   2e-72   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    229   2e-72   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    229   2e-72   
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    229   2e-72   Mesembryanthemum crystallinum
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    229   2e-72   Arachis hypogaea [goober]
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    228   3e-72   Spinacia oleracea
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    228   3e-72   Aralia elata
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     228   4e-72   Spinacia oleracea
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    228   4e-72   Lemna gibba
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    228   6e-72   Camellia sinensis [black tea]
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    228   6e-72   Glycine max [soybeans]
gb|ACU13285.1|  unknown                                                 228   7e-72   Glycine max [soybeans]
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    228   8e-72   Lactuca sativa [cultivated lettuce]
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    227   8e-72   
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    227   8e-72   Populus euphratica
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    227   1e-71   Lemna gibba
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           227   1e-71   Medicago truncatula
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           227   1e-71   Medicago truncatula
gb|ACJ85905.1|  unknown                                                 227   1e-71   Medicago truncatula
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    227   1e-71   Glycine max [soybeans]
gb|ABK96431.1|  unknown                                                 227   1e-71   Populus trichocarpa x Populus deltoides
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           227   1e-71   Medicago truncatula
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    226   2e-71   Glycine soja [wild soybean]
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   2e-71   Cucumis sativus [cucumbers]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    226   2e-71   Cucumis sativus [cucumbers]
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           226   2e-71   Medicago truncatula
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         226   2e-71   Jatropha curcas
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    226   2e-71   Trifolium repens [creeping white clover]
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    226   3e-71   Glycine tomentella [wooly glycine]
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    226   3e-71   Lactuca sativa [cultivated lettuce]
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    225   5e-71   Camellia oleifera [abura-tsubaki]
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    225   6e-71   Lemna gibba
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     225   7e-71   Jatropha curcas
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   1e-70   Gossypium hirsutum [American cotton]
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    224   1e-70   Pyrus x bretschneideri [bai li]
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    224   1e-70   Coffea canephora [robusta coffee]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   1e-70   Gossypium hirsutum [American cotton]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   1e-70   Gossypium hirsutum [American cotton]
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   1e-70   Gossypium mustelinum
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    224   1e-70   Lemna gibba
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      224   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    223   1e-70   Pisum sativum [garden pea]
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      224   1e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      224   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      224   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    224   2e-70   
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   2e-70   Nicotiana sylvestris
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   2e-70   Gossypium hirsutum [American cotton]
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             224   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    224   2e-70   
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   3e-70   Arabidopsis suecica
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   3e-70   Gossypium tomentosum
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      223   3e-70   Arabidopsis thaliana [mouse-ear cress]
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    223   4e-70   Cucumis sativus [cucumbers]
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   5e-70   Gossypium raimondii
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   5e-70   Nicotiana tomentosiformis
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   5e-70   Nicotiana tomentosiformis
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   5e-70   Nicotiana sylvestris
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   6e-70   Gossypium tomentosum
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   6e-70   Nicotiana sylvestris
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         222   6e-70   Jatropha curcas
emb|CDP20139.1|  unnamed protein product                                222   7e-70   Coffea canephora [robusta coffee]
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      223   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   7e-70   Gossypium hirsutum [American cotton]
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   7e-70   Nicotiana tomentosiformis
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    223   7e-70   Raphanus sativus
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    222   8e-70   Arabidopsis lyrata subsp. lyrata
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   8e-70   Nicotiana tomentosiformis
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    222   8e-70   Flaveria pringlei
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   9e-70   Brassica rapa
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   221   9e-70   Pisum sativum [garden pea]
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             222   9e-70   Capsella rubella
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   9e-70   Nicotiana tabacum [American tobacco]
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   1e-69   Gossypium mustelinum
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             222   1e-69   Capsella rubella
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   1e-69   Nicotiana tomentosiformis
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   1e-69   Arabidopsis suecica
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    222   1e-69   Elaeis guineensis
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   1e-69   Gossypium hirsutum [American cotton]
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   1e-69   Nicotiana sylvestris
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   1e-69   Gossypium hirsutum [American cotton]
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    222   1e-69   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   2e-69   Gossypium raimondii
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   2e-69   Brassica rapa
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    221   2e-69   Nicotiana sylvestris
ref|XP_010103758.1|  hypothetical protein L484_014647                   221   2e-69   Morus notabilis
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   2e-69   Camelina sativa [gold-of-pleasure]
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    221   2e-69   Gossypium hirsutum [American cotton]
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   2e-69   Tarenaya hassleriana [spider flower]
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    221   2e-69   Gossypium arboreum [tree cotton]
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   2e-69   Ageratina adenophora
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    221   2e-69   Manihot esculenta [manioc]
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   3e-69   Camelina sativa [gold-of-pleasure]
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       221   3e-69   Phaseolus vulgaris [French bean]
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             221   3e-69   Phaseolus vulgaris [French bean]
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    221   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    221   3e-69   Theobroma cacao [chocolate]
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  221   4e-69   Arabidopsis lyrata subsp. lyrata
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    221   4e-69   Manihot esculenta [manioc]
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             221   4e-69   Capsella rubella
emb|CDY52468.1|  BnaA04g27920D                                          221   4e-69   Brassica napus [oilseed rape]
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    220   4e-69   Brassica napus [oilseed rape]
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    220   4e-69   Gossypium hirsutum [American cotton]
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    220   4e-69   Flaveria pringlei
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   6e-69   Camelina sativa [gold-of-pleasure]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   6e-69   Spinacia turkestanica
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    220   7e-69   Brassica napus [oilseed rape]
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    220   7e-69   Flaveria pringlei
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     220   7e-69   Eucalyptus grandis [rose gum]
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   8e-69   Spinacia oleracea
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      220   8e-69   Phaseolus vulgaris [French bean]
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   8e-69   Spinacia oleracea
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    219   9e-69   Flaveria pringlei
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   9e-69   Oryza brachyantha
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   9e-69   Brassica oleracea
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   9e-69   Brassica oleracea
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   9e-69   Arabidopsis arenosa
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    219   1e-68   Gossypium gossypioides
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    219   1e-68   Phoenix dactylifera
gb|AAG40356.1|AF325004_1  At1g67090                                     219   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             219   1e-68   Eutrema salsugineum [saltwater cress]
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   1e-68   Arabidopsis arenosa
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    219   1e-68   Arabidopsis suecica
gb|ACQ90230.1|  virus-resistance protein                                221   1e-68   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             219   1e-68   Eutrema salsugineum [saltwater cress]
emb|CDX99682.1|  BnaC04g34390D                                          219   1e-68   
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    219   1e-68   Flaveria pringlei
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   2e-68   Nicotiana tabacum [American tobacco]
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   2e-68   Musa acuminata AAA Group [Cavendish banana]
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    219   2e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67657.1|  BnaCnng55860D                                          219   2e-68   Brassica napus [oilseed rape]
emb|CDX67402.1|  BnaA07g14420D                                          219   2e-68   
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    218   2e-68   Rumex obtusifolius
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    218   3e-68   Flaveria pringlei
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   3e-68   Elaeis guineensis
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    218   3e-68   Manihot esculenta [manioc]
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   3e-68   Gossypium herbaceum [Arabian cotton]
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   3e-68   Brassica oleracea
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   3e-68   Brassica rapa
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   3e-68   Musa acuminata AAA Group [Cavendish banana]
gb|KJB10450.1|  hypothetical protein B456_001G201800                    218   3e-68   Gossypium raimondii
emb|CDY01665.1|  BnaC04g30870D                                          218   3e-68   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    218   4e-68   Brassica oleracea
emb|CAH59401.1|  Rubisco SSU                                            218   4e-68   Plantago major [cart-track plant]
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   5e-68   Setaria italica
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    217   5e-68   Arabidopsis suecica
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             218   5e-68   Prunus persica
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   5e-68   Litchi chinensis [litchi]
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   6e-68   Brassica rapa
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   6e-68   Brassica rapa
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    218   6e-68   Phoenix dactylifera
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    218   6e-68   Brassica napus [oilseed rape]
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    217   7e-68   Tarenaya hassleriana [spider flower]
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    217   7e-68   Brassica oleracea
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    217   8e-68   Brassica rapa
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    217   8e-68   Hevea brasiliensis [jebe]
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    217   8e-68   Flaveria pringlei
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   217   9e-68   
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      217   9e-68   
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   1e-67   
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    216   1e-67   
gb|KJB43046.1|  hypothetical protein B456_007G181300                    217   1e-67   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    216   1e-67   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   2e-67   
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        216   2e-67   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    216   2e-67   
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    216   2e-67   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    217   2e-67   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    216   2e-67   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    216   3e-67   
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   3e-67   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             216   3e-67   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    215   3e-67   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   3e-67   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   4e-67   
ref|WP_026003795.1|  hypothetical protein                               213   4e-67   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       215   4e-67   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    215   4e-67   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    215   4e-67   
emb|CAA30290.1|  rubisco ssu precursor                                  215   5e-67   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    215   5e-67   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    215   5e-67   
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    215   6e-67   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   7e-67   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    214   7e-67   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    214   8e-67   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    214   9e-67   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    214   1e-66   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    214   1e-66   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    214   1e-66   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    214   1e-66   
ref|NP_001066606.1|  Os12g0291400                                       214   1e-66   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    214   1e-66   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    214   1e-66   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    214   1e-66   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      212   2e-66   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   2e-66   
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    212   2e-66   
gb|EAY97115.1|  hypothetical protein OsI_19041                          213   2e-66   
ref|NP_001066559.1|  Os12g0274700                                       213   2e-66   
ref|NP_001066604.1|  Os12g0291100                                       213   2e-66   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   3e-66   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    213   3e-66   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    213   3e-66   
gb|EMT06085.1|  hypothetical protein F775_43781                         213   3e-66   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    213   3e-66   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         212   3e-66   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    213   4e-66   
dbj|BAJ86022.1|  predicted protein                                      213   4e-66   
emb|CAH59404.1|  Rubisco SSU                                            213   4e-66   
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    213   4e-66   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    213   4e-66   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    213   4e-66   
dbj|BAJ89884.1|  predicted protein                                      212   6e-66   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    212   6e-66   
dbj|BAJ90550.1|  predicted protein                                      212   6e-66   
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    210   7e-66   
gb|ABK96590.1|  unknown                                                 213   7e-66   
emb|CAA10497.1|  hypothetical protein                                   212   8e-66   
ref|WP_037767734.1|  hypothetical protein                               210   8e-66   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    212   8e-66   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    212   8e-66   
dbj|BAJ90202.1|  predicted protein                                      212   9e-66   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    212   1e-65   
dbj|BAJ90404.1|  predicted protein                                      212   1e-65   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   1e-65   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   1e-65   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    211   1e-65   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    211   1e-65   
ref|NP_001066607.1|  Os12g0292400                                       211   2e-65   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   2e-65   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   2e-65   
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    209   2e-65   
gb|EAY82834.1|  hypothetical protein OsI_38046                          211   2e-65   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   2e-65   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    211   2e-65   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     211   2e-65   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    211   2e-65   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           211   2e-65   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   3e-65   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    210   3e-65   
emb|CDY12616.1|  BnaA02g12840D                                          211   3e-65   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    209   4e-65   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   4e-65   
emb|CAA10496.1|  hypothetical protein                                   210   4e-65   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    210   4e-65   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   4e-65   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                210   6e-65   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    209   6e-65   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   6e-65   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   7e-65   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   7e-65   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                209   7e-65   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    209   8e-65   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    209   8e-65   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    209   8e-65   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    209   9e-65   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    209   9e-65   
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    207   9e-65   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   9e-65   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   1e-64   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    209   1e-64   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    208   1e-64   
emb|CDY42338.1|  BnaC02g17150D                                          209   1e-64   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    209   2e-64   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    209   2e-64   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     208   2e-64   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    208   2e-64   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    209   2e-64   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    208   2e-64   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     208   2e-64   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   2e-64   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   2e-64   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   2e-64   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    208   2e-64   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    206   3e-64   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    208   3e-64   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    208   3e-64   
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    207   3e-64   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    207   3e-64   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   5e-64   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    207   5e-64   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    207   5e-64   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    207   5e-64   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    207   5e-64   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    207   5e-64   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     207   5e-64   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                207   6e-64   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          207   6e-64   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    207   7e-64   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    207   7e-64   
gb|ABR45725.1|  RBCS1                                                   207   8e-64   
pdb|1AUS|S  Chain S, Activated Unliganded Spinach Rubisco               205   8e-64   
sp|P00868.1|RBS1_PEA  RecName: Full=Ribulose bisphosphate carboxy...    206   8e-64   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     206   8e-64   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    207   8e-64   
emb|CAG25595.1|  putative rubisco small subunit                         206   9e-64   
gb|AAK16232.1|AF044400_1  ribulose-1,5-bisphosphate carboxylase s...    205   1e-63   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    206   1e-63   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    206   1e-63   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    206   1e-63   
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    205   1e-63   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    206   1e-63   
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    206   1e-63   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    206   2e-63   
gb|ABR45726.1|  RBCS1                                                   206   2e-63   
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    205   2e-63   
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    205   2e-63   
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...    204   2e-63   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    206   2e-63   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    206   2e-63   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    206   2e-63   
pdb|4MKV|S  Chain S, Structure Of Pisum Sativum Rubisco With Aba        204   2e-63   
emb|CBI15452.3|  unnamed protein product                                205   3e-63   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          205   3e-63   
emb|CDY42337.1|  BnaC02g17140D                                          206   3e-63   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    206   3e-63   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    205   4e-63   
ref|WP_039311749.1|  hypothetical protein                               203   4e-63   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    205   4e-63   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   5e-63   
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    204   5e-63   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    205   5e-63   
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...    205   6e-63   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   6e-63   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   7e-63   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   7e-63   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    204   7e-63   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    204   8e-63   
ref|WP_028130706.1|  hypothetical protein                               202   9e-63   
gb|ABS57004.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    202   1e-62   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    204   1e-62   
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           204   1e-62   
gb|AAG49562.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   2e-62   
prf||0902172A  carboxylase/oxygenase,RBP                                202   2e-62
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    202   2e-62   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    203   2e-62   
emb|CAH10356.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    202   2e-62   
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...    203   2e-62   
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    203   2e-62   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    202   2e-62   
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    202   2e-62   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    202   3e-62   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     202   3e-62   
gb|AAP31674.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   3e-62   
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    202   4e-62   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    202   4e-62   
emb|CAH10355.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...    201   5e-62   
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    201   7e-62   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    201   7e-62   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    202   8e-62   
pdb|1IR1|S  Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bi...    199   1e-61   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    201   1e-61   
pdb|3AXK|S  Chain S, Structure Of Rice Rubisco In Complex With Na...    199   1e-61   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    201   2e-61   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     200   3e-61   
emb|CAA30393.1|  ribulose bisphosphate carboxylase                      200   4e-61   
ref|WP_039311073.1|  hypothetical protein                               198   5e-61   
pdb|4HHH|S  Chain S, Structure Of Pisum Sativum Rubisco                 197   7e-61   
gb|AIB55758.1|  ribulose bisphosphate carboxylase small chain, pa...    198   7e-61   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    199   1e-60   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...    199   1e-60   
emb|CAA59218.1|  ribulose-bisphosphate carboxylase                      196   2e-60   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        197   2e-60   
pdb|3AXM|S  Chain S, Structure Of Rice Rubisco In Complex With 6pg      196   2e-60   
gb|ABK25403.1|  unknown                                                 198   3e-60   
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    197   4e-60   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    197   4e-60   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    197   5e-60   
gb|EMS67205.1|  Ribulose bisphosphate carboxylase small chain, ch...    195   6e-60   
emb|CAA24969.1|  unnamed protein product                                195   7e-60   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    197   8e-60   
pdb|1WDD|S  Chain S, Crystal Structure Of Activated Rice Rubisco ...    194   2e-59   
dbj|BAJ89663.1|  predicted protein                                      194   3e-59   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    194   3e-59   
gb|ABK21347.1|  unknown                                                 196   3e-59   
gb|ACN40080.1|  unknown                                                 195   4e-59   
gb|ABK21690.1|  unknown                                                 196   4e-59   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWV
Sbjct  37   VSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+ K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP L+ EQLLK++EYLLNKGWV
Sbjct  37   VSSKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCTDATQV+ EL+E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE+GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AWV
Sbjct  97   PCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV
Sbjct  34   VTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLAKEVEYLIRKGWV  93

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A++
Sbjct  94   PCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAFI  153

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDNKRQVQCI FIA++P+
Sbjct  154  RIIGFDNKRQVQCISFIAHRPE  175



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS+ D TS+S+NG RVQCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GWV
Sbjct  36   VTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFETLSYLPPLSPESLAKEVDYLLRSGWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE KKAYP A++
Sbjct  96   PCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   246 bits (627),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+
Sbjct  98   PCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  605  KKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPC  426
            +K   D TSI+ NG RVQCMQVWPP G KKFETLSYLPPL+TEQLLK+VEYLL KGWVPC
Sbjct  40   RKVNNDITSIANNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLLKEVEYLLRKGWVPC  99

Query  425  LEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRI  246
            LEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ EL+E  KAYP A+VRI
Sbjct  100  LEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDATQVLKELDEAVKAYPNAFVRI  159

Query  245  LGFDNKRQVQCIMFIAYKP  189
            +GFDN RQVQCI FIA++P
Sbjct  160  IGFDNVRQVQCISFIAHRP  178



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECKK+YP AW+
Sbjct  98   PCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWV
Sbjct  39   VTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+V
Sbjct  98   PCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIA+KP
Sbjct  158  RIIGFDNKRQVQCISFIAFKP  178



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWV
Sbjct  39   VTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+V
Sbjct  98   PCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIA+KP
Sbjct  158  RIIGFDNKRQVQCISFIAFKP  178



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+
Sbjct  38   VTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWI  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+V
Sbjct  98   PCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  158  RIIGFDNKRQVQCISFIAYKP  178



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  38   VTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQV+AE++ECKK+YP AW+
Sbjct  98   PCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDTTQVLAEVQECKKSYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWV
Sbjct  37   VTRKNNLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWV
Sbjct  37   VTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
             +K+  D TSI++NG RVQCMQVWPP G KKFETLSYLPPL+TEQLLK+VEYLL KGWVP
Sbjct  40   VRKANNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLLKEVEYLLRKGWVP  99

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  +AYP A+VR
Sbjct  100  CLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDAAQVLKELDEAVRAYPNAFVR  159

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIA++P
Sbjct  160  IIGFDNVRQVQCISFIAHRP  179



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL +VEYLL  GWV
Sbjct  37   VTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWV
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWV
Sbjct  97   PCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWV
Sbjct  97   PCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   243 bits (620),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWV
Sbjct  37   VTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   243 bits (620),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGW  435
            VTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GW
Sbjct  37   VTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGW  96

Query  434  VPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  255
            VPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  254  VRILGFDNKRQVQCIMFIAYKPD  186
            +RI+GFDN RQVQCI FIAYKP+
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPE  179



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   243 bits (620),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   243 bits (619),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  37   VTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AWV
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++ECK AYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RV+CM VWPP   KK+ETLSYLP LS EQLLK++EYLL KGWV
Sbjct  37   VTRKQDLDITSIASNGGRVECMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++E KKAYP AW+
Sbjct  97   PCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLLSEIEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+
Sbjct  97   PCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WV
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWV  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++
Sbjct  100  PCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFI  159

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  160  RIIGFDNVRQVQCISFIAYKP  180



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+
Sbjct  37   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWI  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+V
Sbjct  96   PCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFV  155

Query  251  RILGFDNKRQVQCIMFIAYKPDD  183
            RI+GFDNKRQVQCI FIAYKP D
Sbjct  156  RIIGFDNKRQVQCISFIAYKPKD  178



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV
Sbjct  34   VTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLAKEVEYLIRKGWV  93

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETEKGFVYRE   SPGYYDGRYWTMWKLPMFG TDA+QV+ ELEE KKAYP A++
Sbjct  94   PCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAFI  153

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDNKRQVQCI FIA++P+
Sbjct  154  RIIGFDNKRQVQCISFIAHRPE  175



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  37   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLREVEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+AE+EE KKAYP AW+
Sbjct  97   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAAQVLAEVEEAKKAYPQAWI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WV
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWV  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  100  PCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFI  159

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  160  RIIGFDNVRQVQCISFIAYKP  180



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+EQL K+V+YLL K  +
Sbjct  39   VTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC D++QV+ ELEECKKAYP A++
Sbjct  99   PCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQ I FIAYKP
Sbjct  159  RIIGFDNKRQVQIISFIAYKP  179



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+ EQLLK+VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLTDEQLLKEVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE G VYRE H SPGYYDGRYW MWKLPMFGCTDATQV+AE++ECKK+YP AW+
Sbjct  98   PCLEFETEHGIVYREKHKSPGYYDGRYWNMWKLPMFGCTDATQVLAEVQECKKSYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WV
Sbjct  37   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  96   PCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WV
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSPESLAKEVDYLLRKNWV  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++
Sbjct  100  PCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFI  159

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  160  RIIGFDNVRQVQCISFIAYKP  180



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWV
Sbjct  38   VTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLREVDYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   240 bits (613),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K+  D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS+EQLL ++EYLL  GWV
Sbjct  37   VSRKTNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE  +SPGYYDGRYWTMWKLPMFGCTDATQV AE++E KKAYP A +
Sbjct  97   PCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAHI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  157  RIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+S+NG RVQCMQVWPP   KKFETLSYLPPLS E L K+V+YLL  GW+
Sbjct  39   VTRKTNNDITSLSSNGGRVQCMQVWPPIAKKKFETLSYLPPLSPESLAKEVDYLLRMGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++
Sbjct  99   PCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  159  RIIGFDNKRQVQCISFIAYKP  179



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+
Sbjct  38   VTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+V
Sbjct  97   PCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFV  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  157  RIIGFDNKRQVQCISFIAYKP  177



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL +V YLL KGW+
Sbjct  38   VTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+EE KKAYP A+V
Sbjct  97   PCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAFV  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDNKRQVQCI FIAYKP 
Sbjct  157  RIIGFDNKRQVQCISFIAYKPS  178



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WV
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWV  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  100  PCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFI  159

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  160  RIIGFDNVRQVQCISFIAYKP  180



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L K+V+YLL K WV
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWV  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  100  PCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFI  159

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  160  RIIGFDNVRQVQCISFIAYKP  180



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D +S+ +NG RVQCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GW+
Sbjct  39   VTRKANNDISSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A++
Sbjct  99   PCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  159  RIIGFDNKRQVQCISFIAYKP  179



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+ EQL K+V+YLL KGW+
Sbjct  36   VTRKANNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTDEQLAKEVDYLLRKGWI  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGC+D+TQV+ EL+E KKAYP +++
Sbjct  96   PCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDSTQVLKELDEAKKAYPNSFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN+RQVQCI FIAYKP
Sbjct  156  RIIGFDNRRQVQCISFIAYKP  176



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGW  435
            VTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLL ++EYLL  GW
Sbjct  37   VTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGW  96

Query  434  VPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  255
            VPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  254  VRILGFDNKRQVQCIMFIAYKPD  186
            VRI+GFDN RQVQCI FIAYKP+
Sbjct  157  VRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            +T+K+ +D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL++E L K+V++LL   WV
Sbjct  39   ITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLAKEVDFLLRNKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ ELEE KKAYP A++
Sbjct  99   PCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGW  435
            VTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLLK+VEYLL  GW
Sbjct  37   VTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGW  96

Query  434  VPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  255
            VPCLEFETE GFVYRE ++SPGYYDGRYWTMWKLPMFGCTD TQV+AE++E K AYP AW
Sbjct  97   VPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAW  156

Query  254  VRILGFDNKRQVQCIMFIAYKPD  186
            +RI+GFDN RQVQCI FIAYKP+
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPE  179



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   238 bits (607),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L K+V+YLL K WV
Sbjct  37   VTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  96   PCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWV
Sbjct  39   VTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+V
Sbjct  98   PCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFV  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIA+KP
Sbjct  157  RIIGFDNKRQVQCISFIAFKP  177



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   238 bits (606),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS+ D +++ +NG +VQCMQVWPP G KKFETLSYLPPLS E LLK+V+YLLN GWV
Sbjct  41   VTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLLKEVQYLLNNGWV  100

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  101  PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  160

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQC+ FIAYKP
Sbjct  161  RIIGFDNVRQVQCVSFIAYKP  181



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   238 bits (606),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  36   VTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWV  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  95   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNVRQVQCISFIAYKP  175



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  38   VTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  97   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGW  435
            VTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP  S EQLL ++EYLL  GW
Sbjct  37   VTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDFSDEQLLSEIEYLLKNGW  96

Query  434  VPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAW  255
            VPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP AW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  254  VRILGFDNKRQVQCIMFIAYKPD  186
            VRI+GFDN RQVQCI FIAYKP+
Sbjct  157  VRIIGFDNVRQVQCISFIAYKPE  179



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            +TKKS+ DF+S+ +NG RVQCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLNKGW+
Sbjct  39   ITKKSSNDFSSLPSNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++
Sbjct  99   PCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQC+ FIAYKP
Sbjct  159  RIIGFDNKRQVQCVSFIAYKP  179



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V +K  +D T+I+ NG RVQCM VWPP G KKFETLSYLPPLS E L K+VEYLL KGWV
Sbjct  29   VPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFETLSYLPPLSIESLTKEVEYLLRKGWV  88

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC+DA+QV+ ELEECKK YP A+V
Sbjct  89   PCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCSDASQVMKELEECKKEYPTAFV  148

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  149  RIIGFDNKRQVQCISFIAYKP  169



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  36   VTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWV  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A+ 
Sbjct  95   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFT  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNVRQVQCISFIAYKP  175



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL +++EYLL   WV
Sbjct  38   VTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLAREIEYLLRNKWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP ++V
Sbjct  98   PCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNTRQVQCISFIASKP  178



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LLK++EYLL   WV
Sbjct  39   VTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELLKEIEYLLRMNWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL+E  K YP A+V
Sbjct  98   PCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVLKELDEAIKTYPNAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  158  RIIGFDNKRQVQCISFIAYKP  178



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL  GW+
Sbjct  37   TTRKNNRDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKAYP A++
Sbjct  97   PCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPDAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN+RQVQCI FIAYKP
Sbjct  157  RIIGFDNRRQVQCISFIAYKP  177



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G+KKFETLSYLPPLS E LLK+V+YLLN GWV
Sbjct  39   VTRKNN-DITSVASNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  98   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQC+ FIAYKP
Sbjct  158  RIIGFDNVRQVQCVSFIAYKP  178



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   235 bits (600),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+ AD +++ +NG + +CMQVWPP GLKKFETLSYLPPLSTE L K+VEYL+  GW+
Sbjct  37   ATRKANADLSTLLSNGGKARCMQVWPPEGLKKFETLSYLPPLSTEALAKEVEYLIRNGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE+HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYREYHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPDYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQC+ FIAYKP
Sbjct  156  RIIGFDNKRQVQCVSFIAYKP  176



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  38   VTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL E KKAYP A++
Sbjct  97   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELREAKKAYPEAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL +++EYLL   WV
Sbjct  38   VTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLAQEIEYLLRNKWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP +++
Sbjct  98   PCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNTRQVQCISFIASKP  178



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K A D T++++NG RVQCMQVWPP GLKKFETLSYLPPLS E L K+VEYLL   WV
Sbjct  38   VTRK-ANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTDA+QV+AELEE KK YP A++
Sbjct  97   PCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQC+ FIAYKP
Sbjct  157  RIIGFDNIRQVQCVSFIAYKP  177



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            KS+ D +S+ +NG RVQCMQVWPP G KKFETLSYLPPL+TE LL +V+YLLNKGW+PCL
Sbjct  43   KSSNDLSSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLTTEALLGEVQYLLNKGWIPCL  102

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV ELEE KKAYP A+VRI+
Sbjct  103  EFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNELEEVKKAYPQAFVRII  162

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFD  RQVQCI FIAYKP+
Sbjct  163  GFDKNRQVQCISFIAYKPE  181



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K     TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWV
Sbjct  38   VSRKQNLYITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVDYLLKNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  98   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  158  RIIGFDNVRQVQCISFIAYKPE  179



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L KQ+EYL+ KGW+
Sbjct  39   ATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + +
Sbjct  99   PCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHI  158

Query  251  RILGFDNKRQVQCIMFIAYKPDDK  180
            RI+GFDNKRQVQCI FIAYKP  K
Sbjct  159  RIIGFDNKRQVQCISFIAYKPPAK  182



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LLK++EYLL   WV
Sbjct  39   VTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELLKEIEYLLRMNWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV  EL+E  K YP A+V
Sbjct  98   PCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVFKELDEAIKTYPNAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  158  RIIGFDNKRQVQCISFIAYKP  178



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   234 bits (597),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS+++NG RVQCMQVWPP G+KK+ETLSYLPPL+TE LL +V+YLLNKGW+
Sbjct  30   VTKKND-DITSLASNGGRVQCMQVWPPIGMKKYETLSYLPPLTTESLLAEVQYLLNKGWI  88

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGCTD  QVV EL+ECKKAYP A++
Sbjct  89   PCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPAQVVNELDECKKAYPNAFI  148

Query  251  RILGFDNKRQVQCIMFI  201
            RI+GFDNKRQVQCI FI
Sbjct  149  RIIGFDNKRQVQCISFI  165



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL+K+VEYL+ KGWV
Sbjct  37   VTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLVKEVEYLIRKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++
Sbjct  97   PCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA+ P
Sbjct  157  RIIGFDNVRQVQCISFIAHTP  177



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLNKGW+
Sbjct  41   VTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNKGWI  99

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++
Sbjct  100  PCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPTAFI  159

Query  251  RILGFDNKRQVQCIMFIAYKPDD  183
            RI+GFDNKRQVQC+ FIAYKP D
Sbjct  160  RIIGFDNKRQVQCVSFIAYKPAD  182



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  39   VTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  98   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  158  RIIGFDNVRQVQCISFIAYKP  178



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+K+V+YLLN GWV
Sbjct  39   VTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLIKEVQYLLNNGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  98   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  158  RIIGFDNVRQVQCISFIAYKP  178



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS  QLL++VEYLL  GWV
Sbjct  38   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLS--QLLREVEYLLKNGWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  96   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  155

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  156  RIIGFDNVRQVQCISFIAYKPE  177



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV
Sbjct  37   VTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++
Sbjct  97   PCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA+ P
Sbjct  157  RIIGFDNVRQVQCISFIAHTP  177



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = -1

Query  611  VTKKSAADFTSIS--TNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKG  438
            VT+K+  D TS+   +NG RVQCMQVWPP G KKFETLSYLPPLS E L K+V+YLL  G
Sbjct  39   VTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFETLSYLPPLSPESLAKEVDYLLRMG  98

Query  437  WVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGA  258
            W+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AELEE KKAYP A
Sbjct  99   WIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNA  158

Query  257  WVRILGFDNKRQVQCIMFIAYKP  189
            ++RI+GFDNKRQVQCI FIAYKP
Sbjct  159  FIRIIGFDNKRQVQCISFIAYKP  181



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L KQ+EYL+ KGW+
Sbjct  39   ATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSLESLAKQIEYLILKGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL+E  K YP + +
Sbjct  99   PCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  159  RIIGFDNKRQVQCISFIAYKP  179



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL K+++YLL   WV
Sbjct  38   VTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLAKEIDYLLRMKWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT A+QV+ ELEE KKAYP +++
Sbjct  98   PCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNVRQVQCISFIASKP  178



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            ++KKS  D TS++TNG RVQCMQVWPP GLKK+ETLSYLP L+ EQLLK+++YL+  GWV
Sbjct  39   ISKKSV-DITSLATNGGRVQCMQVWPPRGLKKYETLSYLPDLTDEQLLKEIDYLIRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+ EC K YP  WV
Sbjct  98   PCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCWV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNVRQVQCISFIAAKP  178



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LLK++ YLL  GW+
Sbjct  39   ATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++V
Sbjct  99   PCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFV  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI F+A KP
Sbjct  159  RIIGFDNKRQVQCISFLAAKP  179



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   233 bits (593),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLP L+ EQL K+V+YLL  GWV
Sbjct  39   VTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPQLTQEQLSKEVDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++
Sbjct  98   PCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPNAYI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA+KP
Sbjct  158  RIIGFDNVRQVQCISFIAFKP  178



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LLK++ YL+  GW+
Sbjct  39   ATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLIRSGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+ E +K YP ++V
Sbjct  99   PCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFV  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIA KP
Sbjct  159  RIIGFDNKRQVQCISFIAAKP  179



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D T++++NG +V CMQVWPP G KKFETLSYLPPLS E L K+V+YLL  GWV
Sbjct  37   VTRKQNNDITTLASNGGKVHCMQVWPPVGKKKFETLSYLPPLSEESLAKEVDYLLRMGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGR WTMWKLPMFGCTD++QV+ ELEE KKAYP +++
Sbjct  97   PCLEFELEHGFVYRENHRSPGYYDGRCWTMWKLPMFGCTDSSQVLKELEEAKKAYPNSFI  156

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDNKRQVQCI FIAYKP 
Sbjct  157  RIIGFDNKRQVQCISFIAYKPS  178



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ +QL K+VEYL+ KGWV
Sbjct  34   VTKKTNNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTEDQLAKEVEYLIRKGWV  93

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL E K AYP +++
Sbjct  94   PCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESFI  153

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA+ P
Sbjct  154  RIIGFDNVRQVQCISFIAHTP  174



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L K+V+YLL K WVPCL
Sbjct  43   KKTNDITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCL  102

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P +++RI+
Sbjct  103  EFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRII  162

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFDN RQVQCI FIAYKP
Sbjct  163  GFDNVRQVQCISFIAYKP  180



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T K A DF+++ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL K+V+YLL K WVP
Sbjct  36   TTKKANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLRKKWVP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL ECKK YP AW+R
Sbjct  96   CLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAWIR  155

Query  248  ILGFDNKRQVQCIMFIAYKPD  186
            I+GFDN RQVQCIMFIA +PD
Sbjct  156  IIGFDNVRQVQCIMFIASRPD  176



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS+++NG RVQCMQ WPP G+KK+ETLSYLPPL+TE LL +V+YLLNKGW+
Sbjct  30   VTKKND-DITSLASNGGRVQCMQAWPPIGMKKYETLSYLPPLTTESLLAEVQYLLNKGWI  88

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGC D  QVV EL+ECKKAYP A++
Sbjct  89   PCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCIDPAQVVNELDECKKAYPNAFI  148

Query  251  RILGFDNKRQVQCIMFI  201
            RI+GFDNKRQVQCI FI
Sbjct  149  RIIGFDNKRQVQCISFI  165



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPL+TE LL +V+YLLNKGWV
Sbjct  29   VTKKND-DITSLASNGGRVQCMQVWPPVGKKKFETLSYLPPLTTESLLSEVQYLLNKGWV  87

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQVV ELEE KKAYP A++
Sbjct  88   PCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDPTQVVNELEEAKKAYPNAFI  147

Query  251  RILGFDNKRQVQCIMFI  201
            RI+GFD+ RQVQCI FI
Sbjct  148  RIIGFDSFRQVQCISFI  164



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D T+++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL K+VEYLL KGWV
Sbjct  39   VTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFETLSYLPDLTREQLAKEVEYLLRKGWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGC+DA QV+ EL+E  KAYP ++V
Sbjct  99   PCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDAVQVLKELDEAIKAYPNSFV  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L K+V+YLL K WVPCL
Sbjct  42   KKTNDITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCL  101

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ ELEE KKA P +++RI+
Sbjct  102  EFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRII  161

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFDN RQVQCI FIAYKP
Sbjct  162  GFDNVRQVQCISFIAYKP  179



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL QV+YLLN GW+
Sbjct  38   VTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLLNNGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+EE KKAYP A++
Sbjct  97   PCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQC+ FIA+KP
Sbjct  157  RIIGFDNKRQVQCVSFIAFKP  177



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   231 bits (588),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGW+
Sbjct  37   VTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKGFVYRE H SPGYYDGRYWTMW+LP+FG TD++QV+ EL +CK  YP +++
Sbjct  97   PCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFI  156

Query  251  RILGFDNKRQVQCIMFIAYKPDD  183
            RI+GFDN RQVQCI FIA+ P +
Sbjct  157  RIIGFDNVRQVQCISFIAHTPKN  179



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
             +K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQLLK+VEYLL KGWVP
Sbjct  39   VRKVNNDITSIASNGGRVHCMQVWPPIGKKKFETLSYLPPLTEEQLLKEVEYLLRKGWVP  98

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE EKGFVYRE + SPGYYDGRYWTMWKLP+FGCT+A QV+ EL+E  KAYP A+VR
Sbjct  99   CLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCTEAVQVLKELQEVVKAYPNAFVR  158

Query  248  ILGFDNKRQVQCIMFIAYKPDD  183
            I+GFDN RQVQCI FIA+ P +
Sbjct  159  IIGFDNVRQVQCISFIAHTPKE  180



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  605  KKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPC  426
            KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPC
Sbjct  39   KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPC  98

Query  425  LEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRI  246
            LEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI
Sbjct  99   LEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRI  158

Query  245  LGFDNKRQVQCIMFIAYKPDD  183
            +GFDN RQVQCI FIA+ P+ 
Sbjct  159  IGFDNVRQVQCISFIAHTPES  179



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  37   ATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++KS  D TS++TNG RV CMQVWPP  LKKFETLSYLP LS E LLK++ YLL KGWV
Sbjct  36   VSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLLIKGWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE     VYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV AE+ ECK AYP A V
Sbjct  96   PCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAHV  155

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDNKRQVQCI FIAYKP+
Sbjct  156  RIIGFDNKRQVQCISFIAYKPE  177



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   230 bits (587),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WV
Sbjct  39   VSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A++
Sbjct  99   PCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  159  RIIGFDNTRQVQCISFIAAKP  179



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  37   ATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   230 bits (586),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  605  KKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPC  426
            KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVPC
Sbjct  39   KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPC  98

Query  425  LEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRI  246
            LEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI
Sbjct  99   LEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRI  158

Query  245  LGFDNKRQVQCIMFIAYKPDD  183
            +GFDN RQVQCI FIA+ P+ 
Sbjct  159  IGFDNVRQVQCISFIAHTPES  179



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WV
Sbjct  39   VSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ ELEE KKAYP A++
Sbjct  99   PCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  159  RIIGFDNTRQVQCISFIAAKP  179



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP A++R
Sbjct  96   CLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D T++++NG RVQCM+VWPP GLKKFETLSYLP +S EQL K+V+YLL KGW+
Sbjct  39   VTRKNN-DITTLASNGGRVQCMKVWPPLGLKKFETLSYLPDMSNEQLGKEVDYLLRKGWI  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QVV E+EE KK YP A++
Sbjct  98   PCIEFDIHSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVVNEIEEAKKEYPDAYI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFDN RQVQCI FIAYKP
Sbjct  158  RVIGFDNVRQVQCISFIAYKP  178



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKKS  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL K+VEYLL   WV
Sbjct  37   VTKKSN-DFSSLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLAKEVEYLLRNKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GF YRE + SPGYYDGRYWTMWKLPMFGC DA+QV+ EL ECKK YP +WV
Sbjct  96   PCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCNDASQVLKELNECKKEYPQSWV  155

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIA+KPD
Sbjct  156  RIIGFDNVRQVQCISFIAHKPD  177



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ PD
Sbjct  161  GFDNVRQVQCISFIAHTPD  179



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ PD
Sbjct  161  GFDNVRQVQCISFIAHTPD  179



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ PD
Sbjct  161  GFDNVRQVQCISFIAHTPD  179



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ PD
Sbjct  161  GFDNVRQVQCISFIAHTPD  179



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCM VWPP G+KKFETLSYLPPLS E LLK+V+YLLN GWV
Sbjct  39   VTRKNN-DITSVASNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLLKEVQYLLNNGWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAELEE KKAYP A++
Sbjct  97   PCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQC+ FIAYKP
Sbjct  157  RIIGFDNVRQVQCVSFIAYKP  177



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL K+V+YLL KGWV
Sbjct  39   VTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLRKEVDYLLRKGWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE   GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+E K AYP A+V
Sbjct  99   PCLEFEVGYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKELQEAKAAYPKAFV  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   228 bits (582),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCL
Sbjct  40   KKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCL  99

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+
Sbjct  100  EFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRII  159

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFD+ RQVQC+ FIAYKP
Sbjct  160  GFDSNRQVQCVSFIAYKP  177



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   228 bits (582),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLPPL+ E+L K+V+YLL  GWV
Sbjct  39   VTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPPLTNEELAKEVDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E G+VYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++
Sbjct  98   PCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLNEVEECKKEYPNAFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA+KP
Sbjct  158  RIIGFDNVRQVQCISFIAFKP  178



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCL
Sbjct  40   KKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCL  99

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+
Sbjct  100  EFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRII  159

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFD+ RQVQC+ FIAYKP
Sbjct  160  GFDSNRQVQCVSFIAYKP  177



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  37   ATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL K+V+YL+  GW+
Sbjct  33   VTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQAQLGKEVDYLIRLGWI  92

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF  + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP +++
Sbjct  93   PCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQSFI  152

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FI YKP
Sbjct  153  RIIGFDNKRQVQCISFICYKP  173



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SP YYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVW P G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWAPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   228 bits (580),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L K+++YL+   W+
Sbjct  37   VTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+ ECKK YP A++
Sbjct  97   PCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFDN RQVQCI FI  KP
Sbjct  157  RVIGFDNIRQVQCISFIVAKP  177



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   227 bits (579),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D  SI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDTISIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   227 bits (579),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+  +L K+++YLL   WV
Sbjct  38   VSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEAELAKEIDYLLRSKWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL+E KKAYP A++
Sbjct  98   PCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCTEASQVLVELQEAKKAYPNAFI  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNVRQVQCISFIAAKP  178



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  + +++ +NG +V CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  37   ATRKANKNLSTLPSNGGKVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ P+
Sbjct  161  GFDNVRQVQCISFIAHTPE  179



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ P+
Sbjct  161  GFDNVRQVQCISFIAHTPE  179



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA+ P+
Sbjct  161  GFDNVRQVQCISFIAHTPE  179



>sp|P12468.1|RBS4_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Glycine max]
 gb|AAA34008.1| ribulose 1,5-bisphosphate carboxylase [Glycine max]
 prf||1306410A ribulose bisphosphate carboxylase S
Length=178

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + S GYYDGRYWTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSLGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L K+++YLL   WV
Sbjct  39   VSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELAKEIDYLLRSKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG+V+RE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL E KKAYP A++
Sbjct  99   PCLEFELEKGWVHREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLVELGEAKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  159  RIIGFDNTRQVQCISFIAAKP  179



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVVAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFDN RQVQCI FIA+ P
Sbjct  161  GFDNVRQVQCISFIAHTP  178



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGR WTMWKLPMFGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYREHNRSPGYYDGRCWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            +T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWV
Sbjct  39   ITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++
Sbjct  99   PCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFDN RQVQCI FIAYKP
Sbjct  159  RVIGFDNVRQVQCISFIAYKP  179



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            +T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWV
Sbjct  39   ITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++
Sbjct  99   PCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFDN RQVQCI FIAYKP
Sbjct  159  RVIGFDNVRQVQCISFIAYKP  179



>gb|KEH21539.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL K+VEYL+ KGWV CL
Sbjct  41   KVNKDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLAKEVEYLIRKGWVACL  100

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL+E   AYP A+VRI+
Sbjct  101  EFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKELDEVVDAYPNAFVRII  160

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFD  RQVQCI FIA+ PD
Sbjct  161  GFDKVRQVQCISFIAHTPD  179



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  605  KKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPC  426
            +K+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL K+VEYLL  GWVPC
Sbjct  40   RKTTNDITSIASNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLAKEVEYLLRSGWVPC  99

Query  425  LEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRI  246
            LEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KA+P  +VRI
Sbjct  100  LEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGFVRI  159

Query  245  LGFDNKRQVQCIMFIAYKP  189
            +GFD+ RQVQCI FIAYKP
Sbjct  160  IGFDSYRQVQCISFIAYKP  178



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  D TSI++NGSRV CMQVWPP G KKFETLSYLPPL+ EQLLK+VEYLL KGWV
Sbjct  36   VTKKNN-DITSITSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLLRKGWV  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE EKGFV+R++++SPGYYDGRYWTMW+LP+FG TDA QV+ E+ ECK  YP A++
Sbjct  95   PCVEFELEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDAAQVLKEVAECKAEYPEAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA  P
Sbjct  155  RIIGFDNVRQVQCISFIASTP  175



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL K+VEYLL KGW+P
Sbjct  36   TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIP  95

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE H SPGYYDGRYWTMWKLP+FGCTDA+QV+ EL+E K AYP  ++R
Sbjct  96   CLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGFIR  155

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  156  IIGFDNVRQVQCISFIAYKP  175



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L K+++YL+   WV
Sbjct  37   VTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+ ECKK YP A++
Sbjct  97   PCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFD+ RQVQCI FI  KP
Sbjct  157  RVIGFDSVRQVQCISFIVSKP  177



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   225 bits (574),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL K+V+YL+  GW+
Sbjct  33   VTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQVQLGKEVDYLIRLGWI  92

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF    GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+EECKK YP A++
Sbjct  93   PCLEFSVVGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQAFI  152

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIA KP
Sbjct  153  RIIGFDNKRQVQCISFIACKP  173



>sp|P19309.1|RBS3_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40A, 
chloroplastic; Short=RuBisCO small subunit SSU40A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35102.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  + +++  NG RV CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  37   ATRKANNNLSTLPGNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  97   PCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  156  RIIGFDNKRQVQCISFIAYKP  176



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  605  KKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPC  426
            +K+  D TSI+ NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL K+VEYLL  GWVPC
Sbjct  40   RKTTNDITSIAGNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLAKEVEYLLRSGWVPC  99

Query  425  LEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRI  246
            LEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL+E  KA+P  +VRI
Sbjct  100  LEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGFVRI  159

Query  245  LGFDNKRQVQCIMFIAYKP  189
            +GFD+ RQVQCI FIAYKP
Sbjct  160  IGFDSYRQVQCISFIAYKP  178



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WV
Sbjct  40   VTRK-ANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPPLSPESLAKEVDYLLRKNWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            P LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ ELEE K AYP +++
Sbjct  99   PTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKELEEAKTAYPNSFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQ QCI FIAY+P
Sbjct  159  RIIGFDNVRQTQCISFIAYQP  179



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            ++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLLK+++YL+  GW+
Sbjct  39   ISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLLKEIDYLIRNGWI  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  WV
Sbjct  98   PCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCWV  157

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIA KP
Sbjct  158  RIIGFDNVRQVQCISFIAAKP  178



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>sp|P00872.2|RBS1_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU1, 
chloroplastic; Short=RuBisCO small subunit SSU1; Flags: 
Precursor [Lemna gibba]
 emb|CAA35104.1| unnamed protein product [Lemna gibba]
Length=173

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D +++ ++G RV CMQVWPP GLKKFETLSYLPPLS E L K+V+YLL   WV
Sbjct  33   ATRKANNDLSTLPSSGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWV  92

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF  E GFVYRE +ASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+EE KKAYP  +V
Sbjct  93   PCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFV  151

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDNKRQVQCI FIAYKP
Sbjct  152  RIIGFDNKRQVQCISFIAYKP  172



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AAA33686.1| ribulose 1,5-bisphosphate carboxylase small subunit propeptide, 
partial [Pisum sativum]
Length=156

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
             KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL KGWVP
Sbjct  14   VKKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVP  73

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE EKGFVYRE + SP YYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VR
Sbjct  74   CLEFELEKGFVYREHNKSPRYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVR  133

Query  248  ILGFDNKRQVQCIMFIAYKPDD  183
            I+GFDN RQVQCI FIA+ P+ 
Sbjct  134  IIGFDNVRQVQCISFIAHTPES  155



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKTNKDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WV
Sbjct  40   VTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLAKEVDYLLRKNWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            P LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E+EE K AYP +++
Sbjct  99   PTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEVEEAKTAYPNSFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQ QCI FIAY+P
Sbjct  159  RIIGFDNVRQTQCISFIAYQP  179



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  159  RIIGFDNVRQVQCISFIAYKPE  180



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT K+  D TS+++NGS+V CMQVWPP G KKFETLSYLP LS   L K+V+YLL   W+
Sbjct  39   VTHKTNFDITSLASNGSKVHCMQVWPPVGKKKFETLSYLPDLSEVSLAKEVDYLLRNKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE + SPGYYDGRYWTMWKLP+FGCTD++QV+ E+EECKK YP A++
Sbjct  99   PCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSSQVLKEVEECKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNSRQVQCISFIAYKP  179



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 119/141 (84%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L K+V+YLL K WV
Sbjct  40   VTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLAKEVDYLLRKNWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            P LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E EE K AYP +++
Sbjct  99   PTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEXEEAKTAYPNSFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQ QCI FIAY+P
Sbjct  159  RIIGFDNVRQTQCISFIAYQP  179



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  23   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNTRQVQCISFIAYKP  163



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  23   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNTRQVQCISFIAYKP  163



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  23   VTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNTRQVQCISFIAYKP  163



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            +T+K+  D T++++N  +VQCM+VWPP GL+KFETLSYLP +S EQL K+ +YLL  GWV
Sbjct  39   ITRKNNVDITTLASNAGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EF+   GFVYRE H SPG+YDGRYWTMWKLPMFGCTD++QV+ E+EE KK YP A++
Sbjct  99   PCVEFDIGSGFVYRENHRSPGFYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            R++GFDN RQVQCI FIAYKP
Sbjct  159  RVIGFDNVRQVQCISFIAYKP  179



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  159  RIIGFDNVRQVQCISFIAYKPE  180



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSVEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWV
Sbjct  22   VTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLREVDYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   223 bits (567),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   222 bits (565),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   222 bits (565),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSIS+ G RVQCMQVWPP G K FETLSYLPPLS +QL K+V YLL    V
Sbjct  16   VTRKNNTDITSISSKGGRVQCMQVWPPVGKKFFETLSYLPPLSQDQLAKEVHYLLRMDRV  75

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEE K AYP +++
Sbjct  76   PCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKTAYPNSFI  135

Query  251  RILGFDNKRQVQCIMFIA  198
            RI+GFDNKRQVQCI FIA
Sbjct  136  RIIGFDNKRQVQCISFIA  153



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   222 bits (565),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K + D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLLK+++YL+  GW+PCL
Sbjct  18   KKSVDITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLLKEIDYLIRNGWIPCL  77

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+ EC K YP  WVRI+
Sbjct  78   EFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCWVRII  137

Query  242  GFDNKRQVQCIMFIAYKP  189
            GFDN RQVQCI FIA KP
Sbjct  138  GFDNVRQVQCISFIAAKP  155



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L K+V+YL+   W+
Sbjct  35   ATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A +
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNALI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   222 bits (566),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   ATRKANNDITSITSNGGRVNCMQVWPPVGKKKFETLSYLPDLTDSELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNSRQVQCISFIAYKP  175



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (564),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   222 bits (566),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K A DF+++ +NG RVQCM+VWPP G KK+ETLSYLP L+  QL K+V+YLL   WVPCL
Sbjct  38   KKANDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPNLTEAQLAKEVDYLLRNKWVPCL  97

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+
Sbjct  98   EFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRII  157

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA KPD
Sbjct  158  GFDNVRQVQCISFIASKPD  176



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI+FIAYKP
Sbjct  155  RIIGFDNNRQVQCIIFIAYKP  175



>gb|AAA33685.2| ribulose 1,5 bisphosphate carboxylase, partial [Pisum sativum]
Length=139

 Score =   221 bits (562),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  593  ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFE  414
             D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLLK+VEYLL K WVPCLEFE
Sbjct  2    TDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKPWVPCLEFE  61

Query  413  TEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFD  234
             EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL+E   AYP A+VRI+GFD
Sbjct  62   LEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFD  121

Query  233  NKRQVQCIMFIAYKPD  186
            N RQVQCI FIA+ P+
Sbjct  122  NVRQVQCISFIAHTPE  137



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (563),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPRAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  96   PCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L K+V+YL+   W+
Sbjct  23   ATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  83   PCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNTRQVQCISFIAYKP  163



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL ++EYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLLSEIEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+ E KKAYP AW+
Sbjct  82   PCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  23   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YPGA++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNTRQVQCISFIAYKP  163



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT++++ DF+ + +NG RV+CMQVWP  G KKFETLSYLPPLS E LLKQ+EYLL  GW+
Sbjct  38   VTRRASNDFSKLPSNGGRVRCMQVWPIEGKKKFETLSYLPPLSIEALLKQIEYLLRSGWI  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  EL+ECKK YP  ++
Sbjct  98   PCLEF-CKVGFVYRENHQSPGYYDGRYWTMWKLPMFGCNDAAQVAKELDECKKEYPDVFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELE CKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELENCKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIAYKP+
Sbjct  159  RIIGFDNVRQVQCISFIAYKPE  180



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL +VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELE CKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELENCKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB43047.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
 gb|KJB43048.1| hypothetical protein B456_007G181400 [Gossypium raimondii]
Length=179

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  96   PCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  31   VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A++
Sbjct  91   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI+FIAYKP
Sbjct  151  RIIGFDNNRQVQCIIFIAYKP  171



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++V+YLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVDYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  590  DFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFET  411
            D T++++NG RVQCMQVWPP G  KFETLSYLP L+ EQLLK+++YLL   W+PCLEFE 
Sbjct  46   DITALASNGGRVQCMQVWPPRGKLKFETLSYLPDLTDEQLLKEIDYLLRSNWIPCLEFEV  105

Query  410  EKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDN  231
             K  +YRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE++E KKAYP A VRI+GFDN
Sbjct  106  GKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQETKKAYPDAHVRIIGFDN  165

Query  230  KRQVQCIMFIAYKPDDK  180
             RQVQCI FIAYKP  K
Sbjct  166  NRQVQCISFIAYKPPAK  182



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELE CKK YP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELENCKKEYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010521010.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+ AD TS+++NGS+V CMQVWP  GL+KFETLSYLP LS  +L K+V+YLL   W+
Sbjct  37   VTRKNNADLTSLASNGSKVNCMQVWPTTGLRKFETLSYLPDLSDTELAKEVDYLLRNNWI  96

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE    FVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+E K  +P A +
Sbjct  97   PCLEFELGNAFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQEAKTTHPDAHI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL  L+  QL K+V+YLL   WV
Sbjct  39   VTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLTDLTPVQLAKEVDYLLRSKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A++
Sbjct  99   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELEECKKAYPNAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K A DF+++  NG RVQCM+VWPP GLKK+ETLSYLP L+  QL K+V+YLL   WVPCL
Sbjct  38   KKANDFSTLPNNGGRVQCMKVWPPLGLKKYETLSYLPTLTETQLAKEVDYLLRNKWVPCL  97

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE E GFVYRE   SPGYYDGR+WTMWKLPMFGCTD+ QV+ E+ ECKK YP AW+RI+
Sbjct  98   EFELEHGFVYREHARSPGYYDGRHWTMWKLPMFGCTDSAQVLKEVGECKKEYPQAWIRII  157

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA KPD
Sbjct  158  GFDNVRQVQCISFIASKPD  176



>gb|AAF06100.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPPLS EQL  +++YLL  GW+
Sbjct  39   ATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPPLSREQLASEIDYLLRSGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYR   + PGYYDGRYWTMWKLPMFGCTD++QV+ EL+E  KA+P  + 
Sbjct  99   PCLEFELEHGFVYRAHGSLPGYYDGRYWTMWKLPMFGCTDSSQVLKELDELIKAHPDGFA  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AGV54682.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
Length=180

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ EQL K+V+YLL KGWVP
Sbjct  38   SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTQEQLAKEVDYLLRKGWVP  97

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++R
Sbjct  98   CLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIR  157

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  158  IIGFDNVRQVQCISFIAYKP  177



>ref|XP_007151650.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 ref|XP_007151651.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
 gb|ESW23644.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 gb|ESW23645.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
Length=180

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ EQL K+V+YLL KGWVP
Sbjct  38   SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTKEQLAKEVDYLLRKGWVP  97

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++R
Sbjct  98   CLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIR  157

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  158  IIGFDNVRQVQCISFIAYKP  177



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>ref|XP_007033270.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY04196.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
Length=184

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+ E+L K+VEYLL   WV
Sbjct  39   VARKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTRERLFKEVEYLLRNKWV  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE    PGYYDGR W MWKLPMFGCTDA+QV+ EL+E KK YP A++
Sbjct  99   PCLEFELEHGFVYRENLRIPGYYDGRCWIMWKLPMFGCTDASQVLKELDEAKKTYPTAFI  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN+RQVQCI FIAYKP
Sbjct  159  RIIGFDNRRQVQCISFIAYKP  179



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>gb|AAF06098.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
 gb|AAF06101.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPPLS EQL  +++YLL  GW+
Sbjct  39   ATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPPLSREQLASEIDYLLRSGWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYR   + PGYYDGRYWTMWKLPMFGCTD++QV+ EL+E  KA+P  + 
Sbjct  99   PCLEFELEHGFVYRAHGSLPGYYDGRYWTMWKLPMFGCTDSSQVLKELDELIKAHPDGFA  158

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  159  RIIGFDNVRQVQCISFIAYKP  179



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG +V CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGKVSCMKVWPPIGKKKFETLSYLPDLSDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  31   VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E++ECK  YP A++
Sbjct  91   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  151  RIIGFDNNRQVQCISFIAYKP  171



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   WV
Sbjct  36   VIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWV  95

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  96   PCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  155

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  156  RIIGFDNVRQVQCISFIAYKP  176



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK   DF+++++NG RVQCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WV
Sbjct  31   VTKK-VNDFSTLASNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWV  89

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+
Sbjct  90   PCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWI  149

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIA KPD
Sbjct  150  RIIGFDNVRQVQCISFIASKPD  171



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   220 bits (561),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   220 bits (561),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   219 bits (559),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCL
Sbjct  32   KKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCL  91

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+
Sbjct  92   EFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRII  151

Query  242  GFDNKRQVQCIMFI  201
            GFD+ RQVQC+ FI
Sbjct  152  GFDSNRQVQCVSFI  165



>ref|XP_009403968.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYLP L  E LLKQ+EYLL   W+
Sbjct  39   VTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYLPTLVDEVLLKQIEYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCTDATQV  ELEECKK YP A+V
Sbjct  99   PCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCTDATQVAKELEECKKEYPRAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIA+KPD
Sbjct  158  RIIGFDNNRQVQCISFIAHKPD  179



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  31   VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A++
Sbjct  91   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  151  RIIGFDNNRQVQCISFIAYKP  171



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WV
Sbjct  31   VTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLLRNKWV  89

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+
Sbjct  90   PCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWI  149

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIA KPD
Sbjct  150  RIIGFDNVRQVQCISFIASKPD  171



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL K+++YLL  GWV
Sbjct  39   VTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWV  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKKAYP A+V
Sbjct  98   PCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAFV  157

Query  251  RILGFDNK  228
            RI+GFDN 
Sbjct  158  RIIGFDNN  165



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCL
Sbjct  32   KKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCL  91

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+
Sbjct  92   EFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRII  151

Query  242  GFDNKRQVQCIMFI  201
            GFD+ RQVQC+ FI
Sbjct  152  GFDSNRQVQCVSFI  165



>emb|CAA42618.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
 emb|CAA40339.1| small subunit of ribulose 1,5-bisphosphate carboxylase/oxygenase 
[Phaseolus vulgaris]
Length=180

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  608  TKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVP  429
            ++K   D TS++ NG RVQC+QVWP  G KKFETLSYLPPL+ +QL K+V+YLL KGWVP
Sbjct  38   SRKMNNDITSVANNGGRVQCIQVWPTVGKKKFETLSYLPPLTKQQLAKEVDYLLRKGWVP  97

Query  428  CLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVR  249
            CLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ EL E + A+P  ++R
Sbjct  98   CLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIR  157

Query  248  ILGFDNKRQVQCIMFIAYKP  189
            I+GFDN RQVQCI FIAYKP
Sbjct  158  IIGFDNVRQVQCISFIAYKP  177



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K   D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL +QV+YLLN  WVPCL
Sbjct  32   KKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCL  91

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ ELEECKK YP A++RI+
Sbjct  92   EFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRII  151

Query  242  GFDNKRQVQCIMFI  201
            GFD+ RQVQC+ FI
Sbjct  152  GFDSNRQVQCVSFI  165



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -1

Query  602  KSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCL  423
            K A DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WVPCL
Sbjct  38   KKANDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEAQLAKEVDYLLRNKWVPCL  97

Query  422  EFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRIL  243
            EFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+RI+
Sbjct  98   EFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRII  157

Query  242  GFDNKRQVQCIMFIAYKPD  186
            GFDN RQVQCI FIA KP+
Sbjct  158  GFDNVRQVQCISFIASKPE  176



>ref|XP_006663954.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   219 bits (558),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V+++S +      +NG R++CMQVWP  G+KKFETLSYLPPLS E LLKQ+EYLL   WV
Sbjct  27   VSRRSGSSTLGNVSNGGRIKCMQVWPIEGIKKFETLSYLPPLSVEDLLKQIEYLLRSKWV  86

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF ++ GFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ ELEE KKAYP A+V
Sbjct  87   PCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAFV  145

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  146  RIIGFDNVRQVQCISFIAYKP  166



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  31   VTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELSKEVDYLLRNKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  91   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  151  RIIGFDNNRQVQCISFIAYKP  171



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  31   VTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A++
Sbjct  91   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  151  RIIGFDNNRQVQCISFIAYKP  171



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   219 bits (558),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  23   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNNRQVQCISFIAYKP  163



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL K+V+YLL   W+
Sbjct  31   VTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWI  90

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E+GFV+R++ + PGYYDGRYWTMWKLPMFGCTD+ QV+ ELEECKK YP A++
Sbjct  91   PCLEFELEEGFVHRKYSSLPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFI  150

Query  251  RILGFDNKRQVQCIMFIA  198
            RI+GFDN RQVQCI FIA
Sbjct  151  RIIGFDNVRQVQCISFIA  168



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T++++ DF+ + +NG RVQCM+VWP  G+KKFETLSYLPPL  E LLKQ+EYLL   W+
Sbjct  38   ATRRASNDFSKLPSNGGRVQCMKVWPIEGVKKFETLSYLPPLPIEALLKQIEYLLRSRWI  97

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  ELEECKK YP A++
Sbjct  98   PCLEF-CKIGFVYRENHRSPGYYDGRYWTMWKLPMFGCNDAAQVAKELEECKKEYPDAFI  156

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  157  RIIGFDNVRQVQCISFIAYKP  177



>gb|AAG40356.1|AF325004_1 At1g67090 [Arabidopsis thaliana]
Length=180

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L K+V+YL+   W+
Sbjct  35   ATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   SP YYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  95   PCVEFELEHGFVYREHGNSPRYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTEVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFV+RE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELENGFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPQAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
             T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  23   ATRKANNDITSITSNGGRVNCMKVWPPVGKKKFETLSYLPDLTDSELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK YP A++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNNRQVQCISFIAYKP  163



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  23   VTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  82

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  83   PCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFI  142

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  143  RIIGFDNNRQVQCISFIAYKP  163



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  103  VTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  162

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A++
Sbjct  163  PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFI  222

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  223  RIIGFDNNRQVQCISFIAYKP  243



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPDLTEVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E  FV+RE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECKK YP A++
Sbjct  95   PCVEFELENAFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPQAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNTRQVQCISFIAYKP  175



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L K+V+YLL   W+
Sbjct  35   VTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWI  94

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E++ECK  YP A++
Sbjct  95   PCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFI  154

Query  251  RILGFDNKRQVQCIMFIAYKP  189
            RI+GFDN RQVQCI FIAYKP
Sbjct  155  RIIGFDNNRQVQCISFIAYKP  175



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL K+V+YLL   WV
Sbjct  31   VTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWV  89

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL+ECKK YP AW+
Sbjct  90   PCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWI  149

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
            RI+GFDN RQVQCI FIA KPD
Sbjct  150  RIIGFDNVRQVQCISFIASKPD  171



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            V++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL++VEYLL  GWV
Sbjct  22   VSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLLKNGWV  81

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEFETE GFVYRE + SPGYYDGRYWTM KLPMFGCTDATQV+AE+EE KKAYP AW+
Sbjct  82   PCLEFETEHGFVYRENNKSPGYYDGRYWTMRKLPMFGCTDATQVLAEVEEAKKAYPQAWI  141

Query  251  RILGFDNKRQV  219
            RI+GFDN RQV
Sbjct  142  RIIGFDNVRQV  152



>gb|ABA46901.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=181

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYLP L  E LLKQ+EYLL   W+
Sbjct  39   VTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYLPTLVDEVLLKQIEYLLRSKWI  98

Query  431  PCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWV  252
            PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCTDATQV  ELEECKK YP A+V
Sbjct  99   PCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCTDATQVAKELEECKKEYPRAFV  157

Query  251  RILGFDNKRQVQCIMFIAYKPD  186
             I+GFDN RQVQCI FIA+KPD
Sbjct  158  GIIGFDNNRQVQCISFIAHKPD  179



>ref|NP_001119331.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94313.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=186

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 118/146 (81%), Gaps = 5/146 (3%)
 Frame = -1

Query  611  VTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWV  432
            VT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L K+V+YLL   W+
Sbjct  35   VTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWI  94

Query  431  PCLEFE-----TEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELEECKKAY  267
            PC+EFE     T+ GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+EECKK Y
Sbjct  95   PCVEFELEVINTKHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEY  154

Query  266  PGAWVRILGFDNKRQVQCIMFIAYKP  189
            PGA++RI+GFDN RQVQCI FIAYKP
Sbjct  155  PGAFIRIIGFDNTRQVQCISFIAYKP  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230