BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043F24

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794279.1|  PREDICTED: hydroxyphenylpyruvate reductase         163   2e-44   Nicotiana sylvestris
ref|XP_009588864.1|  PREDICTED: hydroxyphenylpyruvate reductase         163   4e-44   Nicotiana tomentosiformis
emb|CDP16491.1|  unnamed protein product                                160   4e-43   Coffea canephora [robusta coffee]
ref|XP_011074952.1|  PREDICTED: formate dehydrogenase, mitochondrial    159   1e-42   Sesamum indicum [beniseed]
ref|XP_007015903.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    154   4e-42   
ref|XP_011003978.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   1e-41   Populus euphratica
ref|XP_011003974.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   2e-41   Populus euphratica
ref|XP_004250408.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    155   2e-41   Solanum lycopersicum
ref|XP_011003972.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   2e-41   Populus euphratica
ref|XP_011003975.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   2e-41   Populus euphratica
ref|XP_011003976.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   2e-41   Populus euphratica
ref|XP_011003971.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    155   2e-41   Populus euphratica
ref|XP_007015900.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    154   3e-41   
ref|XP_007015901.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    154   8e-41   
ref|XP_007015899.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    154   8e-41   
ref|XP_006441517.1|  hypothetical protein CICLE_v10020311mg             152   2e-40   Citrus clementina [clementine]
ref|XP_007015898.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    151   2e-40   
ref|XP_006361376.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    153   2e-40   Solanum tuberosum [potatoes]
ref|XP_007015897.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    152   2e-40   
gb|ABK96037.1|  unknown                                                 151   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDP31626.1|  hypothetical protein JCGZ_14851                         151   2e-40   Jatropha curcas
ref|XP_007015896.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    152   4e-40   
ref|XP_002319339.2|  hypothetical protein POPTR_0013s10050g             152   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006657609.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    150   7e-40   
gb|KCW70958.1|  hypothetical protein EUGRSUZ_F04070                     148   7e-40   Eucalyptus grandis [rose gum]
ref|XP_002521771.1|  phosphoglycerate dehydrogenase, putative           151   7e-40   Ricinus communis
ref|XP_006441518.1|  hypothetical protein CICLE_v10020311mg             152   8e-40   Citrus clementina [clementine]
ref|XP_006441521.1|  hypothetical protein CICLE_v10020311mg             152   8e-40   Citrus clementina [clementine]
gb|KCW70959.1|  hypothetical protein EUGRSUZ_F04070                     148   8e-40   Eucalyptus grandis [rose gum]
ref|XP_010243885.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    150   1e-39   Nelumbo nucifera [Indian lotus]
gb|AER41584.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    150   2e-39   Oryza brachyantha
ref|XP_010243882.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    150   2e-39   Nelumbo nucifera [Indian lotus]
gb|AER41609.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    149   4e-39   Oryza glaberrima
gb|KJB55660.1|  hypothetical protein B456_009G087500                    148   4e-39   Gossypium raimondii
gb|EEC81831.1|  hypothetical protein OsI_25581                          149   4e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_010063710.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    148   4e-39   Eucalyptus grandis [rose gum]
ref|XP_010063709.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    148   4e-39   Eucalyptus grandis [rose gum]
gb|KJB55658.1|  hypothetical protein B456_009G087500                    148   4e-39   Gossypium raimondii
gb|KDO36393.1|  hypothetical protein CISIN_1g045269mg                   141   5e-39   Citrus sinensis [apfelsine]
ref|XP_006478176.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    148   6e-39   Citrus sinensis [apfelsine]
gb|KJB55664.1|  hypothetical protein B456_009G087500                    148   8e-39   Gossypium raimondii
gb|KJB55663.1|  hypothetical protein B456_009G087500                    148   9e-39   Gossypium raimondii
ref|XP_009393479.1|  PREDICTED: formate dehydrogenase, mitochondr...    147   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006478175.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    148   1e-38   
ref|XP_002459677.1|  hypothetical protein SORBIDRAFT_02g008670          147   1e-38   
ref|XP_010665339.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    147   2e-38   Vitis vinifera
gb|EYU28234.1|  hypothetical protein MIMGU_mgv1a007209mg                148   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_006577809.1|  PREDICTED: uncharacterized protein LOC100785...    147   2e-38   Glycine max [soybeans]
ref|XP_010665338.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    147   2e-38   Vitis vinifera
gb|KHG10814.1|  Glyoxylate reductase                                    147   2e-38   Gossypium arboreum [tree cotton]
ref|XP_010665337.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    147   2e-38   Vitis vinifera
ref|XP_009393478.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282092.2|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    147   2e-38   Vitis vinifera
gb|EMT11768.1|  Glyoxylate reductase                                    146   2e-38   
ref|XP_006478174.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    147   2e-38   
ref|XP_006478173.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    147   3e-38   Citrus sinensis [apfelsine]
ref|XP_008378743.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase      147   3e-38   
gb|EMS56366.1|  Glyoxylate reductase                                    146   3e-38   Triticum urartu
ref|XP_004499721.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    146   4e-38   Cicer arietinum [garbanzo]
dbj|BAD31969.1|  phosphoglycerate dehydrogenase-like protein            145   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004499720.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    146   4e-38   
gb|KHN24796.1|  D-3-phosphoglycerate dehydrogenase                      146   5e-38   Glycine soja [wild soybean]
ref|NP_001059330.1|  Os07g0264100                                       146   5e-38   
ref|XP_003598073.1|  D-3-phosphoglycerate dehydrogenase                 145   7e-38   Medicago truncatula
ref|XP_009379254.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    146   7e-38   Pyrus x bretschneideri [bai li]
ref|XP_009379261.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    146   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_008218923.1|  PREDICTED: formate dehydrogenase, mitochondr...    145   9e-38   
ref|XP_008218922.1|  PREDICTED: formate dehydrogenase, mitochondr...    145   1e-37   Prunus mume [ume]
ref|XP_008218920.1|  PREDICTED: formate dehydrogenase, mitochondr...    145   1e-37   Prunus mume [ume]
ref|XP_007223301.1|  hypothetical protein PRUPE_ppa007293mg             145   1e-37   Prunus persica
dbj|BAJ91330.1|  predicted protein                                      143   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03270.1|  predicted protein                                      144   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011457341.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    144   2e-37   Fragaria vesca subsp. vesca
dbj|BAK02358.1|  predicted protein                                      143   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010428086.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010471237.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002888861.1|  oxidoreductase family protein                      144   3e-37   
dbj|BAK00574.1|  predicted protein                                      144   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009379247.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    144   4e-37   Pyrus x bretschneideri [bai li]
dbj|BAK05235.1|  predicted protein                                      143   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_177364.2|  D-isomer specific 2-hydroxyacid dehydrogenase d...    144   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910119.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    143   5e-37   Elaeis guineensis
ref|XP_004984235.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    142   5e-37   
gb|AAG51802.1|AC067754_18  phosphoglycerate dehydrogenase, putati...    143   5e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KDO36140.1|  hypothetical protein CISIN_1g044647mg                   135   6e-37   Citrus sinensis [apfelsine]
ref|XP_010910114.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    143   7e-37   Elaeis guineensis
gb|AFK43325.1|  unknown                                                 142   8e-37   Medicago truncatula
ref|XP_006390689.1|  hypothetical protein EUTSA_v10018793mg             142   1e-36   
ref|XP_008461933.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    142   1e-36   
ref|XP_007148628.1|  hypothetical protein PHAVU_005G002200g             142   1e-36   Phaseolus vulgaris [French bean]
ref|XP_004139684.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    140   1e-36   
ref|XP_003557318.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    142   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_010414841.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008218917.1|  PREDICTED: formate dehydrogenase, mitochondr...    141   2e-36   Prunus mume [ume]
ref|XP_008218916.1|  PREDICTED: formate dehydrogenase, mitochondr...    141   2e-36   
ref|XP_008218915.1|  PREDICTED: formate dehydrogenase, mitochondr...    141   2e-36   Prunus mume [ume]
gb|KGN44470.1|  hypothetical protein Csa_7G302340                       140   2e-36   Cucumis sativus [cucumbers]
emb|CDY50445.1|  BnaC06g24190D                                          141   4e-36   Brassica napus [oilseed rape]
ref|XP_004161907.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    140   5e-36   
ref|XP_008802910.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    140   6e-36   Phoenix dactylifera
ref|XP_006301744.1|  hypothetical protein CARUB_v10022205mg             140   9e-36   
ref|XP_008802909.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    140   1e-35   Phoenix dactylifera
ref|XP_010415950.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate r...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001242647.1|  uncharacterized protein LOC100785085               140   1e-35   Glycine max [soybeans]
emb|CDX68275.1|  BnaA07g23150D                                          139   2e-35   
ref|XP_006441516.1|  hypothetical protein CICLE_v10024174mg             134   3e-35   
ref|XP_009104868.1|  PREDICTED: formate dehydrogenase, mitochondr...    138   4e-35   Brassica rapa
ref|XP_009104867.1|  PREDICTED: formate dehydrogenase, mitochondr...    138   6e-35   Brassica rapa
ref|XP_002459676.1|  hypothetical protein SORBIDRAFT_02g008660          137   1e-34   Sorghum bicolor [broomcorn]
gb|KFK41640.1|  hypothetical protein AALP_AA2G154000                    136   2e-34   Arabis alpina [alpine rockcress]
ref|XP_006858573.1|  hypothetical protein AMTR_s00071p00183090          135   5e-34   
ref|XP_004963884.1|  PREDICTED: formate dehydrogenase 1, mitochon...    135   2e-33   
tpg|DAA39793.1|  TPA: hypothetical protein ZEAMMB73_065837              131   4e-33   
ref|XP_010535279.1|  PREDICTED: formate dehydrogenase, mitochondrial    132   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_008667395.1|  PREDICTED: uncharacterized protein LOC100217...    131   7e-33   Zea mays [maize]
ref|XP_008667394.1|  PREDICTED: uncharacterized protein LOC100217...    132   1e-32   Zea mays [maize]
ref|NP_001137068.1|  uncharacterized protein LOC100217241               132   1e-32   Zea mays [maize]
tpg|DAA39795.1|  TPA: hypothetical protein ZEAMMB73_065837              132   1e-32   
tpg|DAA39792.1|  TPA: hypothetical protein ZEAMMB73_065837              131   2e-32   
ref|XP_006858572.1|  hypothetical protein AMTR_s00071p00182560          130   2e-32   
ref|XP_010683622.1|  PREDICTED: formate dehydrogenase 2, mitochon...    129   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008667393.1|  PREDICTED: uncharacterized protein LOC100217...    131   3e-32   
ref|XP_010683411.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    129   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007015902.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    127   2e-31   
gb|ABR18201.1|  unknown                                                 120   9e-29   Picea sitchensis
ref|XP_001767463.1|  predicted protein                                  118   6e-28   
ref|XP_011003977.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    118   8e-28   Populus euphratica
ref|XP_001766047.1|  predicted protein                                  114   1e-26   
gb|KJB55666.1|  hypothetical protein B456_009G087500                    113   4e-26   Gossypium raimondii
gb|KDO56050.1|  hypothetical protein CISIN_1g0174901mg                  113   4e-26   Citrus sinensis [apfelsine]
gb|KDO56049.1|  hypothetical protein CISIN_1g0174901mg                  112   6e-26   Citrus sinensis [apfelsine]
dbj|BAC22329.1|  putative phosphoglycerate dehydrogenase                112   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AER41626.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    111   2e-25   Oryza glumipatula
gb|AER41608.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    111   2e-25   Oryza glaberrima
gb|EPS66269.1|  hypothetical protein M569_08508                         110   6e-25   Genlisea aurea
ref|XP_010095911.1|  Glyoxylate reductase/hydroxypyruvate reductase     110   4e-24   
ref|XP_008461935.1|  PREDICTED: formate dehydrogenase, mitochondr...    107   4e-24   
ref|XP_008461934.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    105   2e-23   Cucumis melo [Oriental melon]
ref|XP_005646982.1|  hypothetical protein COCSUDRAFT_37061              104   6e-23   Coccomyxa subellipsoidea C-169
ref|XP_002962752.1|  hypothetical protein SELMODRAFT_404020           99.4    2e-21   
ref|XP_002962542.1|  hypothetical protein SELMODRAFT_404404           99.4    3e-21   
ref|XP_001422519.1|  predicted protein                                96.3    4e-20   Ostreococcus lucimarinus CCE9901
ref|XP_003082919.1|  oxidoreductase family protein (ISS)              85.9    2e-16   Ostreococcus tauri
ref|XP_005849953.1|  hypothetical protein CHLNCDRAFT_143308           84.3    6e-16   Chlorella variabilis
ref|WP_022842734.1|  lactate dehydrogenase                            82.0    3e-15   Acidobacteriaceae bacterium TAA166
ref|WP_013570641.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  80.9    8e-15   Terriglobus saanensis
ref|WP_016987590.1|  hypothetical protein                             74.7    1e-13   
ref|WP_020711063.1|  hypothetical protein                             76.6    2e-13   Acidobacteriaceae bacterium KBS 83
ref|XP_003063700.1|  predicted protein                                76.3    7e-13   Micromonas pusilla CCMP1545
ref|WP_018205413.1|  MULTISPECIES: hypothetical protein               71.2    2e-12   
ref|WP_022726624.1|  lactate dehydrogenase                            73.6    4e-12   
ref|WP_015878860.1|  lactate dehydrogenase                            72.4    8e-12   Tolumonas auensis
gb|KDD72690.1|  hypothetical protein H632_c3019p0                     72.8    8e-12   Helicosporidium sp. ATCC 50920
ref|WP_020880970.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  72.0    1e-11   Desulfovibrio sp. X2
ref|WP_043338986.1|  hypothetical protein                             70.5    4e-11   Belnapia moabensis
ref|WP_037135542.1|  2-hydroxyacid dehydrogenase                      70.5    4e-11   Rhizobium sp. CF394
ref|WP_043358506.1|  hypothetical protein                             70.1    6e-11   Belnapia sp. F-4-1
ref|WP_012107589.1|  D-isomer specific 2-hydroxyacid dehydrogenase    69.3    1e-10   Methanoregula boonei
ref|WP_033397128.1|  lactate dehydrogenase                            69.3    1e-10   
ref|WP_018335712.1|  hypothetical protein                             69.3    1e-10   Actinomycetospora chiangmaiensis
ref|WP_012875992.1|  hydroxyacid dehydrogenase                        68.9    1e-10   Thermobaculum terrenum
ref|WP_014806274.1|  glyoxylate reductase                             68.9    1e-10   Acetomicrobium
ref|WP_043280329.1|  hypothetical protein                             67.8    4e-10   
ref|WP_028227829.1|  hypothetical protein                             67.8    4e-10   Paraburkholderia ferrariae
ref|WP_037064716.1|  hypothetical protein                             67.0    5e-10   
ref|WP_036553081.1|  hypothetical protein                             67.0    7e-10   Nisaea denitrificans
ref|WP_035064188.1|  2-hydroxyacid dehydrogenase                      67.0    7e-10   Desulfovibrio termitidis
emb|CCK81372.1|  NAD-binding protein                                  63.5    8e-10   Desulfobacula toluolica Tol2
ref|WP_008715411.1|  putative oxidoreductase                          66.6    8e-10   Rhodococcus sp. AW25M09
ref|XP_002505587.1|  predicted protein                                67.0    9e-10   Micromonas commoda
ref|WP_035265554.1|  lactate dehydrogenase                            66.6    1e-09   Desulfosarcina sp. BuS5
ref|WP_007521382.1|  glycerate dehydrogenase                          66.6    1e-09   Desulfovibrio sp. A2
ref|WP_006328672.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  66.6    1e-09   Mesorhizobium sp. STM 4661
ref|WP_012547855.1|  lactate dehydrogenase                            66.6    1e-09   Dictyoglomus thermophilum
ref|WP_013019292.1|  2-hydroxyacid dehydrogenase                      66.6    1e-09   Stackebrandtia nassauensis
ref|WP_043718890.1|  hypothetical protein                             63.2    1e-09   Kutzneria sp. 744
ref|WP_020697799.1|  hypothetical protein                             66.2    1e-09   Reyranella massiliensis
ref|WP_008413665.1|  D-2-hydroxyacid dehydrogenase                    65.9    2e-09   Halalkalicoccus jeotgali
gb|AHC51448.1|  2-hydroxyacid dehydrogenase                           65.9    2e-09   Sulfolobus acidocaldarius SUSAZ
ref|WP_039671565.1|  hypothetical protein                             65.9    2e-09   
ref|WP_018114836.1|  hypothetical protein                             65.9    2e-09   Rhizobiales bacterium
ref|WP_041319387.1|  2-hydroxyacid dehydrogenase                      65.5    2e-09   
ref|WP_008874215.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  65.5    2e-09   Mesorhizobium metallidurans
ref|WP_013298877.1|  lactate dehydrogenase                            65.5    2e-09   Thermoanaerobacterium thermosaccharolyticum
gb|AEF34261.1|  D-3-phosphoglycerate dehydrogenase SerA3              65.5    2e-09   Mycolicibacter sinensis
ref|WP_012582609.1|  lactate dehydrogenase                            65.5    2e-09   Dictyoglomus turgidum
ref|WP_028096745.1|  oxidoreductase                                   65.5    3e-09   Dongia sp. URHE0060
ref|WP_009070777.1|  phosphoglycerate dehydrogenase-like oxidored...  65.1    3e-09   
ref|WP_034897846.1|  lactate dehydrogenase                            64.7    4e-09   Erwinia typographi
ref|WP_032379580.1|  2-hydroxyacid dehydrogenase                      64.3    5e-09   
ref|XP_008329727.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...  64.7    5e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_041867685.1|  lactate dehydrogenase                            62.4    5e-09   
ref|WP_012876402.1|  2-hydroxyacid dehydrogenase                      64.7    6e-09   Thermobaculum terrenum
ref|WP_012582463.1|  3-phosphoglycerate dehydrogenase                 65.1    6e-09   Dictyoglomus turgidum
ref|WP_015906531.1|  lactate dehydrogenase                            64.3    6e-09   Desulfobacterium autotrophicum
ref|WP_032402399.1|  2-hydroxyacid dehydrogenase                      64.3    7e-09   Rhodococcus fascians
ref|XP_008329726.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...  64.3    7e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_039235937.1|  2-hydroxyacid dehydrogenase                      63.9    7e-09   Quasibacillus thermotolerans
ref|WP_007229451.1|  glyoxylate reductase                             64.3    7e-09   marine gamma proteobacterium HTCC2148
ref|WP_037193108.1|  2-hydroxyacid dehydrogenase                      63.9    8e-09   Rhodococcus
ref|WP_013139514.1|  2-hydroxyacid dehydrogenase                      63.9    8e-09   Segniliparus rotundus
ref|WP_012611363.1|  glycerate dehydrogenase                          63.9    8e-09   Desulfovibrio vulgaris
ref|WP_028818663.1|  hypothetical protein                             61.6    8e-09   
gb|KIA68489.1|  D-3-phosphoglycerate dehydrogenase                    63.9    8e-09   
ref|WP_020960081.1|  2-hydroxyacid dehydrogenase                      63.9    9e-09   Geobacillus genomosp. 3
ref|WP_004900153.1|  2-hydroxyacid dehydrogenase                      63.5    9e-09   Leuconostoc citreum
ref|WP_004905936.1|  2-hydroxyacid dehydrogenase                      63.5    9e-09   Leuconostoc citreum
ref|WP_029008214.1|  2-hydroxyacid dehydrogenase                      63.9    9e-09   Azospirillum halopraeferens
ref|WP_041010349.1|  dehydrogenase                                    63.9    9e-09   Mesorhizobium plurifarium
ref|WP_012548694.1|  3-phosphoglycerate dehydrogenase                 64.3    9e-09   Dictyoglomus thermophilum
ref|WP_040987398.1|  dehydrogenase                                    63.9    9e-09   Mesorhizobium plurifarium
dbj|BAC24143.1|  2-oxo-4-phenylbutanoate reductase                    63.5    9e-09   Oenococcus oeni
ref|WP_030920347.1|  3-phosphoglycerate dehydrogenase                 63.5    1e-08   Streptosporangium amethystogenes
ref|WP_012826850.1|  NAD-binding D-isomer specific 2-hydroxyacid ...  63.5    1e-08   Haliangium ochraceum
ref|WP_029061147.1|  oxidoreductase                                   63.5    1e-08   Labrenzia sp. DG1229
ref|WP_035844464.1|  hypothetical protein                             63.5    1e-08   Defluviimonas
ref|WP_013200656.1|  lactate dehydrogenase                            63.5    1e-08   Erwinia billingiae
ref|WP_040645653.1|  hypothetical protein                             63.2    1e-08   
ref|WP_041006516.1|  dehydrogenase                                    63.5    1e-08   Mesorhizobium plurifarium
ref|WP_007471586.1|  2-hydroxyacid dehydrogenase                      63.5    1e-08   Segniliparus rugosus
ref|WP_015312451.1|  lactate dehydrogenase-like oxidoreductase        63.5    1e-08   Thermoanaerobacterium thermosaccharolyticum
ref|WP_022703054.1|  2-hydroxyacid dehydrogenase                      63.2    1e-08   Pseudorhodobacter ferrugineus
ref|WP_004073201.1|  lactate dehydrogenase                            63.2    1e-08   Desulfobacter postgatei
gb|EPX84695.1|  Lactate dehydrogenase                                 63.2    1e-08   Rubellimicrobium thermophilum DSM 16684
ref|WP_004404791.1|  MULTISPECIES: D-isomer specific 2-hydroxyaci...  63.5    1e-08   Thermoanaerobacter
ref|WP_013298812.1|  lactate dehydrogenase                            63.2    1e-08   
ref|WP_013266039.1|  glyoxylate reductase                             63.2    1e-08   Acidilobus saccharovorans
ref|WP_013145109.1|  2-hydroxyacid dehydrogenase                      63.2    1e-08   Geobacillus sp. C56-T3
ref|WP_035710713.1|  D-3-phosphoglycerate dehydrogenase               63.9    1e-08   
ref|WP_011231440.1|  2-hydroxyacid dehydrogenase                      63.2    2e-08   Geobacillus
ref|WP_025420783.1|  lactate dehydrogenase                            63.2    2e-08   Sodalis praecaptivus
ref|WP_003866626.1|  MULTISPECIES: lactate dehydrogenase              63.2    2e-08   Thermoanaerobacter
ref|WP_036307029.1|  2-hydroxyacid dehydrogenase                      63.2    2e-08   
ref|WP_029689388.1|  2-hydroxyacid dehydrogenase                      63.2    2e-08   
ref|WP_014063254.1|  lactate dehydrogenase                            63.2    2e-08   Thermoanaerobacter wiegelii
ref|WP_031194935.1|  dehydrogenase                                    62.8    2e-08   Mesorhizobium sp. LSHC420B00
ref|WP_020963031.1|  lactate dehydrogenase                            62.8    2e-08   Thermofilum
gb|ESX64956.1|  dehydrogenase                                         62.8    2e-08   Mesorhizobium sp. LSHC420B00
ref|WP_014757115.1|  MULTISPECIES: lactate dehydrogenase              62.8    2e-08   Thermoanaerobacterium aotearoense
ref|WP_043870188.1|  dehydrogenase                                    62.8    2e-08   Celeribacter indicus
ref|WP_017800580.1|  lactate dehydrogenase                            62.8    2e-08   Erwinia toletana
ref|WP_031211595.1|  hypothetical protein                             62.4    2e-08   
ref|WP_042300725.1|  3-phosphoglycerate dehydrogenase                 62.8    2e-08   Paraburkholderia kururiensis
ref|WP_014974771.1|  2-hydroxyacid dehydrogenase                      62.4    2e-08   Leuconostoc carnosum
ref|WP_039279002.1|  phosphoglycerate dehydrogenase                   62.4    2e-08   Novosphingobium malaysiense
ref|WP_037501297.1|  hypothetical protein                             62.4    3e-08   
ref|WP_029199184.1|  glycerate dehydrogenase                          62.4    3e-08   Paenibacillus alginolyticus
ref|WP_013788786.1|  lactate dehydrogenase                            62.4    3e-08   
gb|AER67036.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  62.4    3e-08   Thermovirga lienii DSM 17291
ref|WP_019633540.1|  hypothetical protein                             62.4    3e-08   Actinomadura atramentaria
ref|WP_026325911.1|  3-phosphoglycerate dehydrogenase                 62.4    3e-08   Sphingomonas sp. Mn802worker
gb|ESW87578.1|  3-phosphoglycerate dehydrogenase                      62.4    3e-08   Mesorhizobium sp. LSJC280B00
ref|WP_040104542.1|  dehydrogenase                                    60.5    3e-08   
ref|WP_009665693.1|  3-phosphoglycerate dehydrogenase                 62.4    3e-08   Oxalobacteraceae bacterium IMCC9480
ref|WP_006200482.1|  dehydrogenase                                    62.4    3e-08   Mesorhizobium amorphae
ref|WP_040401337.1|  hypothetical protein                             62.0    3e-08   
ref|WP_032390955.1|  2-hydroxyacid dehydrogenase                      62.4    3e-08   
ref|WP_017437303.1|  2-hydroxyacid dehydrogenase                      62.4    3e-08   Parageobacillus caldoxylosilyticus
ref|WP_006009111.1|  glycerate dehydrogenase                          62.4    3e-08   Desulfovibrio piger
ref|WP_013272238.1|  2-hydroxyacid dehydrogenase [                    62.0    3e-08   [Clostridium] saccharolyticum
ref|WP_005535138.1|  phosphoglycerate dehydrogenase                   62.0    3e-08   Haloarcula argentinensis
ref|WP_037219417.1|  2-hydroxyacid dehydrogenase                      62.0    3e-08   
emb|CDX43948.1|  Glyoxylate reductase                                 62.4    3e-08   Mesorhizobium sp. SOD10
ref|WP_026876452.1|  2-hydroxyacid dehydrogenase                      62.4    3e-08   Jiangella gansuensis
ref|WP_037156463.1|  hypothetical protein                             62.0    3e-08   Rhizobium sp. YS-1r
ref|WP_020429464.1|  hypothetical protein                             60.1    4e-08   
ref|WP_041003766.1|  dehydrogenase                                    62.0    4e-08   Mesorhizobium sp. SOD10
ref|WP_042410627.1|  2-hydroxyacid dehydrogenase                      62.0    4e-08   Parageobacillus caldoxylosilyticus
ref|WP_024966984.1|  lactate dehydrogenase                            62.0    4e-08   Pantoea sp. IMH
ref|WP_025704270.1|  hypothetical protein                             59.3    4e-08   
ref|WP_043630066.1|  3-phosphoglycerate dehydrogenase                 62.0    4e-08   Nonomuraea candida
ref|WP_008162469.1|  dehydrogenase                                    62.0    4e-08   Achromobacter arsenitoxydans
ref|WP_041262748.1|  2-hydroxyacid dehydrogenase                      62.0    4e-08   Fervidobacterium pennivorans
gb|AHG02119.1|  hypothetical protein HALLA_02085                      62.0    4e-08   Halostagnicola larsenii XH-48
gb|EFH86853.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  62.0    4e-08   Ktedonobacter racemifer DSM 44963
ref|WP_006940315.1|  oxidoreductase                                   62.0    4e-08   Labrenzia aggregata
ref|WP_040444820.1|  hypothetical protein                             62.0    4e-08   
ref|WP_023797344.1|  dehydrogenase                                    62.0    4e-08   Mesorhizobium sp. L48C026A00
ref|WP_023385817.1|  lactate dehydrogenase                            62.0    4e-08   Youngiibacter fragilis
ref|WP_033191461.1|  2-hydroxyacid dehydrogenase                      62.0    4e-08   
ref|WP_012642181.1|  glyoxylate reductase                             62.0    4e-08   
ref|WP_032368189.1|  2-hydroxyacid dehydrogenase                      62.0    4e-08   
ref|WP_029912678.1|  lactate dehydrogenase                            62.0    4e-08   
ref|WP_021073766.1|  hypothetical protein                             62.0    4e-08   
gb|AFG34288.1|  lactate dehydrogenase-like oxidoreductase             62.0    4e-08   
ref|WP_017618255.1|  hypothetical protein                             62.0    5e-08   
ref|WP_013617525.1|  glycerate dehydrogenase                          61.6    5e-08   
ref|WP_002711023.1|  hypothetical protein                             62.0    5e-08   
ref|WP_037772145.1|  2-hydroxyacid dehydrogenase                      61.2    5e-08   
ref|WP_043618565.1|  2-hydroxyacid dehydrogenase                      62.0    5e-08   
ref|WP_042640696.1|  dehydrogenase                                    61.6    5e-08   
ref|WP_040973853.1|  dehydrogenase                                    61.6    5e-08   
ref|WP_015788535.1|  2-hydroxyacid dehydrogenase                      61.6    5e-08   
emb|CDX23765.1|  Phosphoglycerate dehydrogenase                       61.6    5e-08   
ref|WP_043501876.1|  dehydrogenase                                    60.8    5e-08   
ref|WP_043923873.1|  3-phosphoglycerate dehydrogenase                 61.6    5e-08   
ref|WP_032374434.1|  2-hydroxyacid dehydrogenase                      61.6    5e-08   
ref|WP_009144294.1|  dehydrogenase                                    61.6    5e-08   
gb|EGP08449.1|  D-3-phosphoglycerate dehydrogenase                    62.0    5e-08   
ref|WP_012624488.1|  glycerate dehydrogenase                          61.6    5e-08   
ref|WP_009733360.1|  glycerate dehydrogenase                          61.6    5e-08   
ref|WP_013933006.1|  lactate dehydrogenase                            61.6    6e-08   
ref|WP_038572953.1|  hypothetical protein                             61.2    6e-08   
ref|WP_015844527.1|  2-hydroxyacid dehydrogenase                      61.6    6e-08   
gb|EEB76368.1|  D-isomer specific 2-hydroxyacid dehydrogenase, ca...  61.6    6e-08   
ref|WP_043883861.1|  2-hydroxyacid dehydrogenase                      61.6    6e-08   
gb|EFD24587.1|  4-phosphoerythronate dehydrogenase                    61.6    6e-08   
ref|WP_039981301.1|  3-phosphoglycerate dehydrogenase                 61.6    6e-08   
ref|WP_029348297.1|  dehydrogenase                                    61.6    6e-08   
ref|WP_032394571.1|  2-hydroxyacid dehydrogenase                      61.2    6e-08   
ref|WP_035585719.1|  glycerate dehydrogenase                          61.2    6e-08   
ref|WP_015761257.1|  glycerate dehydrogenase                          61.2    6e-08   
ref|WP_009306695.1|  MULTISPECIES: glycerate dehydrogenase            61.2    6e-08   
gb|EFM22478.1|  4-phosphoerythronate dehydrogenase                    61.6    7e-08   
ref|WP_039835258.1|  2-hydroxyacid dehydrogenase                      59.3    7e-08   
ref|WP_026988575.1|  hypothetical protein                             61.2    7e-08   
ref|WP_028602895.1|  D-3-phosphoglycerate dehydrogenase               61.2    7e-08   
ref|WP_015127557.1|  glyoxylate reductase                             61.2    7e-08   
ref|WP_037177837.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   
ref|WP_009467427.1|  oxidoreductase                                   61.2    7e-08   
ref|WP_037771952.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   
ref|WP_021660086.1|  putative glycerate dehydrogenase                 61.2    7e-08   
ref|WP_040159155.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   
gb|AHG04121.1|  D-2-hydroxyacid dehydrogenase                         61.2    7e-08   
ref|WP_019014218.1|  hypothetical protein                             61.2    7e-08   
gb|AHF97449.1|  lactate dehydrogenase                                 61.2    7e-08   
ref|WP_022917962.1|  dehydrogenase                                    61.2    7e-08   
ref|WP_037151030.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   
gb|EQI08778.1|  NAD binding domain of 6-phosphogluconate dehydrog...  61.2    7e-08   
ref|XP_011399491.1|  D-3-phosphoglycerate dehydrogenase               61.2    7e-08   
ref|WP_026455941.1|  hypothetical protein                             58.9    8e-08   
ref|WP_023675187.1|  dehydrogenase                                    61.2    8e-08   
ref|WP_043657422.1|  3-phosphoglycerate dehydrogenase                 60.8    8e-08   
ref|WP_031192324.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        61.2    9e-08   
ref|WP_027144647.1|  dehydrogenase                                    60.8    9e-08   
ref|WP_044733151.1|  2-hydroxyacid dehydrogenase                      61.2    9e-08   
ref|WP_014261685.1|  phosphoglycerate dehydrogenase                   60.8    9e-08   
ref|WP_019630537.1|  hypothetical protein                             60.8    9e-08   
ref|WP_042833555.1|  2-hydroxyacid dehydrogenase                      60.8    9e-08   
ref|WP_005024870.1|  glycerate dehydrogenase                          60.8    9e-08   
ref|WP_021726818.1|  4-phosphoerythronate dehydrogenase               60.8    9e-08   
ref|WP_007694088.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  60.8    9e-08   
ref|WP_008967540.1|  oxidoreductase                                   60.8    1e-07   
gb|ACZ89847.1|  D-3-phosphoglycerate dehydrogenase                    60.8    1e-07   
ref|WP_041446076.1|  hypothetical protein                             60.8    1e-07   
gb|AHF76806.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  60.8    1e-07   
ref|WP_025421939.1|  2-hydroxyacid dehydrogenase                      60.8    1e-07   
ref|WP_040885922.1|  dehydrogenase                                    60.8    1e-07   
ref|WP_006000067.1|  glycerate dehydrogenase                          60.8    1e-07   
gb|EAQ10547.1|  Predicted dehydrogenase                               60.8    1e-07   
ref|WP_012250254.1|  3-phosphoglycerate dehydrogenase                 60.8    1e-07   
ref|WP_008527868.1|  2-hydroxyacid dehydrogenase                      60.8    1e-07   
ref|WP_017956812.1|  dehydrogenase                                    60.8    1e-07   
ref|WP_007803182.1|  dehydrogenase                                    60.8    1e-07   
ref|WP_004065700.1|  phosphoglycerate dehydrogenase                   60.8    1e-07   
ref|WP_015539532.1|  Lactate dehydrogenase and related dehydrogen...  60.5    1e-07   
ref|WP_030990980.1|  2-hydroxyacid dehydrogenase                      60.8    1e-07   
ref|WP_008610567.1|  phosphoglycerate dehydrogenase                   60.5    1e-07   
ref|WP_006600813.1|  phosphoglycerate dehydrogenase                   60.5    1e-07   
ref|WP_028162019.1|  2-hydroxyacid dehydrogenase                      60.5    1e-07   
gb|AGB44181.1|  phosphoglycerate dehydrogenase-like oxidoreductase    60.5    1e-07   
ref|WP_041163666.1|  dehydrogenase                                    60.5    1e-07   
ref|WP_040348642.1|  hypothetical protein                             60.5    1e-07   
ref|WP_006076958.1|  phosphoglycerate dehydrogenase                   60.5    1e-07   
ref|WP_037528049.1|  hypothetical protein                             60.5    1e-07   
ref|WP_017277535.1|  dehydrogenase                                    60.5    1e-07   
ref|WP_036244153.1|  hypothetical protein                             60.1    1e-07   
ref|WP_035635445.1|  MULTISPECIES: oxidoreductase                     60.5    1e-07   
gb|ESX82943.1|  3-phosphoglycerate dehydrogenase                      60.5    1e-07   
ref|WP_027007989.1|  hypothetical protein                             60.5    1e-07   
ref|XP_008189273.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...  60.5    1e-07   
ref|WP_027023590.1|  dehydrogenase                                    60.5    2e-07   
gb|AAM25122.1|  Lactate dehydrogenase and related dehydrogenases      60.5    2e-07   
ref|WP_019436000.1|  hypothetical protein                             60.1    2e-07   
ref|WP_015554677.1|  Phosphoglycerate dehydrogenase and related d...  60.5    2e-07   
ref|WP_044374445.1|  2-hydroxyacid dehydrogenase                      59.3    2e-07   
ref|WP_035676944.1|  3-phosphoglycerate dehydrogenase                 58.2    2e-07   
gb|ERM91422.1|  lactate dehydrogenase                                 60.5    2e-07   
ref|WP_032389263.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_043268025.1|  2-hydroxyacid dehydrogenase                      60.5    2e-07   
ref|WP_009022970.1|  probable phosphoglycerate dehydrogenase          60.5    2e-07   
ref|WP_016668101.1|  hypothetical protein                             60.1    2e-07   
ref|WP_041927760.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_035696270.1|  3-phosphoglycerate dehydrogenase                 58.2    2e-07   
ref|WP_024296044.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.1    2e-07   
ref|WP_014990112.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_020480251.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|WP_024279334.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_028819430.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
ref|WP_008928022.1|  glycerate dehydrogenase                          60.1    2e-07   
ref|WP_034132393.1|  hypothetical protein                             57.0    2e-07   
ref|WP_031314228.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_010015356.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_020930551.1|  hypothetical protein                             59.3    2e-07   
ref|WP_026207453.1|  hypothetical protein                             60.1    2e-07   
ref|WP_041587337.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_017126045.1|  hypothetical protein                             60.1    2e-07   
ref|WP_005071463.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_032382749.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
gb|AGM31002.1|  D-3-phosphoglycerate dehydrogenase                    60.1    2e-07   
ref|WP_038970352.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-07   
gb|EIV65555.1|  D-3-phosphoglycerate dehydrogenase SerA3              60.1    2e-07   
ref|WP_028003344.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_027992253.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_017266270.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_013845479.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_014531533.1|  dehydrogenase                                    60.1    2e-07   
dbj|BAB50272.1|  phosphoglycerate dehydrogenase                       60.1    2e-07   
ref|WP_003526767.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_008879979.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.1    2e-07   
ref|WP_032933788.1|  dehydrogenase                                    60.1    2e-07   
ref|WP_005044181.1|  phosphoglycerate dehydrogenase                   60.1    2e-07   
ref|WP_011887562.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
gb|ABC72353.1|  phosphoglycerate dehydrogenase                        60.5    2e-07   
ref|WP_038974873.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-07   
ref|WP_035293128.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_042013862.1|  glycerate dehydrogenase                          60.1    2e-07   
ref|WP_026414054.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_004515630.1|  phosphoglycerate dehydrogenase                   60.1    2e-07   
ref|WP_021508123.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
emb|CAJ51173.2|  phosphoglycerate dehydrogenase                       60.5    2e-07   
ref|WP_038951093.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-07   
ref|WP_008574904.1|  MULTISPECIES: 2-D-hydroxyacid dehydrogenase      59.7    2e-07   
ref|WP_024519441.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
ref|WP_034826230.1|  lactate dehydrogenase                            59.7    2e-07   
ref|WP_011570341.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|WP_014554982.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
ref|WP_035275470.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_042266170.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_011595583.1|  dihydrofolate reductase                          59.7    2e-07   
ref|WP_012418731.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
ref|WP_010697146.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|WP_010548133.1|  glycerate dehydrogenase                          59.7    2e-07   
ref|WP_020575276.1|  hypothetical protein                             60.1    2e-07   
ref|WP_034273914.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_041024976.1|  bifunctional glyoxylate/hydroxypyruvate redu...  59.7    2e-07   
ref|WP_013165014.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_024737089.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|WP_007709209.1|  2-hydroxyacid dehydrogenase [                    59.7    2e-07   
ref|WP_037935125.1|  3-phosphoglycerate dehydrogenase                 59.7    2e-07   
ref|WP_038649217.1|  lactate dehydrogenase                            59.7    2e-07   
ref|WP_029720836.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
gb|EKP94310.1|  D-3-phosphoglycerate dehydrogenase                    60.1    2e-07   
ref|WP_036268062.1|  hypothetical protein                             59.3    2e-07   
ref|WP_007952016.1|  3-phosphoglycerate dehydrogenase                 59.7    2e-07   
ref|WP_007938886.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   59.7    2e-07   
ref|WP_040827362.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
dbj|BAB05321.1|  D-3-phosphoglycerate dehydrogenase                   60.1    3e-07   
gb|ADU50638.1|  D-3-phosphoglycerate dehydrogenase                    60.1    3e-07   
ref|WP_020514229.1|  hypothetical protein                             59.7    3e-07   
ref|WP_008831506.1|  phosphoglycerate dehydrogenase                   59.7    3e-07   
ref|WP_032917711.1|  dehydrogenase                                    59.7    3e-07   
ref|XP_008478926.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...  57.0    3e-07   
ref|WP_027943129.1|  hypothetical protein                             59.3    3e-07   
ref|WP_023669839.1|  MULTISPECIES: dehydrogenase                      59.7    3e-07   
ref|WP_023700159.1|  dehydrogenase                                    59.7    3e-07   
ref|WP_026699498.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
ref|WP_027578068.1|  2-hydroxyacid dehydrogenase                      59.7    3e-07   
ref|WP_042501017.1|  3-phosphoglycerate dehydrogenase                 60.1    3e-07   
ref|WP_007697227.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  59.3    3e-07   
gb|KJC37744.1|  3-phosphoglycerate dehydrogenase                      59.7    3e-07   
ref|WP_005064070.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
gb|KJC53694.1|  3-phosphoglycerate dehydrogenase                      59.7    3e-07   
ref|WP_033542536.1|  bifunctional glyoxylate/hydroxypyruvate redu...  59.7    3e-07   
gb|ENN70525.1|  hypothetical protein YQE_12701                        59.3    3e-07   
ref|WP_016577070.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  59.7    3e-07   
ref|WP_030047962.1|  2-hydroxyacid dehydrogenase                      58.5    3e-07   
ref|WP_044105513.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
ref|WP_027510027.1|  dehydrogenase                                    59.3    3e-07   
ref|WP_017264148.1|  dehydrogenase                                    59.3    3e-07   
gb|KFI53771.1|  2-hydroxyacid dehydrogenase                           59.7    3e-07   
ref|WP_041821413.1|  D-3-phosphoglycerate dehydrogenase               59.7    3e-07   
ref|WP_031472107.1|  dehydrogenase [                                  59.3    3e-07   
ref|WP_019264337.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_022801308.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
gb|AEE62659.1|  unknown                                               59.3    3e-07   
ref|WP_018950116.1|  hypothetical protein                             59.3    3e-07   
ref|WP_008982147.1|  glycerate dehydrogenase                          59.3    3e-07   
ref|WP_034722642.1|  hypothetical protein                             59.3    3e-07   
ref|WP_007188042.1|  phosphoglycerate dehydrogenase                   59.3    3e-07   
ref|WP_004032208.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   59.7    3e-07   
ref|WP_038523513.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
ref|WP_016893035.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
ref|WP_019267648.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_019266338.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_011953898.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_020993825.1|  hypothetical protein                             57.0    3e-07   
ref|WP_036012418.1|  3-phosphoglycerate dehydrogenase                 57.4    3e-07   
ref|WP_033492571.1|  hypothetical protein                             59.3    3e-07   
ref|WP_020544561.1|  hypothetical protein                             59.3    3e-07   
ref|WP_035643910.1|  dehydrogenase                                    59.3    3e-07   
ref|WP_012924188.1|  2-hydroxyacid dehydrogenase                      59.3    3e-07   
ref|WP_027998642.1|  dehydrogenase                                    59.3    4e-07   
ref|WP_043135714.1|  glycerate dehydrogenase                          59.3    4e-07   
ref|WP_011222981.1|  2-hydroxyacid dehydrogenase                      59.3    4e-07   
dbj|BAO90074.1|  D-isomer specific 2-hydroxyacid dehydrogenase NA...  59.3    4e-07   
ref|WP_021906121.1|  phosphoglycerate dehydrogenase and related d...  59.3    4e-07   
gb|EQC44114.1|  4-phosphoerythronate dehydrogenase                    59.3    4e-07   
ref|WP_026388263.1|  2-hydroxyacid dehydrogenase                      59.3    4e-07   
gb|AJF26634.1|  2-hydroxyacid dehydrogenase                           59.3    4e-07   



>ref|XP_009794279.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana sylvestris]
Length=400

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAVFNHLK GHLGGLGIDVAW EPFDPD+AIL F  VIITPHVAGVTE SY
Sbjct  314  IARGGLLDYDAVFNHLKSGHLGGLGIDVAWAEPFDPDDAILKFPEVIITPHVAGVTEKSY  373

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            RYMAKVVGDVALQLHAG P TGIEIVN
Sbjct  374  RYMAKVVGDVALQLHAGEPFTGIEIVN  400



>ref|XP_009588864.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana tomentosiformis]
Length=401

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAVFNHLK GHLGGLGIDVAW EPFDPD+AIL F  VIITPH+AGVTE SY
Sbjct  315  IARGGLLDYDAVFNHLKSGHLGGLGIDVAWAEPFDPDDAILKFPEVIITPHIAGVTEKSY  374

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            RYMAKVVGDVALQLHAG P TGIEIVN
Sbjct  375  RYMAKVVGDVALQLHAGEPFTGIEIVN  401



>emb|CDP16491.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+AILNF NVIITPHVAGVTE SY
Sbjct  317  IARGGLLDYNAVLHHLESGHLGGLGIDVAWTEPFDPDDAILNFPNVIITPHVAGVTEYSY  376

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            RYMAKVVGDVALQ+HAG PLTGIEIVN
Sbjct  377  RYMAKVVGDVALQVHAGKPLTGIEIVN  403



>ref|XP_011074952.1| PREDICTED: formate dehydrogenase, mitochondrial [Sesamum indicum]
Length=406

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HLK GHLGGLGIDVAWTEPFDPD+AIL F NVIITPHVAGVTE SY
Sbjct  320  IARGGLLDYEAVLHHLKSGHLGGLGIDVAWTEPFDPDDAILKFPNVIITPHVAGVTECSY  379

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+MAKVVGDVALQLH GTP TG+EIVN
Sbjct  380  RFMAKVVGDVALQLHTGTPFTGVEIVN  406



>ref|XP_007015903.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
 gb|EOY33522.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
Length=261

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F+N+IITPHVAGVTE SY
Sbjct  175  IARGSLLDYEAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFKNIIITPHVAGVTEHSY  234

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGDVALQLHAGTPLTGIE+VN
Sbjct  235  RSMAKIVGDVALQLHAGTPLTGIELVN  261



>ref|XP_011003978.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X7 [Populus euphratica]
Length=343

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  257  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  317  RFMSKVVGDVALQLHSGNPLTGIEIVN  343



>ref|XP_011003974.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X3 [Populus euphratica]
Length=390

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  304  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  363

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  364  RFMSKVVGDVALQLHSGNPLTGIEIVN  390



>ref|XP_004250408.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Solanum 
lycopersicum]
Length=398

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HLK GHLGGLGIDVAWTEPFDPD+AIL F +VIITPHVAGVTE SY
Sbjct  312  IARGGLLDYDAVLSHLKSGHLGGLGIDVAWTEPFDPDDAILRFPDVIITPHVAGVTELSY  371

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG P TGIEIVN
Sbjct  372  RDMAKVVGDVALQLHAGKPFTGIEIVN  398



>ref|XP_011003972.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Populus euphratica]
Length=390

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  304  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  363

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  364  RFMSKVVGDVALQLHSGNPLTGIEIVN  390



>ref|XP_011003975.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X4 [Populus euphratica]
Length=388

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  302  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  361

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  362  RFMSKVVGDVALQLHSGNPLTGIEIVN  388



>ref|XP_011003976.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X5 [Populus euphratica]
Length=388

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  302  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  361

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  362  RFMSKVVGDVALQLHSGNPLTGIEIVN  388



>ref|XP_011003971.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Populus euphratica]
Length=394

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  308  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  367

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  368  RFMSKVVGDVALQLHSGNPLTGIEIVN  394



>ref|XP_007015900.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33519.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=349

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F+N+IITPHVAGVTE SY
Sbjct  263  IARGSLLDYEAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFKNIIITPHVAGVTEHSY  322

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGDVALQLHAGTPLTGIE+VN
Sbjct  323  RSMAKIVGDVALQLHAGTPLTGIELVN  349



>ref|XP_007015901.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33520.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=387

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F+N+IITPHVAGVTE SY
Sbjct  301  IARGSLLDYEAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFKNIIITPHVAGVTEHSY  360

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGDVALQLHAGTPLTGIE+VN
Sbjct  361  RSMAKIVGDVALQLHAGTPLTGIELVN  387



>ref|XP_007015899.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33518.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=384

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F+N+IITPHVAGVTE SY
Sbjct  298  IARGSLLDYEAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFKNIIITPHVAGVTEHSY  357

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGDVALQLHAGTPLTGIE+VN
Sbjct  358  RSMAKIVGDVALQLHAGTPLTGIELVN  384



>ref|XP_006441517.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441519.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441522.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54757.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54759.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54762.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=346

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+CGHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  260  IARGGLLDYEAIAHYLECGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  319

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  320  RSMAKVVGDVALQLHAGTPLTGLEFVN  346



>ref|XP_007015898.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33517.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=329

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+  HLGGLGIDVAWTEPFDPD+ IL F+NVIITPHVAG+TE S+
Sbjct  243  IARGGLLDYEAVVHHLESEHLGGLGIDVAWTEPFDPDDPILKFKNVIITPHVAGITEQSF  302

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH GTPLTGIE+VN
Sbjct  303  RSMAKVVGDVALQLHVGTPLTGIELVN  329



>ref|XP_006361376.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Solanum tuberosum]
Length=398

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RGGLLDYDAV  HLK GHLGGLGIDVAWTEPFDPD+AIL F +VIITPHVAGVT+ SY
Sbjct  312  ISRGGLLDYDAVLTHLKSGHLGGLGIDVAWTEPFDPDDAILKFPDVIITPHVAGVTKLSY  371

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG P TGIEIVN
Sbjct  372  RGMAKVVGDVALQLHAGKPFTGIEIVN  398



>ref|XP_007015897.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33516.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=343

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+  HLGGLGIDVAWTEPFDPD+ IL F+NVIITPHVAG+TE S+
Sbjct  257  IARGGLLDYEAVVHHLESEHLGGLGIDVAWTEPFDPDDPILKFKNVIITPHVAGITEQSF  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH GTPLTGIE+VN
Sbjct  317  RSMAKVVGDVALQLHVGTPLTGIELVN  343



>gb|ABK96037.1| unknown [Populus trichocarpa]
Length=343

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  257  IARGGLLDYNAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  317  RSMSKVVGDVALQLHSGNPLTGIEIVN  343



>gb|KDP31626.1| hypothetical protein JCGZ_14851 [Jatropha curcas]
Length=343

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +LK GHLGGLGIDVAWTEPFDPD+ IL + NV+ITPHVAGVTE+SY
Sbjct  257  IARGGLLDYEAVAQNLKSGHLGGLGIDVAWTEPFDPDDPILKYDNVLITPHVAGVTENSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTP TGIEIVN
Sbjct  317  RSMAKVVGDVALQLHAGTPWTGIEIVN  343



>ref|XP_007015896.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33515.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=376

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+  HLGGLGIDVAWTEPFDPD+ IL F+NVIITPHVAG+TE S+
Sbjct  290  IARGGLLDYEAVVHHLESEHLGGLGIDVAWTEPFDPDDPILKFKNVIITPHVAGITEQSF  349

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH GTPLTGIE+VN
Sbjct  350  RSMAKVVGDVALQLHVGTPLTGIELVN  376



>ref|XP_002319339.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
 gb|EEE95262.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
Length=388

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  302  IARGGLLDYNAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  361

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVALQLH+G PLTGIEIVN
Sbjct  362  RSMSKVVGDVALQLHSGNPLTGIEIVN  388



>ref|XP_006657609.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Oryza brachyantha]
Length=336

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  250  IARGGLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFPNVIITPHIAGVTEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LH+G P+T +E VN
Sbjct  310  RTMAKVVGDVALKLHSGEPITEVEFVN  336



>gb|KCW70958.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=269

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+CGHLGGLG DVAWTEPFDP++ IL ++NV++TPHVAGVTE SY
Sbjct  183  IARGGLLDYEAVARHLECGHLGGLGTDVAWTEPFDPNDKILKYKNVLLTPHVAGVTEHSY  242

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAGT LTG+E VN
Sbjct  243  RSMAKVVGDAALQLHAGTSLTGVEFVN  269



>ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
Length=380

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDYDAV  HL  GHLGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  294  VARGGLLDYDAVMQHLNSGHLGGLGIDVAWTEPFDPDDPILKFDNVLITPHVAGVTEHSY  353

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQ+HAG P +GIEIVN
Sbjct  354  RSMAKVVGDVALQIHAGAPCSGIEIVN  380



>ref|XP_006441518.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54758.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=418

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+CGHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  332  IARGGLLDYEAIAHYLECGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  391

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  392  RSMAKVVGDVALQLHAGTPLTGLEFVN  418



>ref|XP_006441521.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54761.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=421

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+CGHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  335  IARGGLLDYEAIAHYLECGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  394

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  395  RSMAKVVGDVALQLHAGTPLTGLEFVN  421



>gb|KCW70959.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=270

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+CGHLGGLG DVAWTEPFDP++ IL ++NV++TPHVAGVTE SY
Sbjct  184  IARGGLLDYEAVARHLECGHLGGLGTDVAWTEPFDPNDKILKYKNVLLTPHVAGVTEHSY  243

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAGT LTG+E VN
Sbjct  244  RSMAKVVGDAALQLHAGTSLTGVEFVN  270



>ref|XP_010243885.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243886.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243887.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243888.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
Length=350

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+ G LGGLGIDVAWTEPFDPD+ IL FQNV+ITPHVAGVTE SY
Sbjct  264  IARGGLLDYEAVADHLESGRLGGLGIDVAWTEPFDPDDPILKFQNVLITPHVAGVTEYSY  323

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQLHAG PLTGI+ VN
Sbjct  324  RAMAKVIGDVALQLHAGKPLTGIDAVN  350



>gb|AER41584.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza brachyantha]
Length=397

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  311  IARGGLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFPNVIITPHIAGVTEYSY  370

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LH+G P+T +E VN
Sbjct  371  RTMAKVVGDVALKLHSGEPITEVEFVN  397



>ref|XP_010243882.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
 ref|XP_010243884.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
Length=404

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV +HL+ G LGGLGIDVAWTEPFDPD+ IL FQNV+ITPHVAGVTE SY
Sbjct  318  IARGGLLDYEAVADHLESGRLGGLGIDVAWTEPFDPDDPILKFQNVLITPHVAGVTEYSY  377

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQLHAG PLTGI+ VN
Sbjct  378  RAMAKVIGDVALQLHAGKPLTGIDAVN  404



>gb|AER41609.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=373

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  287  IARGRLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHIAGVTEYSY  346

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LH+G P+T +E VN
Sbjct  347  RTMAKVVGDVALKLHSGEPITEVEFVN  373



>gb|KJB55660.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55661.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55662.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=349

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLGIDVAW EPFDP++ +L F+NVI+TPHVAGVTE SY
Sbjct  263  IARGGLLDYEAVVQHLESGHLGGLGIDVAWKEPFDPNDPVLKFKNVILTPHVAGVTEHSY  322

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG PL GIE+VN
Sbjct  323  RSMAKVVGDVALQLHAGKPLKGIELVN  349



>gb|EEC81831.1| hypothetical protein OsI_25581 [Oryza sativa Indica Group]
Length=383

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  297  IARGRLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHIAGVTEYSY  356

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LH+G P+T +E VN
Sbjct  357  RTMAKVVGDVALKLHSGEPITEVEFVN  383



>ref|XP_010063710.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X2 [Eucalyptus grandis]
 gb|KCW70957.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=343

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+CGHLGGLG DVAWTEPFDP++ IL ++NV++TPHVAGVTE SY
Sbjct  257  IARGGLLDYEAVARHLECGHLGGLGTDVAWTEPFDPNDKILKYKNVLLTPHVAGVTEHSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAGT LTG+E VN
Sbjct  317  RSMAKVVGDAALQLHAGTSLTGVEFVN  343



>ref|XP_010063709.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=344

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+CGHLGGLG DVAWTEPFDP++ IL ++NV++TPHVAGVTE SY
Sbjct  258  IARGGLLDYEAVARHLECGHLGGLGTDVAWTEPFDPNDKILKYKNVLLTPHVAGVTEHSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAGT LTG+E VN
Sbjct  318  RSMAKVVGDAALQLHAGTSLTGVEFVN  344



>gb|KJB55658.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55659.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55665.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=340

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLGIDVAW EPFDP++ +L F+NVI+TPHVAGVTE SY
Sbjct  254  IARGGLLDYEAVVQHLESGHLGGLGIDVAWKEPFDPNDPVLKFKNVILTPHVAGVTEHSY  313

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG PL GIE+VN
Sbjct  314  RSMAKVVGDVALQLHAGKPLKGIELVN  340



>gb|KDO36393.1| hypothetical protein CISIN_1g045269mg [Citrus sinensis]
Length=99

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I RGGLLDY+AV ++L+ GHLGGLG+DVAWTEPFDP++ IL FQ+V+ITPHV GVTE SY
Sbjct  13   IVRGGLLDYEAVAHYLESGHLGGLGLDVAWTEPFDPNDPILKFQSVLITPHVGGVTEHSY  72

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R  AKVVGDVALQLHAGTPLTGIE VN
Sbjct  73   RSTAKVVGDVALQLHAGTPLTGIEPVN  99



>ref|XP_006478176.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X4 
[Citrus sinensis]
 ref|XP_006478177.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X5 
[Citrus sinensis]
Length=346

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+ GHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  260  IARGGLLDYEAIAHYLESGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  319

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  320  RSMAKVVGDVALQLHAGTPLTGLEFVN  346



>gb|KJB55664.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=383

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLGIDVAW EPFDP++ +L F+NVI+TPHVAGVTE SY
Sbjct  297  IARGGLLDYEAVVQHLESGHLGGLGIDVAWKEPFDPNDPVLKFKNVILTPHVAGVTEHSY  356

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG PL GIE+VN
Sbjct  357  RSMAKVVGDVALQLHAGKPLKGIELVN  383



>gb|KJB55663.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=374

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLGIDVAW EPFDP++ +L F+NVI+TPHVAGVTE SY
Sbjct  288  IARGGLLDYEAVVQHLESGHLGGLGIDVAWKEPFDPNDPVLKFKNVILTPHVAGVTEHSY  347

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG PL GIE+VN
Sbjct  348  RSMAKVVGDVALQLHAGKPLKGIELVN  374



>ref|XP_009393479.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393480.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGL IDVAWTEPFDP++ IL F NV+ITPHVAGVTE SY
Sbjct  257  IARGGLLDYNAVHQHLQSGHLGGLAIDVAWTEPFDPEDPILKFPNVLITPHVAGVTEYSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAG+PLTG+EIVN
Sbjct  317  RTMAKVVGDCALQLHAGSPLTGVEIVN  343



>ref|XP_006478175.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X3 
[Citrus sinensis]
Length=370

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+ GHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  284  IARGGLLDYEAIAHYLESGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  343

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  344  RSMAKVVGDVALQLHAGTPLTGLEFVN  370



>ref|XP_002459677.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
 gb|EER96198.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
Length=360

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY AVF+HL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPHVAGVTE SY
Sbjct  274  IARGGLLDYKAVFDHLESGHLGGLGIDVAWTEPFDPEDPILKFSNVIITPHVAGVTEYSY  333

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH+G   TGIE VN
Sbjct  334  RTMAKVVGDVALQLHSGEIFTGIEFVN  360



>ref|XP_010665339.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X4 [Vitis vinifera]
 emb|CBI39250.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+DY+AV  HL+ GHLGGLG DV WTEPF+PD+ IL FQNVI+TPHVAGVTE SY
Sbjct  257  IARGGLMDYEAVAYHLESGHLGGLGTDVTWTEPFNPDDQILKFQNVIVTPHVAGVTEHSY  316

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD+ALQLHAG PLTG+E VN
Sbjct  317  RSMAKVVGDIALQLHAGAPLTGLEFVN  343



>gb|EYU28234.1| hypothetical protein MIMGU_mgv1a007209mg [Erythranthe guttata]
Length=415

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV ++LK  HLGGLGIDVAWTEPFDPD+ IL F NVIITPHVAGVTE+SY
Sbjct  329  IARGGLLDYNAVLDNLKSSHLGGLGIDVAWTEPFDPDDPILKFPNVIITPHVAGVTENSY  388

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+MAKVVGDVA+QLH G  LTG+EIVN
Sbjct  389  RFMAKVVGDVAIQLHTGACLTGVEIVN  415



>ref|XP_006577809.1| PREDICTED: uncharacterized protein LOC100785085 isoform X1 [Glycine 
max]
 ref|XP_006577810.1| PREDICTED: uncharacterized protein LOC100785085 isoform X2 [Glycine 
max]
Length=344

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+DY+AV NHL+ GHLGGLG DVAWTEPF+PD+ I  F+NVI+TPHVAGVTE SY
Sbjct  258  VARGGLVDYEAVINHLESGHLGGLGTDVAWTEPFNPDDQIFKFKNVIMTPHVAGVTEHSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGDV LQLHAG PLTGIE+VN
Sbjct  318  RSMAKAVGDVVLQLHAGLPLTGIELVN  344



>ref|XP_010665338.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X3 [Vitis vinifera]
Length=351

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+DY+AV  HL+ GHLGGLG DV WTEPF+PD+ IL FQNVI+TPHVAGVTE SY
Sbjct  265  IARGGLMDYEAVAYHLESGHLGGLGTDVTWTEPFNPDDQILKFQNVIVTPHVAGVTEHSY  324

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD+ALQLHAG PLTG+E VN
Sbjct  325  RSMAKVVGDIALQLHAGAPLTGLEFVN  351



>gb|KHG10814.1| Glyoxylate reductase [Gossypium arboreum]
Length=383

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLG+DVAW EPFDP++ +L F+NV++TPHVAGVTE SY
Sbjct  297  IARGGLLDYEAVVQHLESGHLGGLGVDVAWKEPFDPNDPVLKFKNVVLTPHVAGVTEHSY  356

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAG PL GIE+VN
Sbjct  357  RSMAKVVGDVALQLHAGKPLKGIELVN  383



>ref|XP_010665337.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X2 [Vitis vinifera]
Length=356

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+DY+AV  HL+ GHLGGLG DV WTEPF+PD+ IL FQNVI+TPHVAGVTE SY
Sbjct  270  IARGGLMDYEAVAYHLESGHLGGLGTDVTWTEPFNPDDQILKFQNVIVTPHVAGVTEHSY  329

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD+ALQLHAG PLTG+E VN
Sbjct  330  RSMAKVVGDIALQLHAGAPLTGLEFVN  356



>ref|XP_009393478.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=375

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGL IDVAWTEPFDP++ IL F NV+ITPHVAGVTE SY
Sbjct  289  IARGGLLDYNAVHQHLQSGHLGGLAIDVAWTEPFDPEDPILKFPNVLITPHVAGVTEYSY  348

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAG+PLTG+EIVN
Sbjct  349  RTMAKVVGDCALQLHAGSPLTGVEIVN  375



>ref|XP_002282092.2| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X1 [Vitis vinifera]
Length=382

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+DY+AV  HL+ GHLGGLG DV WTEPF+PD+ IL FQNVI+TPHVAGVTE SY
Sbjct  296  IARGGLMDYEAVAYHLESGHLGGLGTDVTWTEPFNPDDQILKFQNVIVTPHVAGVTEHSY  355

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD+ALQLHAG PLTG+E VN
Sbjct  356  RSMAKVVGDIALQLHAGAPLTGLEFVN  382



>gb|EMT11768.1| Glyoxylate reductase [Aegilops tauschii]
Length=346

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPHVAG+TE SY
Sbjct  260  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHVAGITEYSY  319

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P T IE VN
Sbjct  320  RTMAKVVGDVALKLHAGEPFTEIEFVN  346



>ref|XP_006478174.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=411

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+ GHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  325  IARGGLLDYEAIAHYLESGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  384

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  385  RSMAKVVGDVALQLHAGTPLTGLEFVN  411



>ref|XP_006478173.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=421

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+ GHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  335  IARGGLLDYEAIAHYLESGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  394

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLHAGTPLTG+E VN
Sbjct  395  RSMAKVVGDVALQLHAGTPLTGLEFVN  421



>ref|XP_008378743.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Malus domestica]
Length=394

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV   L+ GHLGGLGIDVAWTEPFDPD+ IL F NVIITPHVAGVTE SY
Sbjct  308  IARGGLLDYEAVSYSLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIITPHVAGVTEYSY  367

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVA+QLH G PLTGIE VN
Sbjct  368  RSMAKVVGDVAIQLHEGKPLTGIEFVN  394



>gb|EMS56366.1| Glyoxylate reductase [Triticum urartu]
Length=346

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPHVAG+TE SY
Sbjct  260  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHVAGITEYSY  319

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P T IE VN
Sbjct  320  RTMAKVVGDVALKLHAGEPFTEIEFVN  346



>ref|XP_004499721.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Cicer arietinum]
Length=379

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY+AV  HLK GHLGGLG DVAWTEPFDPD+ IL F+NVI+TPH+AGVTE SY
Sbjct  293  VARGRLLDYEAVVKHLKTGHLGGLGTDVAWTEPFDPDDQILKFKNVIMTPHIAGVTEHSY  352

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDV LQLH G PLTGIE+VN
Sbjct  353  RSMAKVVGDVVLQLHDGLPLTGIELVN  379



>dbj|BAD31969.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD30579.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
Length=336

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  250  IARGRLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHIAGVTEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVG VAL+LH+G P+T +E VN
Sbjct  310  RTMAKVVGGVALKLHSGEPITEVEFVN  336



>ref|XP_004499720.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Cicer arietinum]
Length=388

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY+AV  HLK GHLGGLG DVAWTEPFDPD+ IL F+NVI+TPH+AGVTE SY
Sbjct  302  VARGRLLDYEAVVKHLKTGHLGGLGTDVAWTEPFDPDDQILKFKNVIMTPHIAGVTEHSY  361

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDV LQLH G PLTGIE+VN
Sbjct  362  RSMAKVVGDVVLQLHDGLPLTGIELVN  388



>gb|KHN24796.1| D-3-phosphoglycerate dehydrogenase [Glycine soja]
Length=391

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+DY+AV NHL+ GHLGGLG DVAWTEPF+PD+ I  F+NVI+TPHVAGVTE SY
Sbjct  305  VARGGLVDYEAVINHLESGHLGGLGTDVAWTEPFNPDDQIFKFKNVIMTPHVAGVTEHSY  364

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGDV LQLHAG PLTGIE+VN
Sbjct  365  RSMAKAVGDVVLQLHAGLPLTGIELVN  391



>ref|NP_001059330.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAF21244.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAG89417.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96786.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66922.1| hypothetical protein OsJ_23776 [Oryza sativa Japonica Group]
Length=374

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDYDAVFNHLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH+AGVTE SY
Sbjct  288  IARGRLLDYDAVFNHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHIAGVTEYSY  347

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVG VAL+LH+G P+T +E VN
Sbjct  348  RTMAKVVGGVALKLHSGEPITEVEFVN  374



>ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula]
 gb|AES68324.1| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
[Medicago truncatula]
Length=382

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY+AV  +L+ GHLGGLG DVAWTEPFDPD+ IL F+NVI+TPH+AGVTE SY
Sbjct  296  VARGRLLDYEAVVKNLESGHLGGLGTDVAWTEPFDPDDRILKFKNVIMTPHIAGVTEHSY  355

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDV LQLHAG PLTGIE+VN
Sbjct  356  RSMAKVVGDVVLQLHAGNPLTGIELVN  382



>ref|XP_009379254.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X1 [Pyrus x bretschneideri]
Length=392

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NVIITPHVAGVTE SY
Sbjct  306  IARGGLLDYEAVSYNLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIITPHVAGVTEYSY  365

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD A+QLH G PLTGIE VN
Sbjct  366  RSMAKVVGDAAIQLHEGKPLTGIEFVN  392



>ref|XP_009379261.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X2 [Pyrus x bretschneideri]
Length=390

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NVIITPHVAGVTE SY
Sbjct  304  IARGGLLDYEAVSYNLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIITPHVAGVTEYSY  363

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD A+QLH G PLTGIE VN
Sbjct  364  RSMAKVVGDAAIQLHEGKPLTGIEFVN  390



>ref|XP_008218923.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=355

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  269  IARGGLLDYEAVLYYLESGHLGGLGIDVAWTEPFDPDDPILKFCNVLITPHVAGVTEYSY  328

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE VN
Sbjct  329  RSMSKVVGDVAIQLHEGRPLTGIEFVN  355



>ref|XP_008218922.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=374

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  288  IARGGLLDYEAVLYYLESGHLGGLGIDVAWTEPFDPDDPILKFCNVLITPHVAGVTEYSY  347

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE VN
Sbjct  348  RSMSKVVGDVAIQLHEGRPLTGIEFVN  374



>ref|XP_008218920.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=376

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  290  IARGGLLDYEAVLYYLESGHLGGLGIDVAWTEPFDPDDPILKFCNVLITPHVAGVTEYSY  349

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE VN
Sbjct  350  RSMSKVVGDVAIQLHEGRPLTGIEFVN  376



>ref|XP_007223301.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
 gb|EMJ24500.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
Length=374

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  288  IARGGLLDYEAVSYYLESGHLGGLGIDVAWTEPFDPDDPILKFSNVLITPHVAGVTEYSY  347

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE VN
Sbjct  348  RSMSKVVGDVAIQLHEGRPLTGIEFVN  374



>dbj|BAJ91330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  209  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHIAGITEYSY  268

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P   IE VN
Sbjct  269  RTMAKVVGDVALKLHAGEPFNEIEFVN  295



>dbj|BAK03270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  250  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHIAGITEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P   IE VN
Sbjct  310  RTMAKVVGDVALKLHAGEPFNEIEFVN  336



>ref|XP_011457341.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457342.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457343.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457344.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=335

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLL+Y+AV N+L+ G+LGGLGIDVAWTEPFDPD+ IL F NV+ITPHVAGVTE SY
Sbjct  249  IARGGLLNYEAVLNYLESGYLGGLGIDVAWTEPFDPDDPILKFNNVLITPHVAGVTEYSY  308

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTG+E VN
Sbjct  309  RSMSKVVGDVAIQLHEGKPLTGLEFVN  335



>dbj|BAK02358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  250  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHIAGITEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P   IE VN
Sbjct  310  RTMAKVVGDVALKLHAGEPFNEIEFVN  336



>ref|XP_010428086.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=371

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ + +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  285  IARGGLINYESAYQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  344

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIEIVN
Sbjct  345  RSMAKIVGDLALQLHEGLPLTGIEIVN  371



>ref|XP_010471237.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=370

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ + +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  284  IARGGLINYESAYQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  343

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIEIVN
Sbjct  344  RSMAKIVGDLALQLHEGLPLTGIEIVN  370



>ref|XP_002888861.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65120.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ F +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  287  IARGGLINYESAFQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  346

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIE VN
Sbjct  347  RSMAKIVGDLALQLHEGLPLTGIEFVN  373



>dbj|BAK00574.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  292  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHIAGITEYSY  351

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P   IE VN
Sbjct  352  RTMAKVVGDVALKLHAGEPFNEIEFVN  378



>ref|XP_009379247.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
[Pyrus x bretschneideri]
Length=382

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NVIITPHVAGVTE SY
Sbjct  296  IARGGLLDYEAVSYNLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIITPHVAGVTEYSY  355

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD  +QLH G PLTGIE VN
Sbjct  356  RSMAKVVGDAVIQLHEGKPLTGIEFVN  382



>dbj|BAK05235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAWTEPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  250  IARGRLLDYTAVFNHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVIITPHIAGITEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LHAG P   +E VN
Sbjct  310  RTMAKVVGDVALKLHAGEPFNEVEFVN  336



>ref|NP_177364.2| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
ARA [Arabidopsis thaliana]
 gb|AEE35287.1| D-isomer specific 2-hydroxyacid dehydrogenase-like protein [Arabidopsis 
thaliana]
Length=373

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ F +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  287  IARGGLINYESAFQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  346

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIE VN
Sbjct  347  RSMAKIVGDLALQLHEGLPLTGIEFVN  373



>ref|XP_010910119.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLL+Y++V  HL+ GHLGGLGIDVAWTEPFDP++ IL F NV++TPH+AGVTE SY
Sbjct  258  VARGGLLEYNSVLRHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVLMTPHLAGVTEHSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAG P +GIEIVN
Sbjct  318  RTMAKVVGDCALQLHAGKPFSGIEIVN  344



>ref|XP_004984235.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Setaria italica]
Length=336

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AVF+HLK GHL GLGIDVAW EPFDP++ IL F NVIITPHVAGVTE SY
Sbjct  250  IARGRLLDYNAVFDHLKSGHLAGLGIDVAWMEPFDPEDPILKFPNVIITPHVAGVTEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH+G P TGIE VN
Sbjct  310  RTMAKSVGDTALQLHSGEPFTGIEFVN  336



>gb|AAG51802.1|AC067754_18 phosphoglycerate dehydrogenase, putative; 33424-31403 [Arabidopsis 
thaliana]
Length=344

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ F +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  258  IARGGLINYESAFQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIE VN
Sbjct  318  RSMAKIVGDLALQLHEGLPLTGIEFVN  344



>gb|KDO36140.1| hypothetical protein CISIN_1g044647mg, partial [Citrus sinensis]
Length=93

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I RGGLLDY+ V ++L+ GHLGGLG+DVAWT+PFDP+N IL FQ V+ITPHV GVTE SY
Sbjct  7    IVRGGLLDYEVVAHYLESGHLGGLGLDVAWTKPFDPNNPILKFQIVLITPHVGGVTEHSY  66

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R  AKVVGDVALQLHAGTPL GIE VN
Sbjct  67   RSTAKVVGDVALQLHAGTPLRGIEPVN  93



>ref|XP_010910114.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Elaeis guineensis]
Length=379

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLL+Y++V  HL+ GHLGGLGIDVAWTEPFDP++ IL F NV++TPH+AGVTE SY
Sbjct  293  VARGGLLEYNSVLRHLESGHLGGLGIDVAWTEPFDPEDPILKFPNVLMTPHLAGVTEHSY  352

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHAG P +GIEIVN
Sbjct  353  RTMAKVVGDCALQLHAGKPFSGIEIVN  379



>gb|AFK43325.1| unknown [Medicago truncatula]
Length=344

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY+AV  +L+ GHLGGLG DVAWTEPFDPD+ IL F+NVI+TPH+AGVTE SY
Sbjct  258  VARGRLLDYEAVVKNLESGHLGGLGTDVAWTEPFDPDDRILKFKNVIMTPHIAGVTEHSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDV LQLHA  PLTGIE+VN
Sbjct  318  RSMAKVVGDVVLQLHARNPLTGIELVN  344



>ref|XP_006390689.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
 gb|ESQ27975.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
Length=350

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ + +L+ GHLGG+GIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  264  IARGGLINYESAYQNLESGHLGGIGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  323

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G PLTGIE VN
Sbjct  324  RSMAKVVGDVALQLHEGLPLTGIEFVN  350



>ref|XP_008461933.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Cucumis melo]
Length=337

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLGIDVAWTEPFDPD+ IL F NVI TPHVAGVTE SY
Sbjct  251  VARGRLLDYQSTLHSLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIFTPHVAGVTEHSY  310

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQ+HAG+P+TGIE VN
Sbjct  311  RSMAKVIGDVALQIHAGSPMTGIEFVN  337



>ref|XP_007148628.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
 gb|ESW20622.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
Length=382

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL++Y+AV N+L+ GHLGGLG DVAWTEPF+PD+ I  F+NVI+TPH+AGVTE SY
Sbjct  296  VARGGLVEYEAVINNLESGHLGGLGTDVAWTEPFNPDDQIFKFKNVIMTPHIAGVTEHSY  355

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGDV LQLHAG PLTGIE+VN
Sbjct  356  RSMAKAVGDVVLQLHAGVPLTGIELVN  382



>ref|XP_004139684.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus]
Length=275

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLG+DVAWTEPFDP++ IL F NVI TPHVAGVTE SY
Sbjct  189  VARGRLLDYQSTLHSLESGHLGGLGMDVAWTEPFDPNDPILKFNNVICTPHVAGVTEHSY  248

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQ+HAG+PLTGIE VN
Sbjct  249  RSMAKVIGDVALQMHAGSPLTGIEFVN  275



>ref|XP_003557318.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Brachypodium 
distachyon]
Length=377

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVFNHL+ GHLGGLGIDVAW EPFDP++ IL F NVIITPH+AG+TE SY
Sbjct  291  IARGLLLDYKAVFNHLESGHLGGLGIDVAWMEPFDPEDPILKFSNVIITPHIAGITEYSY  350

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVAL+LH G P T IE VN
Sbjct  351  RTMAKVVGDVALKLHTGEPFTEIEFVN  377



>ref|XP_010414841.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=373

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ + +L+ GHLGGLG DVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  287  IARGGLINYESAYQNLESGHLGGLGTDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  346

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIEIVN
Sbjct  347  RSMAKIVGDLALQLHEGLPLTGIEIVN  373



>ref|XP_008218917.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
 ref|XP_008218918.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=342

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV++TPHVAGVT+ S+
Sbjct  256  IARGGLLDYEAVSYYLESGHLGGLGIDVAWTEPFDPDDPILKFSNVLVTPHVAGVTDYSH  315

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE+VN
Sbjct  316  RSMSKVVGDVAIQLHEGRPLTGIEVVN  342



>ref|XP_008218916.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=353

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV++TPHVAGVT+ S+
Sbjct  267  IARGGLLDYEAVSYYLESGHLGGLGIDVAWTEPFDPDDPILKFSNVLVTPHVAGVTDYSH  326

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE+VN
Sbjct  327  RSMSKVVGDVAIQLHEGRPLTGIEVVN  353



>ref|XP_008218915.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=355

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  +L+ GHLGGLGIDVAWTEPFDPD+ IL F NV++TPHVAGVT+ S+
Sbjct  269  IARGGLLDYEAVSYYLESGHLGGLGIDVAWTEPFDPDDPILKFSNVLVTPHVAGVTDYSH  328

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGDVA+QLH G PLTGIE+VN
Sbjct  329  RSMSKVVGDVAIQLHEGRPLTGIEVVN  355



>gb|KGN44470.1| hypothetical protein Csa_7G302340 [Cucumis sativus]
Length=302

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLG+DVAWTEPFDP++ IL F NVI TPHVAGVTE SY
Sbjct  216  VARGRLLDYQSTLHSLESGHLGGLGMDVAWTEPFDPNDPILKFNNVICTPHVAGVTEHSY  275

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQ+HAG+PLTGIE VN
Sbjct  276  RSMAKVIGDVALQMHAGSPLTGIEFVN  302



>emb|CDY50445.1| BnaC06g24190D [Brassica napus]
Length=373

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ +  L+ GHLGGLG DVAW+EPFDP++ IL F+NVI+TPHVAGVTE SY
Sbjct  286  IARGGLVNYESAYQSLESGHLGGLGTDVAWSEPFDPNDPILKFKNVIMTPHVAGVTEYSY  345

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G PLTGIE+VN
Sbjct  346  RSMAKVVGDVALQLHEGLPLTGIELVN  372



>ref|XP_004161907.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus]
Length=337

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLG+DVAWTEPFDP++ IL F NVI TPHVAGVTE SY
Sbjct  251  VARGRLLDYQSTLHSLESGHLGGLGMDVAWTEPFDPNDPILKFNNVICTPHVAGVTEHSY  310

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKV+GDVALQ+HAG+PLTGIE VN
Sbjct  311  RSMAKVIGDVALQMHAGSPLTGIEFVN  337



>ref|XP_008802910.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
 ref|XP_008802911.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=344

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLL+Y++V +HL+ G+LGGLGIDVAWTEPFDP++ IL F NV+ITPHVAGVTE SY
Sbjct  258  VARGGLLEYNSVLHHLESGNLGGLGIDVAWTEPFDPEDPILKFPNVLITPHVAGVTEHSY  317

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHA  P +GIEIVN
Sbjct  318  RTMAKVVGDCALQLHARKPFSGIEIVN  344



>ref|XP_006301744.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
 gb|EOA34642.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
Length=374

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RGGL++Y++ + +L+ GHLGGLGIDVAW+EPFD ++ IL F+NVIITPHVAGVTE SY
Sbjct  288  ISRGGLINYESAYQNLESGHLGGLGIDVAWSEPFDSNDPILKFKNVIITPHVAGVTEYSY  347

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIEIVN
Sbjct  348  RSMAKIVGDLALQLHEGLPLTGIEIVN  374



>ref|XP_008802909.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=379

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLL+Y++V +HL+ G+LGGLGIDVAWTEPFDP++ IL F NV+ITPHVAGVTE SY
Sbjct  293  VARGGLLEYNSVLHHLESGNLGGLGIDVAWTEPFDPEDPILKFPNVLITPHVAGVTEHSY  352

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGD ALQLHA  P +GIEIVN
Sbjct  353  RTMAKVVGDCALQLHARKPFSGIEIVN  379



>ref|XP_010415950.1| PREDICTED: LOW QUALITY PROTEIN: glyoxylate reductase/hydroxypyruvate 
reductase-like [Camelina sativa]
Length=370

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ + +L+ G LGGLG DVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  284  IARGGLINYESAYQNLESGQLGGLGTDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  343

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+VGD+ALQLH G PLTGIEIVN
Sbjct  344  RSMAKIVGDLALQLHEGLPLTGIEIVN  370



>ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max]
 gb|ACU23032.1| unknown [Glycine max]
Length=391

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+DY+AV N L+ GHLGGLG DVAWTEPF+PD+ I  F+NVI+TPHVAGVTE  Y
Sbjct  305  VARGGLVDYEAVINPLESGHLGGLGTDVAWTEPFNPDDQIFKFKNVIMTPHVAGVTEHFY  364

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R+MAK VGDV  QLHAG PLTGIE+VN
Sbjct  365  RFMAKAVGDVVFQLHAGLPLTGIELVN  391



>emb|CDX68275.1| BnaA07g23150D [Brassica napus]
Length=372

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL++Y++ +  L+ G+LGGLG DVAW+EPFDP++ IL F+NVI+TPHVAGVTE SY
Sbjct  286  IARGGLINYESAYQSLESGYLGGLGTDVAWSEPFDPNDPILKFKNVIMTPHVAGVTEFSY  345

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G PLTGIE+VN
Sbjct  346  RSMAKVVGDVALQLHEGLPLTGIELVN  372



>ref|XP_006441516.1| hypothetical protein CICLE_v10024174mg [Citrus clementina]
 gb|ESR54756.1| hypothetical protein CICLE_v10024174mg [Citrus clementina]
Length=201

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I RGGLLDY+AV ++L+ GHLGGLG+DVAWT+PFDP+N IL FQ V+ITPHV GV E  Y
Sbjct  115  IVRGGLLDYEAVAHYLESGHLGGLGLDVAWTKPFDPNNPILKFQIVLITPHVGGVAEHFY  174

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R  AKVVGDVALQLHAGTPL GIE VN
Sbjct  175  RSTAKVVGDVALQLHAGTPLRGIEPVN  201



>ref|XP_009104868.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Brassica 
rapa]
Length=369

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+ Y++ +  L+ GHLGGLG DVAW+EPFDP++ IL F+NVI+TPHVAGVTE SY
Sbjct  283  IARGGLVSYESAYQSLESGHLGGLGTDVAWSEPFDPNDPILKFKNVIMTPHVAGVTEFSY  342

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G PLT IE+VN
Sbjct  343  RSMAKVVGDVALQLHEGLPLTRIELVN  369



>ref|XP_009104867.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X1 [Brassica 
rapa]
Length=372

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL+ Y++ +  L+ GHLGGLG DVAW+EPFDP++ IL F+NVI+TPHVAGVTE SY
Sbjct  286  IARGGLVSYESAYQSLESGHLGGLGTDVAWSEPFDPNDPILKFKNVIMTPHVAGVTEFSY  345

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G PLT IE+VN
Sbjct  346  RSMAKVVGDVALQLHEGLPLTRIELVN  372



>ref|XP_002459676.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
 gb|EER96197.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
Length=385

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVIITPHVAGVTE SY
Sbjct  299  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVIITPHVAGVTEYSY  358

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH+G P T +E VN
Sbjct  359  RTMAKSVGDTALQLHSGQPFTEVEFVN  385



>gb|KFK41640.1| hypothetical protein AALP_AA2G154000 [Arabis alpina]
Length=367

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG L++Y++ + +L+ GHLGGLGIDVAW+EPFDP++ IL F+NVIITPHVAGVTE SY
Sbjct  281  IARGRLINYESAYQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSY  340

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVA+QLH G P T IE VN
Sbjct  341  RSMAKVVGDVAIQLHEGLPFTRIEFVN  367



>ref|XP_006858573.1| hypothetical protein AMTR_s00071p00183090 [Amborella trichopoda]
 gb|ERN20040.1| hypothetical protein AMTR_s00071p00183090 [Amborella trichopoda]
Length=373

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGG+LDY AV  HL+ GHLGGL IDVAWTEPFDP++ IL F NV+ITPH+AGVTE SY
Sbjct  287  VARGGVLDYQAVKYHLESGHLGGLAIDVAWTEPFDPEDPILKFPNVLITPHIAGVTEYSY  346

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK+V + ALQ+H+G PLTGIE VN
Sbjct  347  RKMAKIVAESALQVHSGAPLTGIECVN  373



>ref|XP_004963884.1| PREDICTED: formate dehydrogenase 1, mitochondrial-like [Setaria 
italica]
Length=548

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AV +HL+ GHL GLGIDVAW EPFDP++ IL F NVI+TPHVAG+TE S 
Sbjct  462  IARGRLLDYKAVLSHLESGHLSGLGIDVAWMEPFDPEDPILKFSNVIMTPHVAGITEYSL  521

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R  AK+VGDVALQLH+G P TGIE VN
Sbjct  522  RTAAKIVGDVALQLHSGKPFTGIEFVN  548



>tpg|DAA39793.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=296

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  210  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  269

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  270  RTMAKSVGDTALQLHLGEAFTEVEFVN  296



>ref|XP_010535279.1| PREDICTED: formate dehydrogenase, mitochondrial [Tarenaya hassleriana]
Length=367

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG L++Y+A + +L+ GHLGGLG+DVAW+EP DPD+ I  F NVI+TPHVAGVTE SY
Sbjct  281  IARGNLIEYEAAYQNLESGHLGGLGMDVAWSEPVDPDDPIFKFNNVIVTPHVAGVTELSY  340

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAKVVGDVALQLH G  +TGI+ VN
Sbjct  341  RSMAKVVGDVALQLHEGRSITGIDFVN  367



>ref|XP_008667395.1| PREDICTED: uncharacterized protein LOC100217241 isoform X3 [Zea 
mays]
 tpg|DAA39796.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=336

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  250  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  309

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  310  RTMAKSVGDTALQLHLGEAFTEVEFVN  336



>ref|XP_008667394.1| PREDICTED: uncharacterized protein LOC100217241 isoform X2 [Zea 
mays]
Length=386

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  300  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  359

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  360  RTMAKSVGDTALQLHLGEAFTEVEFVN  386



>ref|NP_001137068.1| uncharacterized protein LOC100217241 [Zea mays]
 gb|ACF83195.1| unknown [Zea mays]
 tpg|DAA39794.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=379

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  293  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  352

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  353  RTMAKSVGDTALQLHLGEAFTEVEFVN  379



>tpg|DAA39795.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=378

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  292  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  351

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  352  RTMAKSVGDTALQLHLGEAFTEVEFVN  378



>tpg|DAA39792.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=395

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  309  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  368

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  369  RTMAKSVGDTALQLHLGEAFTEVEFVN  395



>ref|XP_006858572.1| hypothetical protein AMTR_s00071p00182560 [Amborella trichopoda]
 gb|ERN20039.1| hypothetical protein AMTR_s00071p00182560 [Amborella trichopoda]
Length=340

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGG+LDY++V  HL+ GHLGG+  DVAWTEPFDP++ IL F NV+ITPHVAGVTE SY
Sbjct  254  VARGGVLDYESVKYHLESGHLGGMAFDVAWTEPFDPEDPILKFPNVLITPHVAGVTECSY  313

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
              M K+V + ALQ HAG PLTGIEIVN
Sbjct  314  GTMGKIVAECALQFHAGDPLTGIEIVN  340



>ref|XP_010683622.1| PREDICTED: formate dehydrogenase 2, mitochondrial isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=302

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDYDAV   L+ GHLGGLGIDVAWTEPFDP + IL   NV+ITPHVAGVTESSY
Sbjct  216  VARGGLLDYDAVAQGLQSGHLGGLGIDVAWTEPFDPKDPILQHPNVLITPHVAGVTESSY  275

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGD ALQ+H  + + G++ VN
Sbjct  276  RAMSKVVGDAALQIHDMSSIKGVQFVN  302



>ref|XP_008667393.1| PREDICTED: uncharacterized protein LOC100217241 isoform X1 [Zea 
mays]
Length=423

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY AVF+HL+ GHL GLGIDVAW EPFDP++ +L F NVI+TPHVAGVTE SY
Sbjct  337  IARGRLLDYKAVFDHLESGHLAGLGIDVAWMEPFDPEDPVLKFPNVILTPHVAGVTEYSY  396

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK VGD ALQLH G   T +E VN
Sbjct  397  RTMAKSVGDTALQLHLGEAFTEVEFVN  423



>ref|XP_010683411.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683483.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683555.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDYDAV   L+ GHLGGLGIDVAWTEPFDP + IL   NV+ITPHVAGVTESSY
Sbjct  240  VARGGLLDYDAVAQGLQSGHLGGLGIDVAWTEPFDPKDPILQHPNVLITPHVAGVTESSY  299

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M+KVVGD ALQ+H  + + G++ VN
Sbjct  300  RAMSKVVGDAALQIHDMSSIKGVQFVN  326



>ref|XP_007015902.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
 gb|EOY33521.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
Length=321

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG LLDY+AV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F+N+IITPHVAGVTE SY
Sbjct  249  IARGSLLDYEAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFKNIIITPHVAGVTEHSY  308

Query  462  RYMAKVVGDVALQ  424
            R MAK+VGDVALQ
Sbjct  309  RSMAKIVGDVALQ  321



>gb|ABR18201.1| unknown [Picea sitchensis]
Length=355

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDY+AV   L+ GHLGGLG DVAW EPFDP + IL    V ITPHVAGVTE SY
Sbjct  269  VARGGLLDYEAVKASLESGHLGGLGADVAWFEPFDPADPILQHPKVFITPHVAGVTEFSY  328

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R MAK++GD AL LH G  L G+EIVN
Sbjct  329  RNMAKIIGDCALHLHNGDSLVGVEIVN  355



>ref|XP_001767463.1| predicted protein [Physcomitrella patens]
 gb|EDQ67787.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV   ++ GHLGGL IDVAWTEPFDP + IL   NV+ITPHV GVT+ SY
Sbjct  249  IARGGLLDYDAVLAGIESGHLGGLAIDVAWTEPFDPTDPILQHPNVLITPHVGGVTDLSY  308

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            + M K++ + A QL  G P TGIE+VN
Sbjct  309  QAMGKIIAETAHQLSVGMPTTGIEVVN  335



>ref|XP_011003977.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X6 [Populus euphratica]
Length=373

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDYDAV +HL+ GHLGGLGIDVAWTEPFDPD+ IL F NVII+PHVAGVTE SY
Sbjct  308  IARGGLLDYDAVVHHLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIISPHVAGVTEHSY  367

Query  462  RYMAKV  445
            R+M+KV
Sbjct  368  RFMSKV  373



>ref|XP_001766047.1| predicted protein [Physcomitrella patens]
 gb|EDQ69106.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDYDAV   L+ GHLGGL IDVAW+EP DP + IL   NV++TPHVAGV  S+Y
Sbjct  252  VARGGLLDYDAVLGALESGHLGGLAIDVAWSEPLDPSDPILQHSNVLVTPHVAGVCTSAY  311

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            + M K++ D A QL  G P +GIE VN
Sbjct  312  QNMGKIIADSAYQLSIGMPTSGIEYVN  338



>gb|KJB55666.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=338

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV  HL+ GHLGGLGIDVAW EPFDP++ +L F+NVI+TPHVAGVTE SY
Sbjct  263  IARGGLLDYEAVVQHLESGHLGGLGIDVAWKEPFDPNDPVLKFKNVILTPHVAGVTEHSY  322

Query  462  RYMAKV  445
            R MAKV
Sbjct  323  RSMAKV  328



>gb|KDO56050.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56051.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56052.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=324

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+CGHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  260  IARGGLLDYEAIAHYLECGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  319

Query  462  RYMAK  448
            R MAK
Sbjct  320  RSMAK  324



>gb|KDO56049.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=348

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+A+ ++L+CGHLGGLGIDVAWTEPFDP++ IL F+NV+ITPHV GVTE SY
Sbjct  284  IARGGLLDYEAIAHYLECGHLGGLGIDVAWTEPFDPNDPILKFKNVLITPHVGGVTEHSY  343

Query  462  RYMAK  448
            R MAK
Sbjct  344  RSMAK  348



>dbj|BAC22329.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAD31965.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
Length=316

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG +LDYDAVF+HLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH AGVTE S+
Sbjct  246  IARGHILDYDAVFDHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHTAGVTEYSF  305

Query  462  RYMAKVV  442
            R  AK+V
Sbjct  306  RAAAKIV  312



>gb|AER41626.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glumipatula]
Length=337

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG +LDYDAVF+HLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH AGVTE S+
Sbjct  267  IARGHILDYDAVFDHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHTAGVTEYSF  326

Query  462  RYMAKVV  442
            R  AK+V
Sbjct  327  RAAAKIV  333



>gb|AER41608.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=333

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG +LDYDAVF+HLK GHLGGLGIDVAWTEP+DP++ IL F NVIITPH AGVTE S+
Sbjct  260  IARGHILDYDAVFDHLKSGHLGGLGIDVAWTEPYDPEDPILKFSNVIITPHTAGVTEYSF  319

Query  462  RYMAKV  445
            R  AKV
Sbjct  320  RAAAKV  325



>gb|EPS66269.1| hypothetical protein M569_08508, partial [Genlisea aurea]
Length=344

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RGGLLDYDAV  +L+ GHLGGL IDVAW EPF+PD+A+L F NVI+TPHVAGVTE SY
Sbjct  279  ISRGGLLDYDAVVKNLESGHLGGLAIDVAWREPFEPDDAVLKFPNVIVTPHVAGVTECSY  338

Query  462  RYMAKV  445
            R MAKV
Sbjct  339  RAMAKV  344



>ref|XP_010095911.1| Glyoxylate reductase/hydroxypyruvate reductase [Morus notabilis]
 gb|EXB62505.1| Glyoxylate reductase/hydroxypyruvate reductase [Morus notabilis]
Length=567

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGLLDY+AV+++L+ GHLGGLGIDVAWTEPF+P++ IL F NV+ITPHVAGVTE++Y
Sbjct  148  IARGGLLDYEAVYHYLQSGHLGGLGIDVAWTEPFNPEDPILKFNNVLITPHVAGVTENAY  207

Query  462  RYMAK  448
            R M+K
Sbjct  208  RCMSK  212



>ref|XP_008461935.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X3 [Cucumis 
melo]
Length=279

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLGIDVAWTEPFDPD+ IL F NVI TPHVAGVTE SY
Sbjct  138  VARGRLLDYQSTLHSLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIFTPHVAGVTEHSY  197

Query  462  RYMAKV  445
            R MAKV
Sbjct  198  RSMAKV  203



>ref|XP_008461934.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Cucumis melo]
Length=329

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG LLDY +  + L+ GHLGGLGIDVAWTEPFDPD+ IL F NVI TPHVAGVTE SY
Sbjct  251  VARGRLLDYQSTLHSLESGHLGGLGIDVAWTEPFDPDDPILKFNNVIFTPHVAGVTEHSY  310

Query  462  RYMAKVV  442
            R MAK +
Sbjct  311  RSMAKCL  317



>ref|XP_005646982.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22438.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDY AV   LK GH+GGLG+DV WTEPFDP + +     V++TPHVAGVTE SY
Sbjct  245  VARGGLLDYSAVRAGLKSGHIGGLGLDVHWTEPFDPQDWVAQHPRVVLTPHVAGVTELSY  304

Query  462  RYMAKVVGDVALQLHAGTPLT  400
            R MA++V   A +LH G P T
Sbjct  305  RAMAQIVAQEARRLHRGLPPT  325



>ref|XP_002962752.1| hypothetical protein SELMODRAFT_404020 [Selaginella moellendorffii]
 gb|EFJ36215.1| hypothetical protein SELMODRAFT_404020 [Selaginella moellendorffii]
Length=276

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDY +V + L+ GHLGGLG+DVAW EP+DP + IL    VI+TPHVAGVT+ SY
Sbjct  111  VARGGLLDYKSVRDGLETGHLGGLGLDVAWHEPYDPQDPILQHPKVILTPHVAGVTQLSY  170

Query  462  RYMAKVVGDVALQLHAG  412
              MA+V+ D A++L  G
Sbjct  171  AKMAQVIADCAVELSHG  187



>ref|XP_002962542.1| hypothetical protein SELMODRAFT_404404 [Selaginella moellendorffii]
 gb|EFJ36005.1| hypothetical protein SELMODRAFT_404404 [Selaginella moellendorffii]
Length=293

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDY +V + L+ GHLGGLG+DVAW EP+DP + IL    VI+TPHVAGVT+ SY
Sbjct  111  VARGGLLDYKSVRDGLESGHLGGLGLDVAWHEPYDPQDPILQHPKVILTPHVAGVTQLSY  170

Query  462  RYMAKVVGDVALQLHAG  412
              MA+V+ D A++L  G
Sbjct  171  AKMAQVIADCAVELSHG  187



>ref|XP_001422519.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=332

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL D DAV   LK GHLG L  DVAW+EP DP++ I+  ++   TPH+AGVT SSY
Sbjct  246  IARGGLFDRDAVLKSLKSGHLGYLASDVAWSEPVDPEDPIVRHEHTYFTPHIAGVTHSSY  305

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            R M ++V   A +L     LT I++VN
Sbjct  306  RMMGEIVATSASRLVEFRKLTDIQVVN  332



>ref|XP_003082919.1| oxidoreductase family protein (ISS) [Ostreococcus tauri]
 emb|CAL56874.1| D-isomer specific 2-hydroxyacid dehydrogenase,NAD-binding [Ostreococcus 
tauri]
Length=333

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL + D + + L  GHLG L  DVAW EP DP + ++N      TPHV GVT+SSY
Sbjct  245  IARGGLFNRDDILSALNSGHLGYLASDVAWLEPVDPSDELVNHHRAYFTPHVGGVTQSSY  304

Query  462  RYMAKVVGDVALQLHAG--TPLTGIEIVN  382
            R M +++ +VA+ L+      L  I+IVN
Sbjct  305  RTMGRIIANVAVALNEDDIDSLADIQIVN  333



>ref|XP_005849953.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
 gb|EFN57851.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
Length=330

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLDY+AV   L  G + GLG+DV   EP DP + +    +VI+TPH+AGVTE SY
Sbjct  234  VARGGLLDYEAVRQGLSSGRITGLGLDVQEQEPVDPQHWLAQHPSVILTPHIAGVTEMSY  293

Query  462  RYMAKVVGDVALQLHAG  412
            R MA+VV    L+L  G
Sbjct  294  RSMAEVVAAAVLRLRHG  310



>ref|WP_022842734.1| lactate dehydrogenase [Acidobacteriaceae bacterium TAA166]
Length=316

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGG++D +A+++ L CGHL G G+DV W EP   ++ IL   NVI TPHV GVTE+S+
Sbjct  232  VARGGVIDGEALYSQLSCGHLAGAGLDVFWQEPLPTNDPILTLPNVIATPHVGGVTEASF  291

Query  462  RYMAKVVGDVALQLHAGTP  406
              +A+ V     +L  G P
Sbjct  292  GMIAEAVAVNIERLRCGEP  310



>ref|WP_013570641.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis]
 gb|ADV84911.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis SP1PR4]
Length=316

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+D +A++  L  GHL G G+DV W EP   ++ IL   NVI TPHV GVTE+S+
Sbjct  232  MARGGLIDQEALYAQLASGHLAGAGLDVFWQEPLPTNDPILTLPNVIATPHVGGVTEASF  291

Query  462  RYMAKVVGDVALQLHAG-TPL  403
              +AK V +   +L  G +PL
Sbjct  292  EEIAKAVAENIERLRRGESPL  312



>ref|WP_016987590.1| hypothetical protein, partial [Pseudomonas fluorescens]
Length=129

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL++  A+   L  GHLGG GIDV W EP D  + +L   NV+ TPH+AG+T  S 
Sbjct  40   VARGGLVEEAALIGALHSGHLGGAGIDVYWREPIDTQHPLLQMSNVVATPHIAGITLDSL  99

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
              +A  V     +L AG PL G+
Sbjct  100  TDIAAGVAANINRLRAGLPLVGL  122



>ref|WP_020711063.1| hypothetical protein [Acidobacteriaceae bacterium KBS 83]
Length=316

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGG+++ +A++  L  GHL G G+DV W EP   D+ IL   NVI TPHV GVTESS+
Sbjct  232  VARGGVVNGEALYAQLHSGHLAGAGLDVFWQEPLPTDDPILTLPNVIATPHVGGVTESSF  291

Query  462  RYMAKVVGD  436
              +A+VV +
Sbjct  292  GMIAEVVAE  300



>ref|XP_003063700.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52073.1| predicted protein [Micromonas pusilla CCMP1545]
Length=390

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL D DAV   L+ GHLG L  DVAW+EP D ++A++       TPHV G+T  +Y
Sbjct  266  VARGGLFDRDAVLAALETGHLGFLASDVAWSEPVDTNDAVVRHPRSYFTPHVGGITGFAY  325

Query  462  RYMAKVVGDVALQLHAGT-PLTGIEIVN  382
              M  VV + A ++  G  P   +E++N
Sbjct  326  GIMGGVVAEEARRVRRGELPSDRVEVIN  353



>ref|WP_018205413.1| MULTISPECIES: hypothetical protein [unclassified Atribacteria]
Length=113

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG +++ +A+   L  GHL G  +DV W EP +P + ILN+ NV+ TPH+AGVT+ SY+
Sbjct  20   ARGPIINKNALMKALDSGHLRGAALDVYWEEPPEPKDPILNYSNVLATPHIAGVTDVSYQ  79

Query  459  YMAKVVGDVALQLHAGT  409
             +A  V +   ++ +G 
Sbjct  80   GIAAKVAENIRRVMSGK  96



>ref|WP_022726624.1| lactate dehydrogenase [Fodinicurvata sediminis]
Length=326

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -1

Query  636  RGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYRY  457
            RGGLLD+DA+   L  G LGG G+DV   EP  PD+ +L   +++ TPHVAGVT+ SY  
Sbjct  241  RGGLLDHDALLRELDTGRLGGAGLDVYEQEPLSPDSPLLGRSDILATPHVAGVTDLSYEG  300

Query  456  MAKVVGDVALQLHAGTPL  403
            +++ V +   +L AG  L
Sbjct  301  ISRNVAENIRRLLAGEAL  318



>ref|WP_015878860.1| lactate dehydrogenase [Tolumonas auensis]
 gb|ACQ93389.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Tolumonas 
auensis DSM 9187]
Length=315

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RGGL+D DA+   LK GHL G G+DV W EP DP + I   QN+I TPH+ GVT+ S 
Sbjct  232  LGRGGLIDKDALETALKSGHLAGAGLDVFWQEPPDPTDPIFQ-QNIIATPHIGGVTDISV  290

Query  462  RYMAKVVGDVALQLHAGTPL  403
            + + +   D   +L  G P+
Sbjct  291  QGIFEAACDNIRRLQTGEPI  310



>gb|KDD72690.1| hypothetical protein H632_c3019p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=330

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RGGLLD  A+   L+   +GGLG+DV W EP + ++ +      I+TPHVAGVT+ SY
Sbjct  242  VSRGGLLDRLAIAEGLESSQIGGLGLDVFWEEPLNVEDPVAAHPRTILTPHVAGVTDHSY  301

Query  462  RYMAKVVGDVALQLHAG-TPLTGI  394
              MA  V D  L+  +G  PL  +
Sbjct  302  TTMAAYVADQVLRCRSGLEPLRTV  325



>ref|WP_020880970.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
 gb|EPR41690.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
Length=322

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLD DA+ + L+ G + G G+DV W EP DP++ +   +NVI TPHVAGVT++SY
Sbjct  229  VARGGLLDQDALLDALREGRVAGAGLDVFWQEPVDPNHPLFA-ENVIATPHVAGVTDASY  287



>ref|WP_043338986.1| hypothetical protein [Belnapia moabensis]
Length=324

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D  A+   L  GHL   G+DV W EP   DN +L   NVI+TPH A  TE S R
Sbjct  232  ARGTLVDEKALAGALTSGHLAAAGLDVFWDEPATADNPLLKLPNVIVTPHTAAATEQSLR  291

Query  459  YMAKVVGDVALQLHAG  412
             MA    +  LQ+  G
Sbjct  292  RMALSCAESILQVFDG  307



>ref|WP_037135542.1| 2-hydroxyacid dehydrogenase [Rhizobium sp. CF394]
Length=313

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IAR GL+D  AV N L  GHL G+G+DV W EP   D+  L   NV++TPH+AG+T+ S 
Sbjct  229  IARAGLIDRTAVENCLGDGHLSGVGLDVFWKEPAGIDDPFLQNPNVMVTPHIAGITDISL  288

Query  462  RYMAKVVGDVALQLHAGTPL  403
              +A+ V +   +   G PL
Sbjct  289  GDIARAVAENIRRFSVGLPL  308



>ref|WP_043358506.1| hypothetical protein [Belnapia sp. F-4-1]
Length=324

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D  A+   L  GH+   G+DV W EP   DN +L   NVI+TPH A  TE S R
Sbjct  232  ARGTLVDEKALAGALTSGHIAAAGLDVFWEEPATADNPLLKLPNVIVTPHTAAATEQSLR  291

Query  459  YMAKVVGDVALQLHAG  412
             MA    +  LQ+  G
Sbjct  292  RMALSCAESILQVFDG  307



>ref|WP_012107589.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei]
 ref|YP_001405177.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei 6A8]
 gb|ABS56534.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Methanoregula 
boonei 6A8]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGLLD  A+   LK G + G G+DV W EP DP++ I   +NVI TPH  GVT+ SY
Sbjct  232  VARGGLLDEHALLTALKSGQVAGAGLDVFWEEPVDPNHPIFK-ENVIATPHTGGVTDVSY  290

Query  462  RYMAKVVGDVALQLHAG  412
              +++   +   +  AG
Sbjct  291  EGISRAFAENVKRYAAG  307



>ref|WP_033397128.1| lactate dehydrogenase [Desulfobacter curvatus]
Length=314

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RGG+++ DA+ + L  G + G G+DV W EP DPD++I  + NVI TPH+AG T+ S 
Sbjct  232  LSRGGVINKDALESSLAEGRIAGAGLDVFWEEPPDPDDSIFRY-NVISTPHIAGSTDVSM  290

Query  462  RYMAKVVGDVALQLHAG-TPL  403
            + + KVV +   +L    TPL
Sbjct  291  KGIVKVVSENIRRLEKNQTPL  311



>ref|WP_018335712.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=317

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D +A+   L  G L G G+DV W EP DP + +L+  NV++TPHV G+TE SY
Sbjct  234  VARGPVVDREALLAALAGGRLAGAGLDVTWVEPIDPHDELLD-HNVLVTPHVGGITEQSY  292

Query  462  RYMAK  448
              MA+
Sbjct  293  AGMAR  297



>ref|WP_012875992.1| hydroxyacid dehydrogenase [Thermobaculum terrenum]
 gb|ACZ42961.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermobaculum terrenum ATCC BAA-798]
Length=314

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            +RGG++D DA+   L+ G + G  +DV   EP  PD+ +L   NV++TPH+A  TE S R
Sbjct  232  SRGGVVDQDALAKALREGWIAGAALDVFEAEPLPPDSPLLELPNVLVTPHMASHTEESLR  291

Query  459  YMAKVVGDVALQLHAGTP  406
             M++VV DV   L    P
Sbjct  292  RMSEVVDDVLAVLEGRQP  309



>ref|WP_014806274.1| glyoxylate reductase [Anaerobaculum mobile]
 gb|AFM21035.1| lactate dehydrogenase-like oxidoreductase [Anaerobaculum mobile 
DSM 13181]
Length=322

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +AR  ++  +A+ + L+ GH+ G G+DV W EP DPD+ ILN  NV ITPH+ G  + + 
Sbjct  230  VARANIVQREALESALREGHIAGCGLDVLWKEPPDPDDPILNMPNVYITPHIGGTNDEAL  289

Query  462  RYMAKVVGDVALQLHAGT-PLTGIEIVN  382
            R +   + D   ++  G  PL+ I + +
Sbjct  290  RGIPAFIADNVNRISEGKLPLSCINVTS  317



>ref|WP_043280329.1| hypothetical protein, partial [Pseudonocardia sp. P2]
Length=322

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            +RGG +D  A+   L  G LGG  +DV   EP  P +++LN  +VIITPH+AG TE S R
Sbjct  239  SRGGTIDEQALLQALATGRLGGAALDVTEVEPLPPGHSLLNRPDVIITPHIAGQTEESLR  298

Query  459  YMAKVVGDVALQLHAGTP  406
             +A    D  L    G P
Sbjct  299  RVALDAADDVLAALTGRP  316



>ref|WP_028227829.1| hypothetical protein [Burkholderia ferrariae]
Length=341

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG++D +A+   L  GHL G  IDV   EP  PDN +L   NVI +PH+AGVT  +  
Sbjct  247  ARGGIVDENALAEKLSNGHLAGAAIDVFLPEPPVPDNPLLEMSNVICSPHLAGVTREAVE  306

Query  459  YMAKVVGDVALQLHAGTP  406
             MA++    AL +  G P
Sbjct  307  RMAQLAVVNALSVFDGEP  324



>ref|WP_037064716.1| hypothetical protein [Pseudonocardia acaciae]
Length=284

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 12/97 (12%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGG++D  A+   L+ GHLGG G+DV  TEP  PD+ +L   NV+ TPH A  T  + 
Sbjct  199  VARGGVVDESALAGALRSGHLGGAGLDVWETEPVPPDHPLLRLPNVVATPHSAAQTRDTV  258

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN**NPPFHHLC  352
            R + +              L  ++ V+   PP H L 
Sbjct  259  RRVFRAA------------LANVQRVSRGEPPLHRLA  283



>ref|WP_036553081.1| hypothetical protein [Nisaea denitrificans]
Length=322

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG++D +A+++ L  G + G GIDV  +EP  P++ +    N+I++PH AGVTE S  
Sbjct  234  ARGGMVDEEALYDALTSGAIAGAGIDVFASEPPKPEHPLFQLDNIIVSPHSAGVTEQSIL  293

Query  459  YMAKVVGDVALQLHAGTP  406
             MA    +  L +  G P
Sbjct  294  RMASQTAENVLNVLDGKP  311



>ref|WP_035064188.1| 2-hydroxyacid dehydrogenase [Desulfovibrio termitidis]
Length=322

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG LLD  AV   L   HLGGLG+DV   EP  PDN +L  +N +ITPH+A  T ++ +
Sbjct  236  ARGPLLDEAAVAAALNDNHLGGLGVDVVAVEPIRPDNPLLTAKNCLITPHLAWATLTARQ  295

Query  459  YMAKVVGDVALQLHAGTP  406
             + +V  D      AG P
Sbjct  296  TLMRVTADNIRAFLAGAP  313



>emb|CCK81372.1| NAD-binding protein [Desulfobacula toluolica Tol2]
Length=95

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RGGL+DY A+ + LK   + G G+DV W EP DP++ +  + NV+ TPH+ G T+ S 
Sbjct  10   VSRGGLVDYKALKSALKSKVIAGAGLDVFWEEPPDPEDDMFQY-NVMATPHIGGATDVSM  68

Query  462  RYMAKVV  442
            + +AK+V
Sbjct  69   QGIAKLV  75



>ref|WP_008715411.1| putative oxidoreductase [Rhodococcus sp. AW25M09]
 emb|CCQ16000.1| putative oxidoreductase [Rhodococcus sp. AW25M09]
Length=318

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RG LLD DA+  HL  GH+ G  +DV  TEP   D+ +   +NV++TPH++G      
Sbjct  227  VGRGELLDADALLTHLGSGHIAGAALDVFETEPLSADHPLWTAENVVVTPHMSGDAAGWK  286

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            R +A+V  D A +   G PL  +
Sbjct  287  RRLAEVFADNAHRYFRGEPLLNV  309



>ref|XP_002505587.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66845.1| predicted protein [Micromonas sp. RCC299]
Length=388

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARGGL + + V   L  G LG L  DVAW EP DP + ++  +    TPHV GVT++SY
Sbjct  261  IARGGLFNREHVLAALDDGRLGYLASDVAWQEPVDPSDPLVAHERAYFTPHVGGVTDTSY  320

Query  462  RYMAKVVGDVALQLHA  415
              M  +V      L A
Sbjct  321  ATMGAIVAKACASLQA  336



>ref|WP_035265554.1| lactate dehydrogenase [Desulfosarcina sp. BuS5]
Length=320

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RGGL+D  A+   L  G +GG G+DV W EP DPD+ I NF NV+ TPH++G T+ S 
Sbjct  232  LSRGGLVDRGALEEALASGKIGGAGLDVFWEEPPDPDDPIFNF-NVLATPHISGSTDVSM  290

Query  462  RYMAKVVGDVALQLHAG  412
            + + K V +   ++  G
Sbjct  291  QGIVKGVAENIRRIAKG  307



>ref|WP_007521382.1| glycerate dehydrogenase [Desulfovibrio sp. A2]
 gb|EGY27495.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 
protein [Desulfovibrio sp. A2]
Length=322

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG LLD  AV + L   HLGGLG+DV   EP  PDN +L  +N +ITPH+A  T ++ +
Sbjct  236  ARGPLLDEAAVASALNDNHLGGLGVDVVAVEPIRPDNPLLTAKNCLITPHLAWATLTARQ  295

Query  459  YMAKVVGDVALQLHAGTP  406
             + +V  +      AG P
Sbjct  296  TLMRVTAENIRAFLAGAP  313



>ref|WP_006328672.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Mesorhizobium 
sp. STM 4661]
 emb|CCV11436.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Mesorhizobium 
sp. STM 4661]
Length=326

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RG ++D DA+   LK G +GG  +DV  T+P  P++   +F NVI+TPH+AG+TE S 
Sbjct  227  VSRGPVIDDDALIEALKKGRIGGAALDVFATQPLPPNHPYFSFDNVIVTPHMAGITEQSM  286

Query  462  RYMAKVVGDVAL  427
              M     D AL
Sbjct  287  MRMGVGAADEAL  298



>ref|WP_012547855.1| lactate dehydrogenase [Dictyoglomus thermophilum]
 gb|ACI19223.1| glyoxylate reductase [Dictyoglomus thermophilum H-6-12]
Length=336

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   +K G + G+G+DV   EP DP N +L+ +NV++TPH+A  T    +
Sbjct  240  ARGELMDEEALIRAIKSGKVAGVGLDVMKDEPPDPQNPLLHMENVVVTPHIAAYTYECLK  299

Query  459  YMA-KVVGDVALQLHAGTPLTGIEIVN  382
             M  KVV DV   ++   P    EI+N
Sbjct  300  GMGDKVVADVERVVNQEIPE---EIIN  323



>ref|WP_013019292.1| 2-hydroxyacid dehydrogenase [Stackebrandtia nassauensis]
 gb|ADD43721.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Stackebrandtia nassauensis DSM 44728]
Length=347

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG+LDY+A+ + L  GHLGG G+DV  TEP   D  +    NV++TPH+AG +    +
Sbjct  257  ARGGVLDYEALCDSLDAGHLGGAGLDVHPTEPLPADARLRRTPNVVLTPHIAGCSREVAK  316

Query  459  YMAKVVGDVALQLHAGTPL  403
              A +      +   G PL
Sbjct  317  LAATICAAEVGRWRRGEPL  335



>ref|WP_043718890.1| hypothetical protein [Kutzneria sp. 744]
 gb|EWM13770.1| phosphoglycerate dehydrogenase [Kutzneria sp. 744]
Length=106

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+D  A+   L  GH+ G G+DV   EP DP N ++N   VI TPHV GVT+   
Sbjct  10   VARGGLVDEAALVAALDSGHIAGAGLDVLAVEPADPGNPLVNHPKVIATPHVGGVTQQVL  69

Query  462  RYMAKVVGDVALQLHAGTPL  403
                  + D   +  AG PL
Sbjct  70   YNSMIALTDNIKRYAAGEPL  89



>ref|WP_020697799.1| hypothetical protein [Reyranella massiliensis]
Length=327

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG+++ DA++  L  G L G G+DV   EP DP N + + +NVI +PH+AGVT+ +  
Sbjct  238  ARGGIVNEDALYAALSTGKLRGAGLDVLDKEPPDPANKLFSLENVIFSPHMAGVTKEASD  297

Query  459  YMAKVVGDVALQLHAGTPLTG  397
             MA    +  L +  G P T 
Sbjct  298  RMAVTAVENILSVFDGRPNTA  318



>ref|WP_008413665.1| D-2-hydroxyacid dehydrogenase [Halalkalicoccus jeotgali]
 ref|YP_003738919.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Halalkalicoccus jeotgali B3]
 gb|ADJ17128.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Halalkalicoccus jeotgali B3]
 gb|ELY41717.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Halalkalicoccus jeotgali B3]
Length=311

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D DA+ + L+ G +GG  +DV   EP   D+ + +F+ V+ITPH AG TE  Y
Sbjct  227  VARGPVVDQDALVDALEAGIIGGAALDVFEAEPLPKDSPLWDFEEVLITPHCAGFTEDYY  286

Query  462  RYMAKVVGDVALQLHAGTPL  403
            R +A +V +  + + AG  L
Sbjct  287  RNVADLVRENLVHIDAGEEL  306



>gb|AHC51448.1| 2-hydroxyacid dehydrogenase [Sulfolobus acidocaldarius SUSAZ]
Length=311

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESSY  463
            +RGG++D +A+   LK   + G G+DV   EP +P+N + +  NVIITPHVAGVT E++ 
Sbjct  227  SRGGIIDEEALLKALKEKRIAGAGLDVLALEPPNPNNPLFSLDNVIITPHVAGVTHEAAE  286

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            R     +  V L L  G PLT +
Sbjct  287  RGFIGALTQV-LNLLQGKPLTNV  308



>ref|WP_039671565.1| hypothetical protein [Sulfolobus acidocaldarius]
Length=321

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESSY  463
            +RGG++D +A+   LK   + G G+DV   EP +P+N + +  NVIITPHVAGVT E++ 
Sbjct  237  SRGGIIDEEALLKALKEKRIAGAGLDVLALEPPNPNNPLFSLDNVIITPHVAGVTHEAAE  296

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            R     +  V L L  G PLT +
Sbjct  297  RGFIGALTQV-LNLLQGKPLTNV  318



>ref|WP_018114836.1| hypothetical protein [Rhizobium sp. JGI 0001005-K05]
Length=313

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IAR GL+D   +   +  G LGG+G+DV WTEP D  + +L   NVI+TPHVAG+T+ S 
Sbjct  229  IARAGLIDRKGLEACIADGQLGGVGLDVFWTEPADALDPLLAHPNVIMTPHVAGITDRSL  288

Query  462  RYMAKVVGDVALQLHAGTPL  403
              +A+ V +   +     PL
Sbjct  289  ADIARAVAENIERFAVMRPL  308



>ref|WP_041319387.1| 2-hydroxyacid dehydrogenase [Mycobacterium sp. JDM601]
Length=316

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESSY  463
            ARG ++D  A+   L  G LGG G+DV   EP  PDN +L   NV++TPHV+  T ++  
Sbjct  228  ARGTVVDETALTEALASGRLGGAGLDVFAVEPVSPDNPLLGLDNVVLTPHVSWYTADTMQ  287

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            RY++  V D   +L  G PLT  E+VN
Sbjct  288  RYLSAAV-DNCRRLRDGQPLT--EVVN  311



>ref|WP_008874215.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Mesorhizobium 
metallidurans]
 emb|CCV05262.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Mesorhizobium 
metallidurans STM 2683]
Length=326

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RG ++D DA+   LK G +GG  +DV  T+P  P++   +F NVI+TPH+AG+TE S 
Sbjct  227  ISRGPVIDDDALIEALKKGRIGGAALDVFATQPLPPNHPYFSFDNVIVTPHMAGITEQSM  286

Query  462  RYM  454
              M
Sbjct  287  MRM  289



>ref|WP_013298877.1| lactate dehydrogenase [Thermoanaerobacterium thermosaccharolyticum]
 gb|ADL69920.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Thermoanaerobacterium 
thermosaccharolyticum DSM 571]
Length=324

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D  A+   LK G +GG+G+DV   EP D +N +L+F NV ITPH++  T    +
Sbjct  241  ARGELIDQKALVKALKDGIVGGIGMDVVENEPIDEENELLSFDNVTITPHISAYTYECLK  300

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV D+   L    P
Sbjct  301  GMGDKVVEDIERVLKGELP  319



>gb|AEF34261.1| D-3-phosphoglycerate dehydrogenase SerA3 [Mycobacterium sp. JDM601]
Length=318

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESSY  463
            ARG ++D  A+   L  G LGG G+DV   EP  PDN +L   NV++TPHV+  T ++  
Sbjct  230  ARGTVVDETALTEALASGRLGGAGLDVFAVEPVSPDNPLLGLDNVVLTPHVSWYTADTMQ  289

Query  462  RYMAKVVGDVALQLHAGTPLTGIEIVN  382
            RY++  V D   +L  G PLT  E+VN
Sbjct  290  RYLSAAV-DNCRRLRDGQPLT--EVVN  313



>ref|WP_012582609.1| lactate dehydrogenase [Dictyoglomus turgidum]
 ref|YP_002352138.1| D-isomer specific 2-hydroxyacid dehydrogenase [Dictyoglomus turgidum 
DSM 6724]
 gb|ACK41524.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Dictyoglomus 
turgidum DSM 6724]
Length=336

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   +K G + G+G+DV   EP DP N +L+ +NV++TPH+A  T    +
Sbjct  240  ARGELMDEEALIRAIKSGKVAGVGLDVMKDEPPDPQNPLLHMENVVVTPHIAAYTYECLK  299

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV D+   ++   P
Sbjct  300  GMGDKVVSDIEKVVNKEIP  318



>ref|WP_028096745.1| oxidoreductase [Dongia sp. URHE0060]
Length=347

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG +++YD ++  LK  HL G  ++  W EP   D A+L   NV +TPH+AG ++++ R
Sbjct  265  ARGPMVNYDDLYQALKSRHLRGAMLETFWLEPVPKDAALLQLDNVTLTPHIAGASKTTVR  324

Query  459  YMAKVVGDVALQLHAGTP  406
              AK++ +   +   G P
Sbjct  325  IAAKMIAEEIRRYAVGEP  342



>ref|WP_009070777.1| phosphoglycerate dehydrogenase-like oxidoreductase [Metallosphaera 
yellowstonensis]
 gb|EHP70230.1| phosphoglycerate dehydrogenase-like oxidoreductase [Metallosphaera 
yellowstonensis MK1]
Length=329

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            +RG ++D  A+ + L+ G L G G+DV   EP  PDN +L  +NVIITPH+ G T  ++ 
Sbjct  245  SRGEIVDEGALVDALRSGKLMGAGLDVLNVEPPSPDNPLLQMENVIITPHIGGTTIEAFE  304

Query  459  YMAKVVGDVALQLHAGTPLTGI  394
              A+      ++L  G PL  I
Sbjct  305  RGAESAIREVIRLLKGEPLKNI  326



>ref|WP_034897846.1| lactate dehydrogenase [Erwinia typographi]
 gb|KGT88455.1| lactate dehydrogenase [Erwinia typographi]
Length=315

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RGGL++  A+   L+ GHL G G+DV W EP DPD+ +    NVI TPH+ GVT++S 
Sbjct  232  LGRGGLIEKQALLAALEVGHLAGAGLDVFWQEPPDPDDVLFQ-HNVIATPHIGGVTDTSL  290



>ref|WP_032379580.1| 2-hydroxyacid dehydrogenase [Rhodococcus fascians]
Length=311

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RG LLD +A+  HL  GH+ G  +DV  TEP   D+ +   +NVI+TPH++G      
Sbjct  220  VGRGELLDTEALLKHLGSGHITGAALDVFETEPLSADHPLWTAENVILTPHMSGDASGWK  279

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            + +A+V  D A +   G PL  +
Sbjct  280  QRLAEVFADNARRYFRGEPLLNV  302



>ref|XP_008329727.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X2 [Cynoglossus semilaevis]
 ref|XP_008329729.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X2 [Cynoglossus semilaevis]
Length=326

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RG ++D DA+   L+ G + G   DV + EP   D+ +LNF N++ITPH+   T S+ 
Sbjct  240  ISRGLVVDQDALVKALQSGIIRGAATDVTYPEPLPRDHPLLNFPNMLITPHIGTNTYSTS  299

Query  462  RYMAKVVGDVALQLHAGTPL  403
            R M +++ D AL +  G PL
Sbjct  300  RRMVQMMVDNALAVIRGEPL  319



>ref|WP_041867685.1| lactate dehydrogenase, partial [Sodalis glossinidius]
Length=160

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RGGL++ +A+   +  G L G G+DV W EP DPD+++   QNVI TP++ GVT+ S 
Sbjct  78   VGRGGLVEKNALEQAIIRGQLAGAGLDVFWQEPPDPDDSLFQ-QNVIATPYIGGVTDISA  136

Query  462  RYMAKVVGDVALQLHAGTPL  403
                + V D   +L  G PL
Sbjct  137  AGNIQPVCDNLRRLQQGAPL  156



>ref|WP_012876402.1| 2-hydroxyacid dehydrogenase [Thermobaculum terrenum]
 gb|ACZ43371.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermobaculum terrenum ATCC BAA-798]
Length=353

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGGLLDY A+   L+ GHL    +DV   EP  PD+ +L    V+++PH+AG T  + +
Sbjct  258  ARGGLLDYSALIEALESGHLWAAALDVFPEEPLPPDSPLLTMPRVVVSPHIAGATRETAK  317

Query  459  YMAKV  445
              A++
Sbjct  318  RAARL  322



>ref|WP_012582463.1| 3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum]
 ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 
6724]
 gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 
6724]
Length=525

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGGL+D DA++  LK   + G  +DV   EP +PDN +L   NV++TPH+   T+ +  
Sbjct  232  ARGGLVDEDALYEILKEKKIAGAALDVFKNEPINPDNPLLTLDNVVLTPHLGASTQEAQE  291

Query  459  YMAKVVGDVALQLHAG  412
             +A +V +  ++   G
Sbjct  292  KVALIVAEEIIRFFKG  307



>ref|WP_015906531.1| lactate dehydrogenase [Desulfobacterium autotrophicum]
 gb|ACN17821.1| SerA2 [Desulfobacterium autotrophicum HRM2]
Length=315

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RG L++ DA+ + L+ G + G+G+DV W EP DP + I N+ NV+ TPH+AG T+ S 
Sbjct  232  LSRGALVNRDALEHALESGAIAGVGLDVFWQEPPDPSDPIFNY-NVMATPHIAGATDISM  290

Query  462  RYMAKVVGDVALQLHAGTPL  403
               A  V +   +L    PL
Sbjct  291  ERTADGVAENIRRLAENRPL  310



>ref|WP_032402399.1| 2-hydroxyacid dehydrogenase [Rhodococcus fascians]
Length=318

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RG LLD +A+  HL  GH+ G  +DV  TEP   D+ +   +NVI+TPH++G      
Sbjct  227  VGRGELLDTEALLKHLGSGHITGAALDVFETEPLSADHPLWTAENVILTPHMSGDASGWK  286

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            + +A+V  D A +   G PL  +
Sbjct  287  QRLAEVFADNARRYFRGEPLLNV  309



>ref|XP_008329726.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X1 [Cynoglossus semilaevis]
Length=363

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I+RG ++D DA+   L+ G + G   DV + EP   D+ +LNF N++ITPH+   T S+ 
Sbjct  277  ISRGLVVDQDALVKALQSGIIRGAATDVTYPEPLPRDHPLLNFPNMLITPHIGTNTYSTS  336

Query  462  RYMAKVVGDVALQLHAGTPL  403
            R M +++ D AL +  G PL
Sbjct  337  RRMVQMMVDNALAVIRGEPL  356



>ref|WP_039235937.1| 2-hydroxyacid dehydrogenase [Bacillus thermotolerans]
Length=316

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY-  463
            +RGG++D +A+   ++ G + G  +DV   EP  PDN +L  +N+ +TPH+AG+TE S  
Sbjct  234  SRGGIIDEEALLEAVQAGEIAGAFLDVLEQEPIAPDNQLLGCENITLTPHIAGLTEESQV  293

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            R    V  +VA  L+ G  L  +
Sbjct  294  RTSLLVAQEVAKSLNGGVSLCTV  316



>ref|WP_007229451.1| glyoxylate reductase [marine gamma proteobacterium HTCC2148]
 gb|EEB78170.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain, 
putative [marine gamma proteobacterium HTCC2148]
Length=323

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG++D +A+   L  GHL   GIDV   EP  PDNA+L+ +NV++ PH+   T  +  
Sbjct  235  ARGGIVDEEALAVALADGHLAAAGIDVFENEPVSPDNALLSLKNVVVAPHIGSATTLTRG  294

Query  459  YMAKVVGDVALQLHAGTPL  403
             MA +  + A+    G P+
Sbjct  295  KMADIAVENAIAALEGRPM  313



>ref|WP_037193108.1| 2-hydroxyacid dehydrogenase [Rhodococcus fascians]
Length=319

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RG LLD +A+  HL  GH+ G  +DV  TEP   D+ +   +NVI+TPH++G      
Sbjct  227  VGRGELLDTEALLAHLATGHIAGAALDVFETEPLSADHPLWTAENVIVTPHMSGDASGWK  286

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            + +A++  D AL+   G PL  +
Sbjct  287  QRLAELFVDNALRHFRGEPLRNV  309



>ref|WP_013139514.1| 2-hydroxyacid dehydrogenase [Segniliparus rotundus]
 gb|ADG99065.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Segniliparus rotundus DSM 44985]
Length=317

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG ++D  A+   L+ GHL   G+DV   EP DP N +L   NV++TPH+  +TE +  
Sbjct  234  ARGSIVDEQALLAALESGHLAAAGLDVFEQEPVDPQNPLLGLSNVVVTPHLTWLTEQTNS  293

Query  459  YMAKVVGDVALQLHAGTPL  403
             M +   +   +L  G P 
Sbjct  294  RMLEAAVENCRRLREGEPF  312



>ref|WP_012611363.1| glycerate dehydrogenase [Desulfovibrio vulgaris]
 gb|ACL07169.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Desulfovibrio 
vulgaris str. 'Miyazaki F']
Length=322

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG LLD  AV   L   HLGGLG+DV   EP  PDN +L  +N +ITPH+A  T ++ +
Sbjct  236  ARGPLLDEAAVAAALNDNHLGGLGVDVVAVEPIRPDNPLLTAKNCLITPHLAWATLTARQ  295

Query  459  YMAKVVGDVALQLHAGTP  406
             + +V         AG P
Sbjct  296  TLMRVTAGNIRAFLAGAP  313



>ref|WP_028818663.1| hypothetical protein, partial [beta proteobacterium SCGC AAA027-C02]
Length=148

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG++D  A+   L+ G +GG  IDV  TEP    N  +  +N+I+TPH+AGVT+ S  
Sbjct  71   ARGGIVDELALAERLRSGRIGGAAIDVFSTEPAKDLNHFVGIENLILTPHIAGVTQESNE  130

Query  459  YMAKVVGD  436
             +++++ D
Sbjct  131  RVSQMIAD  138



>gb|KIA68489.1| D-3-phosphoglycerate dehydrogenase [Bacillus thermotolerans]
 gb|KIG03874.1| D-3-phosphoglycerate dehydrogenase [Bacillaceae bacterium MTCC 
8252]
Length=353

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY-  463
            +RGG++D +A+   ++ G + G  +DV   EP  PDN +L  +N+ +TPH+AG+TE S  
Sbjct  271  SRGGIIDEEALLEAVQAGEIAGAFLDVLEQEPIAPDNQLLGCENITLTPHIAGLTEESQV  330

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            R    V  +VA  L+ G  L  +
Sbjct  331  RTSLLVAQEVAKSLNGGVSLCTV  353



>ref|WP_020960081.1| 2-hydroxyacid dehydrogenase [Geobacillus sp. JF8]
 gb|AGT32277.1| 2-hydroxyacid dehydrogenase [Geobacillus sp. JF8]
Length=333

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG ++D  A+   L+ G + G G+DV   EP  PDN +L  +NV+ITPHVA  +E S R
Sbjct  235  ARGPVIDEPALIRALQDGKIAGAGLDVTECEPIQPDNPLLQMENVVITPHVAWYSEESER  294

Query  459  YMAK  448
             + +
Sbjct  295  ELKR  298



>ref|WP_004900153.1| 2-hydroxyacid dehydrogenase [Leuconostoc citreum]
 emb|CCF24140.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum LBAE C10]
Length=306

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG ++D +A+FN LK G + G G+DV   EP   +NA+L   N  ITPH+A  +  ++
Sbjct  221  IARGAIVDENALFNALKSGEIAGAGLDVVTNEPISDNNALLGLSNTFITPHIAAKSREAF  280



>ref|WP_004905936.1| 2-hydroxyacid dehydrogenase [Leuconostoc citreum]
 gb|ACA82184.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum KM20]
 emb|CCF27268.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum LBAE C11]
 emb|CCF28217.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum LBAE E16]
 emb|CDX64227.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum]
 emb|CDX65948.1| 2-oxo-4-phenylbutanoate reductase [Leuconostoc citreum]
Length=306

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG ++D +A+FN LK G + G G+DV   EP   +NA+L   N  ITPH+A  +  ++
Sbjct  221  IARGAIVDENALFNALKSGEIAGAGLDVVTNEPISDNNALLGLSNTFITPHIAAKSREAF  280



>ref|WP_029008214.1| 2-hydroxyacid dehydrogenase [Azospirillum halopraeferens]
Length=320

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RG ++D  A+   LK G LGG  +DV   +P  P++A+L+  NV++TPH AG+T +S 
Sbjct  230  VSRGPVIDTAALVRALKGGRLGGAALDVYDVQPLPPEDALLDCPNVLLTPHAAGITATSM  289

Query  462  RYMA-KVVGDVALQLHAGTPLTGIEIVN**NPPFHH  358
            R M+    G++   L   TP      VN  NP +  
Sbjct  290  RNMSLGAAGEMLRMLRGDTP------VNLVNPEYRK  319



>ref|WP_041010349.1| dehydrogenase [Mesorhizobium plurifarium]
 emb|CDX20354.1| Phosphoglycerate dehydrogenase [Mesorhizobium plurifarium]
Length=325

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D +A+   L+ G +GG  +DV  T+P  P++    F NVI+TPH+AG+TE S 
Sbjct  227  VARGPVVDDEALIEALQKGRIGGAALDVFSTQPLPPNHPYFGFDNVIVTPHMAGITEESM  286

Query  462  RYMAKVVGDVALQLHAG  412
              M     + AL + AG
Sbjct  287  MRMGVGAANEALLVLAG  303



>ref|WP_012548694.1| 3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum]
 gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum 
H-6-12]
Length=525

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGGL+D DA++  LK   + G  +DV   EP +PDN +L   NV++TPH+   T+ +  
Sbjct  232  ARGGLVDEDALYEVLKEKKIAGAALDVFKNEPINPDNPLLTLDNVVLTPHLGASTQEAQE  291

Query  459  YMAKVVGDVALQLHAG  412
             +A +V +  ++   G
Sbjct  292  KVALIVAEDIIRFFKG  307



>ref|WP_040987398.1| dehydrogenase [Mesorhizobium plurifarium]
 emb|CDX39282.1| Phosphoglycerate dehydrogenase [Mesorhizobium plurifarium]
Length=326

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D +A+   L+ G +GG  +DV  T+P  P++    F NVI+TPH+AG+TE S 
Sbjct  227  VARGPVVDDEALIEALQKGRIGGAALDVFSTQPLPPNHPYFGFDNVIVTPHMAGITEESM  286

Query  462  RYMAKVVGDVALQLHAG  412
              M     + AL + AG
Sbjct  287  MRMGVGAANEALLVLAG  303



>dbj|BAC24143.1| 2-oxo-4-phenylbutanoate reductase [Oenococcus oeni]
Length=306

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG ++D +A+FN LK G + G G+DV   EP   +NA+L   N  ITPH+A  +  ++
Sbjct  221  IARGAIVDENALFNALKSGEIAGAGLDVVTNEPISDNNALLGLSNTFITPHIAAKSREAF  280



>ref|WP_030920347.1| 3-phosphoglycerate dehydrogenase [Streptosporangium amethystogenes]
Length=326

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG ++D  A+ + L+ GHLGG  +DV  TEP  PD+ + N   V+++PHVAGVT  S  
Sbjct  228  ARGQVVDSAALLSALESGHLGGAALDVFDTEPLPPDDPLRNSPRVLLSPHVAGVTPQSTG  287

Query  459  YMAKVVGDVALQLHAGTPLTGI  394
             + + V D       G P+T +
Sbjct  288  RLIRCVLDNLEAAIGGRPVTNV  309



>ref|WP_012826850.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase protein 
[Haliangium ochraceum]
 ref|YP_003266135.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase protein 
[Haliangium ochraceum DSM 14365]
 gb|ACY14242.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Haliangium ochraceum DSM 14365]
Length=303

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG+++  AV   L  GHLGG  +D  W EP++P++ +    +V+  PH+AG T  S+ 
Sbjct  220  ARGGVVERAAVTAALDSGHLGGFALDTPWEEPWNPEDPLYARPDVVALPHIAGSTRESFA  279

Query  459  YMAKVVGDVALQLHAGTPL  403
             +A +V +   +L  G  L
Sbjct  280  RIADIVVENIARLRRGEEL  298



>ref|WP_029061147.1| oxidoreductase [Labrenzia sp. DG1229]
Length=345

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+DYDA+F  L   HLGG  ++    EP +P++ +L   NV +TPH+AG +  + +
Sbjct  263  ARGPLMDYDALFEALSSEHLGGAMLETFAVEPTNPEDPLLQLPNVTLTPHIAGASRKTVK  322

Query  459  YMAKVVGD  436
              A+ + +
Sbjct  323  IAAQKIAE  330



>ref|WP_035844464.1| hypothetical protein [Defluviimonas sp. 20V17]
 gb|KDB02822.1| hypothetical protein U879_15260 [Defluviimonas sp. 20V17]
Length=303

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGGL+D DA+    + GHLGG+ +DV  TEP   D+ +L+  N I+TPH A +++ ++R
Sbjct  219  ARGGLIDEDALA---RAGHLGGVALDVTETEPLPRDSPLLDLPNCILTPHSAALSDGAFR  275

Query  459  YM  454
             M
Sbjct  276  QM  277



>ref|WP_013200656.1| lactate dehydrogenase [Erwinia billingiae]
 emb|CAX58151.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Erwinia 
billingiae Eb661]
Length=315

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESS  466
            + RGGL++  A+   L+  HL G G+DV W EP +PD+A+  + NVI TPH+ GVT++S
Sbjct  232  LGRGGLIEKQALLAALEVNHLAGAGLDVFWQEPPEPDDALFQY-NVIATPHIGGVTDNS  289



>ref|WP_040645653.1| hypothetical protein [Rubellimicrobium thermophilum]
Length=292

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D  A+   L  G LG  G+DV  +EP DPD  +    NV++TPH A  TE + 
Sbjct  210  VARGSVVDEKALIAALSQGRLGAAGLDVFASEP-DPDPRLTALPNVVLTPHSASATEETR  268

Query  462  RYMAKVVGDVALQLHAGTPLTG  397
              MA++V D      AG P+ G
Sbjct  269  AAMARMVLDNLAAFFAGRPMPG  290



>ref|WP_041006516.1| dehydrogenase [Mesorhizobium plurifarium]
 emb|CDX57221.1| Phosphoglycerate dehydrogenase [Mesorhizobium plurifarium]
Length=325

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D +A+   L+ G +GG  +DV  T+P  P++    F NVI+TPH+AG+TE S 
Sbjct  227  VARGPVVDDEALIEALQKGSIGGAALDVFSTQPLPPNHPYFGFDNVIVTPHMAGITEESM  286

Query  462  RYMAKVVGDVALQLHAG  412
              M     + AL + AG
Sbjct  287  MRMGVGAANEALLVLAG  303



>ref|WP_007471586.1| 2-hydroxyacid dehydrogenase [Segniliparus rugosus]
 gb|EFV12240.1| hypothetical protein HMPREF9336_02932 [Segniliparus rugosus ATCC 
BAA-974]
Length=317

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG ++D  A+   L+ G L   G+DV   EP DP N +L  +NV++TPH+  +TE +  
Sbjct  234  ARGSIVDEAALLAALESGQLAAAGLDVFEQEPVDPQNPLLRLRNVVVTPHLTWLTEQTNE  293

Query  459  YMAKVVGDVALQLHAGTPL  403
             M  +  +   +L  G PL
Sbjct  294  RMLDIAIENCRRLRDGEPL  312



>ref|WP_015312451.1| lactate dehydrogenase-like oxidoreductase [Thermoanaerobacterium 
thermosaccharolyticum]
 gb|AGB20008.1| lactate dehydrogenase-like oxidoreductase [Thermoanaerobacterium 
thermosaccharolyticum M0795]
Length=325

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D DA+   L  G + G+G+DV   EP D ++ +L ++NVIITPH++  T    +
Sbjct  242  ARGELIDQDALMKALDDGIVAGVGMDVVENEPIDENHPLLAYENVIITPHISAYTRECLK  301

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L+   P
Sbjct  302  GMGDKVVSDVEKVLNGEVP  320



>ref|WP_022703054.1| 2-hydroxyacid dehydrogenase [Pseudorhodobacter ferrugineus]
Length=305

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGGL+D  A+   L  GHLGG G+DV+  EP   D  +     VI+TPH A +++ ++R
Sbjct  218  ARGGLIDEAALIAALNSGHLGGAGLDVSQVEPLPLDAPLRAAPRVILTPHAATLSDGAFR  277

Query  459  YMAKVVGDVALQLHAGTP  406
             M  +     L   AG P
Sbjct  278  RMGMMAAQNILDFFAGKP  295



>ref|WP_004073201.1| lactate dehydrogenase [Desulfobacter postgatei]
 gb|EIM63848.1| lactate dehydrogenase-like oxidoreductase [Desulfobacter postgatei 
2ac9]
Length=314

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RGG+++ +A+ N L  G + G G+DV W EP DPD+ I  + NV+ TPH+ G T+ S 
Sbjct  232  LSRGGVINKEALENSLATGKIAGAGLDVFWEEPPDPDDGIFKY-NVMSTPHIGGSTDVSM  290

Query  462  RYMAKVVGDVALQLH  418
              + KVV     +L 
Sbjct  291  NGIVKVVSQNIRRLE  305



>gb|EPX84695.1| Lactate dehydrogenase [Rubellimicrobium thermophilum DSM 16684]
Length=302

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARG ++D  A+   L  G LG  G+DV  +EP DPD  +    NV++TPH A  TE + 
Sbjct  220  VARGSVVDEKALIAALSQGRLGAAGLDVFASEP-DPDPRLTALPNVVLTPHSASATEETR  278

Query  462  RYMAKVVGDVALQLHAGTPLTG  397
              MA++V D      AG P+ G
Sbjct  279  AAMARMVLDNLAAFFAGRPMPG  300



>ref|WP_004404791.1| MULTISPECIES: D-isomer specific 2-hydroxyacid dehydrogenase, 
NAD-binding [Thermoanaerobacter]
 gb|EMT38064.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=335

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   LK G + G G+DV   EP D ++ +L F NVIITPH +  T    R
Sbjct  241  ARGELIDTEALIKALKEGKVAGAGLDVVEGEPIDENHPLLAFDNVIITPHTSAYTYECLR  300

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L    P
Sbjct  301  GMGDKVVSDVEKVLRGEIP  319



>ref|WP_013298812.1| lactate dehydrogenase [Thermoanaerobacterium thermosaccharolyticum]
 gb|ADL69855.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Thermoanaerobacterium 
thermosaccharolyticum DSM 571]
Length=325

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D DA+   L  G + G+G+DV   EP D ++ +L ++NVIITPH++  T    +
Sbjct  242  ARGELIDQDALIKALDDGIVAGVGMDVVENEPIDENHPLLAYENVIITPHISAYTRECLK  301

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L+   P
Sbjct  302  GMGDKVVSDVEKVLNGEVP  320



>ref|WP_013266039.1| glyoxylate reductase [Acidilobus saccharovorans]
 ref|YP_003815558.1| Glyoxylate reductase [Acidilobus saccharovorans 345-15]
 gb|ADL18527.1| Glyoxylate reductase [Acidilobus saccharovorans 345-15]
Length=335

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG ++D DA++  LK G + G G+DV  TEP DP + I    NV++TPH+   T  +  
Sbjct  241  ARGKVVDIDALYRALKEGWIAGAGLDVYPTEPLDPSHPITKLSNVVLTPHIGSATRETRA  300

Query  459  YMAKVV  442
             MA++V
Sbjct  301  KMAELV  306



>ref|WP_013145109.1| 2-hydroxyacid dehydrogenase [Geobacillus sp. C56-T3]
 gb|ADI26566.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Geobacillus sp. C56-T3]
Length=334

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESS--  466
            ARG ++D  A+   L+ G + G G+DV   EP  PDN +L  +NV+ITPHVA  +E S  
Sbjct  235  ARGPVIDESALIRALQEGKISGAGLDVTECEPIQPDNPLLKMENVVITPHVAWYSEESEK  294

Query  465  --YRYMAKVVGDV  433
               R  A+ V DV
Sbjct  295  ELKRKTAQNVADV  307



>ref|WP_035710713.1| D-3-phosphoglycerate dehydrogenase [Bacillus aidingensis]
Length=514

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG+++ D +++HL+ GH+GG  +DV   EP   +N +++F  VI TPH+A  T+ +  
Sbjct  218  ARGGIIEEDGLYHHLESGHVGGAALDVFEEEPAQ-NNKLVSFDQVITTPHIAASTKEAQM  276

Query  459  YMAKVVGDVALQLHAGTP  406
             +A  V +  LQ   G P
Sbjct  277  NVAAQVSEEVLQFLNGMP  294



>ref|WP_011231440.1| 2-hydroxyacid dehydrogenase [Geobacillus kaustophilus]
 dbj|BAD76239.1| dehydrogenase [Geobacillus kaustophilus HTA426]
Length=334

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESS--  466
            ARG ++D  A+   L+ G + G G+DV   EP  PDN +L  +NV+ITPHVA  +E S  
Sbjct  235  ARGPVIDESALIRALQEGKISGAGLDVTECEPIQPDNPLLKMENVVITPHVAWYSEESEK  294

Query  465  --YRYMAKVVGDV  433
               R  A+ V DV
Sbjct  295  ELKRKTAQNVADV  307



>ref|WP_025420783.1| lactate dehydrogenase [Sodalis sp. HS1]
 gb|AHF75653.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding, inverted 
[Sodalis sp. HS1]
Length=314

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RGGL++  A+   L  G L G G+DV W EP DP +++   QNVI TPH+ GVT+ S 
Sbjct  232  VGRGGLVEKHALEQALISGQLAGAGLDVFWQEPPDPADSLFQ-QNVIATPHIGGVTDISA  290

Query  462  RYMAKVVGDVALQLHAGTPL  403
                + V D   +L  G PL
Sbjct  291  AGNIQAVCDNLRRLQQGEPL  310



>ref|WP_003866626.1| MULTISPECIES: lactate dehydrogenase [Thermoanaerobacter]
 gb|EEU63522.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Thermoanaerobacter 
ethanolicus CCSD1]
 gb|EGD52641.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Thermoanaerobacter 
ethanolicus JW 200]
 gb|EIV99568.1| lactate dehydrogenase-like oxidoreductase [Thermoanaerobacter 
siderophilus SR4]
Length=335

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   LK G + G G+DV   EP D ++ +L F NVIITPH +  T    R
Sbjct  241  ARGELIDTEALIKALKEGKVAGAGLDVVEGEPIDENHPLLAFDNVIITPHTSAYTYECLR  300

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L    P
Sbjct  301  GMGDKVVSDVEKVLRGEIP  319



>ref|WP_036307029.1| 2-hydroxyacid dehydrogenase [Methylopila sp. 73B]
Length=317

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +AR  ++D  A+   L+ G +GG  +DV   +P  PD AIL   NV+ TPHVAGVT +S 
Sbjct  224  VARAAVVDTAALVAALQEGRIGGAAVDVHDVQPLAPDAAILGAPNVLATPHVAGVTATSL  283

Query  462  RYMAKVVGDVALQLHAG  412
            R M+    +  L++ AG
Sbjct  284  RAMSMGAAEEMLRILAG  300



>ref|WP_029689388.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacter sp. A7A]
Length=335

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   LK G + G G+DV   EP D ++ +L F NVIITPH +  T    R
Sbjct  241  ARGELIDTEALIKALKEGKVAGAGLDVVEGEPIDENHPLLAFDNVIITPHTSAYTYECLR  300

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L    P
Sbjct  301  GMGDKVVSDVEKVLRGEIP  319



>ref|WP_014063254.1| lactate dehydrogenase [Thermoanaerobacter wiegelii]
 gb|AEM79296.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase [Thermoanaerobacter 
wiegelii Rt8.B1]
Length=335

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   LK G + G G+DV   EP D ++ +L F NVIITPH +  T    R
Sbjct  241  ARGELMDTEALIKALKEGKVAGAGLDVVEGEPIDDNHPLLAFDNVIITPHTSAYTYECLR  300

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV DV   L    P
Sbjct  301  GMGDKVVSDVEKVLRGEIP  319



>ref|WP_031194935.1| dehydrogenase [Mesorhizobium sp. LSHC420B00]
Length=326

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RG ++D DA+   L+ G +GG  +DV  T+P  P++    F NVI+TPH+AG+TE S 
Sbjct  227  VSRGPVIDDDALIEALQKGRIGGAALDVFATQPLPPNHPYFGFDNVIVTPHMAGITEQSM  286

Query  462  RYM  454
              M
Sbjct  287  MRM  289



>ref|WP_020963031.1| lactate dehydrogenase [Thermofilum sp. 1910b]
 ref|YP_008432737.1| lactate dehydrogenase [Thermofilum sp. 1910b]
 gb|AGT35724.1| lactate dehydrogenase [Thermofilum sp. 1910b]
 gb|AJB41529.1| D-3-phosphoglycerate dehydrogenase [Thermofilum carboxyditrophus 
1505]
Length=341

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   L+ G +GG+G+DV   EP   D+ +L F NVIITPH+   T  + R
Sbjct  240  ARGELIDTNALIKGLETGKIGGVGLDVIEGEPIGADHPLLKFPNVIITPHIGANTLEALR  299

Query  459  YMAKVVGDVALQLHAGTP  406
             M +   +  LQ+  G P
Sbjct  300  GMDESNANAILQVIRGEP  317



>gb|ESX64956.1| dehydrogenase [Mesorhizobium sp. LSHC420B00]
Length=310

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            ++RG ++D DA+   L+ G +GG  +DV  T+P  P++    F NVI+TPH+AG+TE S 
Sbjct  211  VSRGPVIDDDALIEALQKGRIGGAALDVFATQPLPPNHPYFGFDNVIVTPHMAGITEQSM  270

Query  462  RYM  454
              M
Sbjct  271  MRM  273



>ref|WP_014757115.1| MULTISPECIES: lactate dehydrogenase [Thermoanaerobacterium]
 ref|YP_006390791.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|AFK85192.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|ETO39632.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermoanaerobacterium aotearoense SCUT27]
Length=326

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   L  G + G+G+DV   EP D ++ +L ++NV+ITPH++  T+   +
Sbjct  242  ARGELIDNEALMKALDDGKVAGVGLDVVENEPIDQNHPLLKYENVVITPHISAYTKECLK  301

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV D+   L+   P
Sbjct  302  GMGDKVVSDIEKVLNGQEP  320



>ref|WP_043870188.1| dehydrogenase [Celeribacter indicus]
 gb|AJE47686.1| D-isomer specific 2-hydroxyacid dehydrogenase [Celeribacter indicus]
Length=344

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            +RGGL+D DA+   +  GHLGG G+DV  TEP   D+ + + + VI+TPH+ G T   Y 
Sbjct  245  SRGGLIDEDALVRVMGEGHLGGAGLDVTETEPLPDDHPLRSLERVILTPHILGHTVDLYT  304

Query  459  YMAKVVGDVALQLHAG  412
             M  V+ + A ++  G
Sbjct  305  VMPDVLVENATRIMRG  320



>ref|WP_017800580.1| lactate dehydrogenase [Erwinia toletana]
Length=315

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            + RGGL++  A+   L+ GH+ G G+DV W EP DP + I ++ NVI TPH+ GVT+ S 
Sbjct  232  LGRGGLIEKQALIAALELGHIAGAGLDVFWQEPPDPQDKIFSY-NVIATPHIGGVTDISL  290

Query  462  R  460
            +
Sbjct  291  Q  291



>ref|WP_031211595.1| hypothetical protein, partial [Mesorhizobium sp. LSJC280B00]
Length=289

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +ARGGL+D  A+ + ++  HL G GID    EP  PDN +L    V+++PH A  +  SY
Sbjct  203  VARGGLVDEVALADAIRRSHLAGAGIDTFEREPPSPDNPLLALDTVLVSPHAAHYSTQSY  262

Query  462  RYMA-KVVGDVALQLHAGTPL  403
              +  KV  DVA  L  G P+
Sbjct  263  AEVRNKVFADVASVLRGGKPV  283



>ref|WP_042300725.1| 3-phosphoglycerate dehydrogenase [Burkholderia kururiensis]
Length=341

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARGG++D  A+ + L  GH+ G  IDV   EP  P N +L   NVI +PH+AGVT  +  
Sbjct  247  ARGGIVDECALADRLTSGHIAGAAIDVFLPEPPMPGNPLLEMSNVICSPHLAGVTREAVE  306

Query  459  YMAKVVGDVALQLHAGTP  406
             MA++    AL +  G P
Sbjct  307  RMAQLAVANALSVLDGHP  324



>ref|WP_014974771.1| 2-hydroxyacid dehydrogenase [Leuconostoc carnosum]
 gb|AFT82161.1| hypothetical protein C270_06260 [Leuconostoc carnosum JB16]
Length=305

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            IARG ++D  A+ + LK G + G G+DV   EP  PDN +L+  NV +TPHVA  +  ++
Sbjct  221  IARGAVVDEQALISALKSGKIAGAGLDVVTNEPVTPDNELLSLPNVFVTPHVAASSREAF  280



>ref|WP_039279002.1| phosphoglycerate dehydrogenase [Novosphingobium malaysiense]
 gb|KHK93241.1| phosphoglycerate dehydrogenase [Novosphingobium malaysiense]
Length=318

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            +RGG+++  A+   L+CG L   GIDV   EP   D+ + +  N +++PHVAGVTE+  +
Sbjct  230  SRGGIINEAALAEALRCGQLAAAGIDVFEAEPPPADHPLFDLPNCLLSPHVAGVTEAGMK  289

Query  459  YMAKVVGDVALQLHAGTP  406
             MA  V  V   + AG P
Sbjct  290  DMALNVAAVIEDVAAGRP  307



>ref|WP_037501297.1| hypothetical protein, partial [Solirubrobacter soli]
Length=302

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            I RGGL+D DA+   L  GH+ G  +DV   EP    +A+L+  NVI+TPHVA V+E + 
Sbjct  228  IGRGGLVDEDALVAALHSGHIAGAALDVTEIEPLPLSSALLDAPNVILTPHVAWVSEVAL  287

Query  462  RYMAKVVGDVALQL  421
              + ++  + AL+L
Sbjct  288  SDLKRLTAENALRL  301



>ref|WP_029199184.1| glycerate dehydrogenase [Paenibacillus alginolyticus]
Length=318

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESSY  463
            ARGGLL+   V + L  G L G G+DV   EP  PDN +L+ +NVIITPH+A  T E+  
Sbjct  236  ARGGLLNEKDVAHALNEGRLAGAGLDVLTIEPPQPDNPLLHARNVIITPHIAWATKEARA  295

Query  462  RYMAKVVGDV  433
            R M   +G+V
Sbjct  296  RLMDTAIGNV  305



>ref|WP_013788786.1| lactate dehydrogenase [Thermoanaerobacterium xylanolyticum]
 gb|AEF18056.1| D-lactate dehydrogenase [Thermoanaerobacterium xylanolyticum 
LX-11]
Length=326

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  639  ARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSYR  460
            ARG L+D +A+   L  G + G+G+DV   EP D ++ +L ++NV+ITPH++  T    +
Sbjct  242  ARGELIDNEALMKALDDGKVAGVGLDVVENEPIDENHPLLKYENVVITPHISAYTRECLK  301

Query  459  YMA-KVVGDVALQLHAGTP  406
             M  KVV D+   L+   P
Sbjct  302  GMGDKVVSDIEKVLNGEEP  320



>gb|AER67036.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermovirga lienii DSM 17291]
Length=321

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVTESSY  463
            +AR  L+   A+   L+ G L G+G+DV W EP DP++ +L    V++TPH+ GVT+ + 
Sbjct  232  VARAELVKRSALEKALEGGKLAGIGLDVFWDEPADPEDPLLADPRVLVTPHIGGVTDEAV  291

Query  462  RYMAKVVGDVALQLHAGTPLTGI  394
            + +A  + D   + + G  L  +
Sbjct  292  KGVANFIADNIRRFYGGEELKSL  314



>ref|WP_019633540.1| hypothetical protein [Actinomadura atramentaria]
Length=330

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  642  IARGGLLDYDAVFNHLKCGHLGGLGIDVAWTEPFDPDNAILNFQNVIITPHVAGVT-ESS  466
            +ARGGL+D DA+   L  G LGG  +DV   EP   D+ +    NV+++PHVAG T E+ 
Sbjct  237  VARGGLVDEDALAAALDSGALGGAALDVFAAEPAPADSPLRRHDNVLLSPHVAGATAEAQ  296

Query  465  YRYMAKVVGDVALQLHAGTPLTGI  394
               + KV+ +VA  +  G P++G+
Sbjct  297  SSIIGKVIDNVAAAVR-GEPVSGV  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375