BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043E19

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631909.1|  PREDICTED: aspartic proteinase Asp1                246   8e-76   Nicotiana tomentosiformis
ref|XP_006346815.1|  PREDICTED: aspartic proteinase Asp1-like           246   9e-76   Solanum tuberosum [potatoes]
ref|XP_009766881.1|  PREDICTED: aspartic proteinase Asp1                243   2e-74   Nicotiana sylvestris
ref|XP_004240685.1|  PREDICTED: aspartic proteinase Asp1                243   2e-74   
gb|KFK29973.1|  hypothetical protein AALP_AA7G201200                    229   3e-69   Arabis alpina [alpine rockcress]
emb|CDP04854.1|  unnamed protein product                                225   5e-68   Coffea canephora [robusta coffee]
ref|XP_006412352.1|  hypothetical protein EUTSA_v10025289mg             226   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_002867175.1|  hypothetical protein ARALYDRAFT_328390             225   7e-68   Arabidopsis lyrata subsp. lyrata
emb|CDX68982.1|  BnaC01g04710D                                          225   1e-67   
ref|XP_009121783.1|  PREDICTED: aspartic proteinase Asp1                225   1e-67   Brassica rapa
dbj|BAD80835.1|  nucellin-like protein                                  224   2e-67   Daucus carota [carrots]
dbj|BAC43357.1|  putative nucellin                                      224   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190905.1|  aspartyl protease family protein                   224   3e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75359.1|  BnaA01g03430D                                          224   4e-67   
ref|XP_006282959.1|  hypothetical protein CARUB_v10007649mg             222   1e-66   Capsella rubella
ref|XP_011099684.1|  PREDICTED: aspartic proteinase Asp1                220   6e-66   Sesamum indicum [beniseed]
ref|XP_010432554.1|  PREDICTED: aspartic proteinase Asp1-like           220   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010437756.1|  PREDICTED: aspartic proteinase Asp1-like           220   9e-66   Camelina sativa [gold-of-pleasure]
gb|EYU20602.1|  hypothetical protein MIMGU_mgv1a007047mg                219   1e-65   Erythranthe guttata [common monkey flower]
gb|KJB40494.1|  hypothetical protein B456_007G066800                    219   2e-65   Gossypium raimondii
ref|XP_002310541.2|  hypothetical protein POPTR_0007s04800g             219   2e-65   
ref|XP_010527074.1|  PREDICTED: aspartic proteinase Asp1-like           218   5e-65   Tarenaya hassleriana [spider flower]
gb|ABK95151.1|  unknown                                                 217   6e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002307058.2|  nucellin family protein                            217   7e-65   
ref|XP_006382886.1|  hypothetical protein POPTR_0005s07070g             217   7e-65   
ref|XP_010447234.1|  PREDICTED: aspartic proteinase Asp1-like           218   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007048530.1|  Eukaryotic aspartyl protease family protein ...    218   8e-65   
ref|XP_010025734.1|  PREDICTED: aspartic proteinase Asp1-like           216   4e-64   Eucalyptus grandis [rose gum]
ref|XP_006380399.1|  nucellin family protein                            215   4e-64   
gb|EPS67652.1|  hypothetical protein M569_07122                         214   9e-64   Genlisea aurea
gb|KDP24798.1|  hypothetical protein JCGZ_25323                         214   2e-63   Jatropha curcas
emb|CAB38807.1|  nucellin-like protein                                  214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031099.1|  PREDICTED: aspartic proteinase Asp1-like           213   7e-63   Populus euphratica
gb|KGN62238.1|  hypothetical protein Csa_2G338820                       211   9e-63   Cucumis sativus [cucumbers]
ref|XP_002273988.1|  PREDICTED: aspartic proteinase Asp1                212   1e-62   Vitis vinifera
ref|XP_004163385.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    211   1e-62   
ref|XP_008227592.1|  PREDICTED: aspartic proteinase Asp1                212   2e-62   Prunus mume [ume]
ref|XP_007211687.1|  hypothetical protein PRUPE_ppa005961mg             212   2e-62   Prunus persica
ref|XP_002522918.1|  nucellin, putative                                 211   2e-62   Ricinus communis
ref|XP_011022861.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    211   2e-62   Populus euphratica
ref|XP_004147327.1|  PREDICTED: aspartic proteinase Asp1-like           211   2e-62   
ref|XP_008460824.1|  PREDICTED: aspartic proteinase Asp1 isoform X3     208   2e-61   Cucumis melo [Oriental melon]
ref|XP_008460823.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     207   6e-61   Cucumis melo [Oriental melon]
ref|XP_008460822.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     207   6e-61   Cucumis melo [Oriental melon]
ref|XP_009350136.1|  PREDICTED: aspartic proteinase Asp1-like           207   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_011022860.1|  PREDICTED: aspartic proteinase Asp1-like           207   9e-61   Populus euphratica
emb|CAN73001.1|  hypothetical protein VITISV_037997                     207   1e-60   Vitis vinifera
ref|XP_010547875.1|  PREDICTED: aspartic proteinase Asp1                206   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_010111255.1|  Aspartic proteinase Asp1                           206   3e-60   Morus notabilis
ref|XP_008361087.1|  PREDICTED: aspartic proteinase Asp1-like           206   4e-60   
ref|XP_006464925.1|  PREDICTED: aspartic proteinase Asp1-like           204   9e-60   Citrus sinensis [apfelsine]
ref|XP_010674354.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     203   1e-59   
ref|XP_006432088.1|  hypothetical protein CICLE_v10001122mg             205   1e-59   
gb|KDO52221.1|  hypothetical protein CISIN_1g013774mg                   204   1e-59   Citrus sinensis [apfelsine]
ref|XP_010674353.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     203   3e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009355861.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_006432093.1|  hypothetical protein CICLE_v10001115mg             200   3e-58   
ref|XP_009355862.1|  PREDICTED: aspartic proteinase Asp1-like           200   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_006464928.1|  PREDICTED: aspartic proteinase Asp1-like iso...    199   7e-58   
ref|XP_006432092.1|  hypothetical protein CICLE_v10001115mg             200   9e-58   
ref|XP_006464927.1|  PREDICTED: aspartic proteinase Asp1-like iso...    200   1e-57   
gb|AFK47184.1|  unknown                                                 192   6e-57   Lotus japonicus
ref|XP_009393816.1|  PREDICTED: aspartic proteinase Asp1-like           196   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420564.1|  PREDICTED: aspartic proteinase Asp1-like           196   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007159874.1|  hypothetical protein PHAVU_002G275100g             194   1e-55   Phaseolus vulgaris [French bean]
gb|KHN20145.1|  Aspartic proteinase Asp1                                194   1e-55   Glycine soja [wild soybean]
gb|AAG51657.1|AC010704_1  nucellin-like protein; 27671-25467            193   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177872.3|  aspartyl protease                                     193   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006596210.1|  PREDICTED: aspartic proteinase Asp1-like iso...    192   4e-55   Glycine max [soybeans]
ref|NP_850981.1|  aspartyl protease                                     193   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20610.1|  Aspartic proteinase Asp1                                192   1e-54   Glycine soja [wild soybean]
gb|AES72936.2|  eukaryotic aspartyl protease family protein             191   1e-54   Medicago truncatula
ref|XP_003532363.2|  PREDICTED: aspartic proteinase Asp1-like           191   2e-54   Glycine max [soybeans]
ref|XP_009404862.1|  PREDICTED: aspartic proteinase Asp1-like           191   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010027413.1|  PREDICTED: aspartic proteinase Asp1-like           191   2e-54   
gb|KCW62450.1|  hypothetical protein EUGRSUZ_H05085                     184   3e-54   Eucalyptus grandis [rose gum]
ref|XP_010463205.1|  PREDICTED: aspartic proteinase Asp1-like           184   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002889144.1|  hypothetical protein ARALYDRAFT_476912             190   7e-54   
ref|XP_003630348.1|  Aspartic proteinase Asp1                           189   8e-54   Medicago truncatula
emb|CDX88370.1|  BnaC06g38140D                                          189   8e-54   
gb|KHN31194.1|  Aspartic proteinase Asp1                                185   1e-53   Glycine soja [wild soybean]
emb|CDX87518.1|  BnaA07g33550D                                          189   2e-53   
ref|XP_006472808.1|  PREDICTED: aspartic proteinase Asp1-like iso...    187   3e-53   Citrus sinensis [apfelsine]
ref|XP_010532199.1|  PREDICTED: aspartic proteinase Asp1                186   6e-53   Tarenaya hassleriana [spider flower]
ref|XP_010243511.1|  PREDICTED: aspartic proteinase Asp1                187   7e-53   Nelumbo nucifera [Indian lotus]
emb|CDY41786.1|  BnaC02g13700D                                          187   7e-53   Brassica napus [oilseed rape]
ref|XP_006472807.1|  PREDICTED: aspartic proteinase Asp1-like iso...    187   8e-53   Citrus sinensis [apfelsine]
ref|XP_003524315.1|  PREDICTED: aspartic proteinase Asp1-like           186   1e-52   Glycine max [soybeans]
ref|XP_007137749.1|  hypothetical protein PHAVU_009G152700g             186   1e-52   Phaseolus vulgaris [French bean]
ref|XP_003602685.1|  Aspartic proteinase Asp1                           185   2e-52   
ref|XP_006434233.1|  hypothetical protein CICLE_v10003265mg             186   2e-52   Citrus clementina [clementine]
ref|XP_003522473.1|  PREDICTED: aspartic proteinase Asp1-like           185   3e-52   Glycine max [soybeans]
ref|XP_007203973.1|  hypothetical protein PRUPE_ppa025075mg             183   3e-52   
ref|XP_008219614.1|  PREDICTED: aspartic proteinase Asp1-like iso...    184   3e-52   Prunus mume [ume]
ref|XP_003528065.1|  PREDICTED: aspartic proteinase Asp1-like           185   4e-52   Glycine max [soybeans]
ref|XP_011458802.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     184   4e-52   Fragaria vesca subsp. vesca
ref|XP_007223384.1|  hypothetical protein PRUPE_ppa005622mg             184   4e-52   Prunus persica
gb|EMT17342.1|  Aspartic proteinase Asp1                                176   4e-52   
ref|XP_004977228.1|  PREDICTED: aspartic proteinase Asp1-like iso...    183   5e-52   
ref|XP_010479040.1|  PREDICTED: aspartic proteinase Asp1                184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008219613.1|  PREDICTED: aspartic proteinase Asp1-like iso...    184   6e-52   Prunus mume [ume]
ref|XP_004503902.1|  PREDICTED: aspartic proteinase Asp1-like           184   8e-52   Cicer arietinum [garbanzo]
ref|XP_004290889.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     184   9e-52   Fragaria vesca subsp. vesca
ref|XP_007223385.1|  hypothetical protein PRUPE_ppa005622mg             184   9e-52   Prunus persica
ref|XP_010025732.1|  PREDICTED: aspartic proteinase Asp1-like           183   1e-51   Eucalyptus grandis [rose gum]
ref|XP_008466731.1|  PREDICTED: aspartic proteinase Asp1-like           183   2e-51   Cucumis melo [Oriental melon]
ref|XP_004502990.1|  PREDICTED: aspartic proteinase Asp1-like           182   2e-51   Cicer arietinum [garbanzo]
gb|KHN47012.1|  Aspartic proteinase Asp1                                182   2e-51   Glycine soja [wild soybean]
ref|XP_006393742.1|  hypothetical protein EUTSA_v10011529mg             182   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_003523437.1|  PREDICTED: aspartic proteinase Asp1-like           182   3e-51   
ref|XP_004142705.1|  PREDICTED: aspartic proteinase Asp1-like           182   3e-51   Cucumis sativus [cucumbers]
ref|XP_004977226.1|  PREDICTED: aspartic proteinase Asp1-like iso...    182   3e-51   Setaria italica
ref|NP_567922.2|  aspartyl protease family protein                      181   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004977227.1|  PREDICTED: aspartic proteinase Asp1-like iso...    182   4e-51   
ref|XP_010095410.1|  Aspartic proteinase Asp1                           182   4e-51   
ref|XP_003523438.1|  PREDICTED: aspartic proteinase Asp1-like           181   5e-51   
ref|XP_010416691.1|  PREDICTED: aspartic proteinase Asp1-like           182   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006302228.1|  hypothetical protein CARUB_v10020249mg             182   6e-51   Capsella rubella
ref|XP_010063407.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     181   6e-51   Eucalyptus grandis [rose gum]
ref|XP_010930726.1|  PREDICTED: aspartic proteinase Asp1-like           181   6e-51   
ref|XP_010063406.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     181   1e-50   Eucalyptus grandis [rose gum]
ref|XP_008444185.1|  PREDICTED: aspartic proteinase Asp1-like           180   1e-50   Cucumis melo [Oriental melon]
ref|XP_006663866.1|  PREDICTED: aspartic proteinase Asp1-like           179   2e-50   
ref|XP_008781591.1|  PREDICTED: aspartic proteinase Asp1-like           181   2e-50   Phoenix dactylifera
ref|XP_009106403.1|  PREDICTED: aspartic proteinase Asp1                181   2e-50   Brassica rapa
ref|XP_010930728.1|  PREDICTED: aspartic proteinase Asp1-like           180   2e-50   Elaeis guineensis
ref|XP_010428825.1|  PREDICTED: aspartic proteinase Asp1-like           181   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010471942.1|  PREDICTED: aspartic proteinase Asp1-like           180   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010238658.1|  PREDICTED: aspartic proteinase Asp1-like           180   3e-50   Brachypodium distachyon [annual false brome]
ref|XP_011468243.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     179   3e-50   Fragaria vesca subsp. vesca
ref|XP_006390086.1|  hypothetical protein EUTSA_v10018497mg             179   6e-50   Eutrema salsugineum [saltwater cress]
gb|EMS63812.1|  Aspartic proteinase Asp1                                179   6e-50   Triticum urartu
ref|XP_004149806.1|  PREDICTED: aspartic proteinase Asp1-like           179   6e-50   Cucumis sativus [cucumbers]
ref|XP_003526637.1|  PREDICTED: aspartic proteinase Asp1-like           178   7e-50   Glycine max [soybeans]
ref|XP_004171754.1|  PREDICTED: aspartic proteinase Asp1-like           178   1e-49   
ref|XP_007019123.1|  Eukaryotic aspartyl protease family protein,...    178   2e-49   
emb|CDY12535.1|  BnaC06g00610D                                          176   2e-49   Brassica napus [oilseed rape]
ref|XP_009123049.1|  PREDICTED: aspartic proteinase Asp1                176   3e-49   Brassica rapa
ref|XP_010521265.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     176   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_004498348.1|  PREDICTED: aspartic proteinase Asp1-like           177   3e-49   Cicer arietinum [garbanzo]
emb|CDY10133.1|  BnaC05g03760D                                          177   3e-49   Brassica napus [oilseed rape]
gb|EYU31770.1|  hypothetical protein MIMGU_mgv1a006482mg                176   6e-49   Erythranthe guttata [common monkey flower]
ref|XP_010521264.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     176   7e-49   Tarenaya hassleriana [spider flower]
emb|CDP10935.1|  unnamed protein product                                175   1e-48   Coffea canephora [robusta coffee]
gb|KFK42141.1|  hypothetical protein AALP_AA2G216700                    176   1e-48   Arabis alpina [alpine rockcress]
gb|KEH40514.1|  eukaryotic aspartyl protease family protein             174   2e-48   Medicago truncatula
emb|CDY14973.1|  BnaA10g08830D                                          174   2e-48   Brassica napus [oilseed rape]
gb|EEC68949.1|  hypothetical protein OsI_37668                          174   2e-48   Oryza sativa Indica Group [Indian rice]
gb|EYU31771.1|  hypothetical protein MIMGU_mgv1a006482mg                175   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_010025731.1|  PREDICTED: aspartic proteinase Asp1-like           175   2e-48   
gb|ABA96612.2|  Eukaryotic aspartyl protease family protein, expr...    175   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011069472.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     174   3e-48   
ref|XP_011003438.1|  PREDICTED: aspartic proteinase Asp1-like           174   3e-48   Populus euphratica
gb|KEH40515.1|  eukaryotic aspartyl protease family protein             174   3e-48   Medicago truncatula
ref|NP_001066301.1|  Os12g0177500                                       174   4e-48   
ref|XP_002888605.1|  hypothetical protein ARALYDRAFT_475850             173   5e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010268980.1|  PREDICTED: aspartic proteinase Asp1-like           174   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006303534.1|  hypothetical protein CARUB_v10010968mg             173   7e-48   Capsella rubella
ref|XP_011069464.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     174   7e-48   Sesamum indicum [beniseed]
ref|NP_175079.1|  aspartyl protease family protein                      172   9e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520345.1|  nucellin, putative                                 172   1e-47   
ref|XP_010322933.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     172   1e-47   Solanum lycopersicum
ref|XP_004242040.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     173   1e-47   Solanum lycopersicum
ref|XP_007137426.1|  hypothetical protein PHAVU_009G126200g             172   2e-47   Phaseolus vulgaris [French bean]
ref|XP_009611015.1|  PREDICTED: aspartic proteinase Asp1                172   2e-47   Nicotiana tomentosiformis
gb|KDP32842.1|  hypothetical protein JCGZ_12134                         172   3e-47   Jatropha curcas
gb|KJB29193.1|  hypothetical protein B456_005G089000                    167   4e-47   Gossypium raimondii
ref|XP_002306645.2|  hypothetical protein POPTR_0005s20210g             171   5e-47   
ref|NP_001152116.1|  aspartic proteinase Asp1 precursor                 170   9e-47   
ref|NP_001131929.1|  uncharacterized protein LOC100193320 precursor     170   9e-47   
gb|ACR34528.1|  unknown                                                 170   1e-46   Zea mays [maize]
ref|XP_002441914.1|  hypothetical protein SORBIDRAFT_08g004800          169   2e-46   
ref|XP_007019119.1|  Eukaryotic aspartyl protease family protein ...    168   4e-46   Theobroma cacao [chocolate]
ref|XP_008661408.1|  PREDICTED: uncharacterized protein LOC100193...    169   4e-46   Zea mays [maize]
gb|KJB29192.1|  hypothetical protein B456_005G089000                    166   5e-46   Gossypium raimondii
ref|XP_010025733.1|  PREDICTED: aspartic proteinase Asp1-like           168   5e-46   Eucalyptus grandis [rose gum]
ref|XP_009596730.1|  PREDICTED: aspartic proteinase Asp1-like           169   7e-46   Nicotiana tomentosiformis
gb|AES87275.2|  eukaryotic aspartyl protease family protein             168   8e-46   Medicago truncatula
ref|XP_009802241.1|  PREDICTED: aspartic proteinase Asp1                167   8e-46   Nicotiana sylvestris
ref|XP_009758779.1|  PREDICTED: aspartic proteinase Asp1-like           168   1e-45   Nicotiana sylvestris
gb|KJB29183.1|  hypothetical protein B456_005G088900                    164   1e-45   Gossypium raimondii
emb|CBI18999.3|  unnamed protein product                                166   1e-45   Vitis vinifera
ref|XP_006365534.1|  PREDICTED: aspartic proteinase Asp1-like           167   1e-45   Solanum tuberosum [potatoes]
ref|XP_010664194.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     167   2e-45   Vitis vinifera
ref|XP_004240544.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     166   2e-45   Solanum lycopersicum
gb|KJB29184.1|  hypothetical protein B456_005G088900                    163   3e-45   Gossypium raimondii
ref|XP_004240543.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     166   3e-45   
ref|XP_004142630.1|  PREDICTED: aspartic proteinase Asp1-like           166   3e-45   Cucumis sativus [cucumbers]
gb|KJB29189.1|  hypothetical protein B456_005G089000                    166   3e-45   Gossypium raimondii
ref|XP_004502513.1|  PREDICTED: aspartic proteinase Asp1-like           166   4e-45   Cicer arietinum [garbanzo]
ref|XP_002285867.2|  PREDICTED: aspartic proteinase Asp1 isoform X1     166   4e-45   Vitis vinifera
gb|KJB29190.1|  hypothetical protein B456_005G089000                    166   4e-45   Gossypium raimondii
ref|XP_006355805.1|  PREDICTED: aspartic proteinase Asp1-like iso...    164   5e-45   Solanum tuberosum [potatoes]
gb|KHG10363.1|  Asparticase Asp1                                        166   5e-45   Gossypium arboreum [tree cotton]
ref|XP_011027496.1|  PREDICTED: aspartic proteinase Asp1-like iso...    166   5e-45   Populus euphratica
ref|XP_011468246.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     164   8e-45   Fragaria vesca subsp. vesca
gb|AAM76716.1|  nucellin-like aspartic protease                         163   1e-44   Zea mays [maize]
ref|XP_011027495.1|  PREDICTED: aspartic proteinase Asp1-like iso...    165   1e-44   Populus euphratica
ref|XP_006355850.1|  PREDICTED: aspartic proteinase Asp1-like           164   1e-44   
ref|XP_002302227.1|  nucellin family protein                            164   1e-44   Populus trichocarpa [western balsam poplar]
gb|AAY23266.1|  Similar to nucellin-like aspartic protease              161   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502512.1|  PREDICTED: aspartic proteinase Asp1-like           164   2e-44   Cicer arietinum [garbanzo]
ref|XP_008669793.1|  PREDICTED: aspartic proteinase Asp1                164   2e-44   
ref|XP_006355804.1|  PREDICTED: aspartic proteinase Asp1-like iso...    164   3e-44   Solanum tuberosum [potatoes]
ref|XP_006386369.1|  hypothetical protein POPTR_0002s08190g             164   3e-44   Populus trichocarpa [western balsam poplar]
gb|KJB29187.1|  hypothetical protein B456_005G088900                    163   3e-44   Gossypium raimondii
ref|XP_003605080.1|  Aspartic proteinase Asp1                           163   3e-44   
ref|XP_011074834.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     163   4e-44   
ref|XP_008444184.1|  PREDICTED: aspartic proteinase Asp1-like           163   5e-44   Cucumis melo [Oriental melon]
gb|KJB29182.1|  hypothetical protein B456_005G088900                    164   5e-44   Gossypium raimondii
gb|KJB29181.1|  hypothetical protein B456_005G088900                    163   6e-44   Gossypium raimondii
gb|ACG42043.1|  aspartic proteinase Asp1 precursor                      162   7e-44   Zea mays [maize]
gb|EPS72688.1|  hypothetical protein M569_02067                         161   1e-43   Genlisea aurea
ref|XP_010680865.1|  PREDICTED: aspartic proteinase Asp1-like           161   2e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO80581.1|  hypothetical protein CISIN_1g014185mg                   155   8e-43   Citrus sinensis [apfelsine]
gb|KDO52229.1|  hypothetical protein CISIN_1g015972mg                   159   8e-43   Citrus sinensis [apfelsine]
gb|KDO52225.1|  hypothetical protein CISIN_1g015972mg                   158   2e-42   Citrus sinensis [apfelsine]
ref|XP_006472803.1|  PREDICTED: aspartic proteinase Asp1-like iso...    156   1e-41   Citrus sinensis [apfelsine]
gb|EEC67807.1|  hypothetical protein OsI_35373                          156   1e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_003577760.1|  PREDICTED: aspartic proteinase Asp1-like           156   2e-41   Brachypodium distachyon [annual false brome]
ref|NP_001065913.1|  Os11g0183900                                       155   2e-41   
ref|XP_006472802.1|  PREDICTED: aspartic proteinase Asp1-like iso...    156   2e-41   Citrus sinensis [apfelsine]
gb|EEE51772.1|  hypothetical protein OsJ_33215                          159   3e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62785.1|  Aspartic proteinase Asp1                                155   3e-41   Triticum urartu
gb|KDO80580.1|  hypothetical protein CISIN_1g014185mg                   154   3e-41   Citrus sinensis [apfelsine]
gb|KEH20924.1|  eukaryotic aspartyl protease family protein             155   4e-41   Medicago truncatula
ref|XP_003605078.1|  Aspartic proteinase Asp1                           155   5e-41   
gb|KDO80579.1|  hypothetical protein CISIN_1g014185mg                   155   5e-41   Citrus sinensis [apfelsine]
gb|EMT29613.1|  Aspartic proteinase Asp1                                154   1e-40   
ref|XP_006662787.1|  PREDICTED: aspartic proteinase Asp1-like           154   1e-40   Oryza brachyantha
ref|XP_004978884.1|  PREDICTED: aspartic proteinase Asp1-like           153   2e-40   Setaria italica
gb|EMT12274.1|  Aspartic proteinase Asp1                                153   3e-40   
ref|XP_007019121.1|  Eukaryotic aspartyl protease family protein        153   4e-40   
ref|XP_006856698.1|  hypothetical protein AMTR_s00054p00157640          152   5e-40   
dbj|BAJ99780.1|  predicted protein                                      151   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008807681.1|  PREDICTED: aspartic proteinase Asp1-like           147   3e-38   Phoenix dactylifera
gb|EMT05967.1|  Aspartic proteinase Asp1                                144   7e-38   
ref|XP_001783556.1|  predicted protein                                  145   3e-37   
ref|XP_002511959.1|  protein with unknown function                      146   3e-37   Ricinus communis
ref|XP_001766321.1|  predicted protein                                  143   6e-37   
gb|KHG10362.1|  Asparticase Asp1                                        142   3e-36   Gossypium arboreum [tree cotton]
ref|XP_010912572.1|  PREDICTED: aspartic proteinase Asp1-like           141   6e-36   Elaeis guineensis
ref|XP_001782061.1|  predicted protein                                  138   6e-35   
gb|ABR18371.1|  unknown                                                 139   6e-35   Picea sitchensis
gb|KHG06665.1|  Asparticase Asp1                                        137   8e-35   Gossypium arboreum [tree cotton]
ref|XP_006485774.1|  PREDICTED: aspartic proteinase Asp1-like           137   5e-34   Citrus sinensis [apfelsine]
gb|EMS52520.1|  Aspartic proteinase Asp1                                135   8e-34   Triticum urartu
ref|NP_001065918.1|  Os11g0184800                                       135   1e-33   
gb|AAK81698.1|  aspartyl proteinase                                     135   1e-33   Oryza sativa [red rice]
gb|KDO41977.1|  hypothetical protein CISIN_1g008104mg                   136   1e-33   Citrus sinensis [apfelsine]
sp|A2ZC67.2|ASP1_ORYSI  RecName: Full=Aspartic proteinase Asp1; S...    135   1e-33   Oryza sativa Indica Group [Indian rice]
gb|AAK81699.1|  aspartyl proteinase                                     135   1e-33   Oryza sativa [red rice]
emb|CDY18730.1|  BnaC08g08860D                                          134   1e-33   Brassica napus [oilseed rape]
ref|XP_006440945.1|  hypothetical protein CICLE_v10019473mg             135   2e-33   Citrus clementina [clementine]
gb|EEC67810.1|  hypothetical protein OsI_35379                          134   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006662788.1|  PREDICTED: aspartic proteinase Asp1-like           133   6e-33   Oryza brachyantha
gb|EMT31650.1|  Aspartic proteinase Asp1                                133   7e-33   
ref|XP_010912540.1|  PREDICTED: aspartic proteinase Asp1-like           132   7e-33   
dbj|BAJ98705.1|  predicted protein                                      133   7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN32026.1|  Aspartic proteinase Asp1                                134   8e-33   Glycine soja [wild soybean]
gb|AJA74410.1|  aspartic protease                                       133   8e-33   Cicer arietinum [garbanzo]
emb|CBI15437.3|  unnamed protein product                                133   8e-33   Vitis vinifera
gb|KEH27052.1|  eukaryotic aspartyl protease family protein             133   1e-32   Medicago truncatula
ref|XP_002452609.1|  hypothetical protein SORBIDRAFT_04g028990          133   1e-32   Sorghum bicolor [broomcorn]
ref|XP_010663584.1|  PREDICTED: aspartic proteinase Asp1                133   1e-32   Vitis vinifera
gb|EMS61227.1|  Aspartic proteinase Asp1                                131   2e-32   Triticum urartu
gb|KHG03472.1|  Asparticase Asp1                                        132   2e-32   Gossypium arboreum [tree cotton]
gb|KDP20103.1|  hypothetical protein JCGZ_05872                         132   2e-32   Jatropha curcas
ref|XP_009776622.1|  PREDICTED: aspartic proteinase Asp1                132   2e-32   Nicotiana sylvestris
gb|KJB39307.1|  hypothetical protein B456_007G006200                    132   2e-32   Gossypium raimondii
ref|XP_009621932.1|  PREDICTED: aspartic proteinase Asp1                132   3e-32   Nicotiana tomentosiformis
ref|XP_007161478.1|  hypothetical protein PHAVU_001G072500g             131   3e-32   Phaseolus vulgaris [French bean]
ref|XP_006826817.1|  hypothetical protein AMTR_s00010p00056950          131   5e-32   Amborella trichopoda
ref|NP_001146528.1|  hypothetical protein                               128   5e-32   
ref|XP_007152781.1|  hypothetical protein PHAVU_004G159200g             131   6e-32   Phaseolus vulgaris [French bean]
ref|XP_006354730.1|  PREDICTED: aspartic proteinase Asp1-like           131   7e-32   Solanum tuberosum [potatoes]
gb|EMT27437.1|  Aspartic proteinase Asp1                                130   7e-32   
gb|KHN20716.1|  Aspartic proteinase Asp1                                130   1e-31   Glycine soja [wild soybean]
ref|XP_011012697.1|  PREDICTED: aspartic proteinase Asp1                130   1e-31   Populus euphratica
ref|XP_004512995.1|  PREDICTED: lysine-specific histone demethyla...    133   1e-31   
ref|XP_006583400.1|  PREDICTED: aspartic proteinase Asp1-like           130   1e-31   
ref|NP_001146721.1|  uncharacterized protein LOC100280323               130   1e-31   
gb|ACN34727.1|  unknown                                                 130   1e-31   
ref|XP_010094778.1|  Aspartic proteinase Asp1                           130   2e-31   
ref|NP_001077691.1|  aspartyl protease                                  129   2e-31   
ref|XP_004241624.1|  PREDICTED: aspartic proteinase Asp1                129   2e-31   
ref|XP_007036500.1|  Eukaryotic aspartyl protease family protein,...    129   2e-31   
ref|XP_007019120.1|  Eukaryotic aspartyl protease family protein ...    128   4e-31   
ref|NP_564539.1|  aspartyl protease                                     129   4e-31   
ref|XP_009107742.1|  PREDICTED: aspartic proteinase Asp1-like           121   6e-31   
gb|KJB39309.1|  hypothetical protein B456_007G006200                    128   9e-31   
ref|XP_011097005.1|  PREDICTED: aspartic proteinase Asp1                127   1e-30   
ref|XP_010549131.1|  PREDICTED: aspartic proteinase Asp1                127   1e-30   
ref|XP_003563970.2|  PREDICTED: aspartic proteinase Asp1-like           127   1e-30   
gb|EEC67809.1|  hypothetical protein OsI_35378                          125   2e-30   
ref|XP_008658519.1|  PREDICTED: uncharacterized protein LOC100280...    127   2e-30   
gb|KJB29188.1|  hypothetical protein B456_005G088900                    125   3e-30   
ref|XP_011027497.1|  PREDICTED: aspartic proteinase Asp1-like iso...    125   4e-30   
ref|XP_011027498.1|  PREDICTED: aspartic proteinase Asp1-like iso...    125   4e-30   
ref|XP_010036874.1|  PREDICTED: aspartic proteinase Asp1                126   4e-30   
ref|XP_008813298.1|  PREDICTED: aspartic proteinase Asp1                125   5e-30   
ref|XP_010908260.1|  PREDICTED: aspartic proteinase Asp1                125   6e-30   
ref|XP_010479334.1|  PREDICTED: aspartic proteinase Asp1-like           125   8e-30   
gb|EYU33023.1|  hypothetical protein MIMGU_mgv1a009434mg                123   1e-29   
ref|XP_010265186.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     125   1e-29   
ref|XP_006304522.1|  hypothetical protein CARUB_v10011364mg             125   1e-29   
ref|XP_010461710.1|  PREDICTED: aspartic proteinase Asp1-like           124   2e-29   
ref|XP_002891474.1|  aspartyl protease family protein                   124   2e-29   
ref|XP_010500446.1|  PREDICTED: aspartic proteinase Asp1-like           124   2e-29   
gb|KFK36042.1|  hypothetical protein AALP_AA4G070400                    124   3e-29   
ref|XP_004980239.1|  PREDICTED: aspartic proteinase Asp1-like           122   3e-29   
ref|XP_009406648.1|  PREDICTED: aspartic proteinase Asp1                122   1e-28   
ref|XP_006656867.1|  PREDICTED: aspartic proteinase Asp1-like           121   1e-28   
ref|XP_003570503.1|  PREDICTED: aspartic proteinase Asp1-like           122   1e-28   
emb|CDY60079.1|  BnaA05g36440D                                          121   2e-28   
ref|XP_009144992.1|  PREDICTED: aspartic proteinase Asp1                121   2e-28   
ref|XP_004965200.1|  PREDICTED: aspartic proteinase Asp1-like           120   3e-28   
ref|XP_011074835.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     119   4e-28   
ref|XP_002449123.1|  hypothetical protein SORBIDRAFT_05g005430          118   1e-27   
emb|CDO98445.1|  unnamed protein product                                117   4e-27   
gb|EEE52860.1|  hypothetical protein OsJ_35411                          116   4e-27   
ref|XP_010265185.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     116   1e-26   
dbj|BAK05301.1|  predicted protein                                      115   2e-26   
emb|CDY04326.1|  BnaC05g25880D                                          115   2e-26   
gb|AAB96882.1|  nucellin                                                114   3e-26   
gb|EAZ00454.1|  hypothetical protein OsI_22475                          115   4e-26   
ref|NP_001057353.1|  Os06g0268700                                       114   4e-26   
ref|XP_006393315.1|  hypothetical protein EUTSA_v10011346mg             115   5e-26   
gb|EMT01144.1|  Aspartic proteinase Asp1                                112   7e-26   
gb|AAB97155.1|  EEA1                                                    112   9e-26   
ref|XP_002893981.1|  hypothetical protein ARALYDRAFT_314121             111   3e-25   
ref|XP_004971953.1|  PREDICTED: aspartic proteinase Asp1-like           110   4e-25   
gb|KJB39308.1|  hypothetical protein B456_007G006200                    111   5e-25   
dbj|BAJ86250.1|  predicted protein                                      111   6e-25   
gb|EMT27436.1|  Aspartic proteinase Asp1                                110   7e-25   
ref|NP_001048015.1|  Os02g0730700                                       110   2e-24   
gb|EEC73939.1|  hypothetical protein OsI_08807                          110   2e-24   
ref|XP_006374352.1|  aspartyl protease family protein                   110   4e-24   
gb|EMS61228.1|  Aspartic proteinase Asp1                                108   4e-24   
emb|CDY43703.1|  BnaA08g05170D                                        99.8    3e-23   
gb|EMT28382.1|  Aspartic proteinase Asp1                                106   3e-23   
ref|XP_002449122.1|  hypothetical protein SORBIDRAFT_05g005410          105   3e-23   
ref|XP_004137470.1|  PREDICTED: aspartic proteinase Asp1-like           106   6e-23   
ref|XP_008457584.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     105   1e-22   
gb|ACB69715.1|  putative nucellin-like aspartic protease                102   2e-22   
ref|XP_004953813.1|  PREDICTED: aspartic proteinase Asp1-like           100   2e-21   
gb|KEH32831.1|  eukaryotic aspartyl protease family protein           99.4    5e-21   
ref|XP_006588295.1|  PREDICTED: lysine-specific histone demethyla...    102   6e-21   
ref|XP_007152782.1|  hypothetical protein PHAVU_004G159200g             100   6e-21   
gb|KJB39310.1|  hypothetical protein B456_007G006200                  99.4    2e-20   
ref|XP_002449121.1|  hypothetical protein SORBIDRAFT_05g005400        95.9    5e-20   
gb|ACR37122.1|  unknown                                               90.1    1e-19   
gb|EMT25131.1|  Aspartic proteinase Asp1                              92.4    1e-19   
gb|EMT29612.1|  Aspartic proteinase Asp1                              94.0    4e-19   
gb|AFW56223.1|  hypothetical protein ZEAMMB73_420944                  93.6    4e-19   
gb|KDO80582.1|  hypothetical protein CISIN_1g014185mg                 89.4    8e-18   
ref|XP_008457519.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   87.4    2e-16   
gb|KEH27053.1|  eukaryotic aspartyl protease family protein           86.3    4e-16   
gb|KDO41978.1|  hypothetical protein CISIN_1g008104mg                 85.9    6e-16   
ref|XP_010265187.1|  PREDICTED: aspartic proteinase Asp1 isoform X3   78.6    2e-13   
gb|EMT28907.1|  Aspartic proteinase Asp1                              75.9    4e-13   
gb|KCW48539.1|  hypothetical protein EUGRSUZ_K02213                   76.6    9e-13   
ref|XP_008811543.1|  PREDICTED: uncharacterized protein LOC103722...  72.8    1e-12   
ref|XP_007036501.1|  Eukaryotic aspartyl protease family protein,...  74.7    4e-12   
ref|XP_003600929.1|  Aspartic proteinase Asp1                         70.5    5e-12   
gb|KIZ07939.1|  hypothetical protein MNEG_0012                        71.2    2e-11   
gb|KDO37005.1|  hypothetical protein CISIN_1g019849mg                 71.6    2e-11   
ref|XP_010105474.1|  Aspartic proteinase-like protein 2               69.3    3e-10   
gb|KHN47013.1|  Aspartic proteinase Asp1                              66.2    3e-10   
ref|XP_010549260.1|  PREDICTED: aspartic proteinase-like protein 2    68.6    4e-10   
ref|XP_006403297.1|  hypothetical protein EUTSA_v10003167mg           66.6    2e-09   
ref|XP_010442078.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    3e-09   
ref|XP_010494280.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    3e-09   
ref|XP_010494278.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    3e-09   
ref|XP_010442076.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
ref|XP_010494279.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
ref|XP_010442075.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
ref|XP_010442077.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
gb|KHN41554.1|  Aspartic proteinase-like protein 2                    65.1    6e-09   
ref|XP_010327522.1|  PREDICTED: aspartic proteinase-like protein ...  65.1    6e-09   
ref|NP_199124.3|  aspartyl protease family protein                    65.1    6e-09   
dbj|BAB08274.1|  unnamed protein product                              65.1    6e-09   
ref|XP_006579920.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_010481907.1|  PREDICTED: aspartic proteinase-like protein ...  65.1    7e-09   
ref|XP_009772172.1|  PREDICTED: aspartic proteinase-like protein 2    65.1    7e-09   
ref|XP_010481906.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    7e-09   
ref|XP_010481905.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    7e-09   
ref|XP_006281624.1|  hypothetical protein CARUB_v10027752mg           64.7    7e-09   
ref|XP_009603173.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    8e-09   
gb|KEH31519.1|  eukaryotic aspartyl protease family protein           64.7    8e-09   
ref|XP_002306494.2|  hypothetical protein POPTR_0005s18810g           64.7    8e-09   
gb|KFK31741.1|  hypothetical protein AALP_AA6G152800                  64.7    8e-09   
ref|XP_009603172.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    9e-09   
ref|XP_006590642.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    9e-09   
gb|AES90651.2|  eukaryotic aspartyl protease family protein           64.7    9e-09   
ref|XP_004248841.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    9e-09   
gb|KHN44014.1|  Aspartic proteinase-like protein 2                    64.3    1e-08   
ref|XP_003516613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.3    1e-08   
ref|XP_003608454.1|  Aspartic proteinase nepenthesin-1                64.3    1e-08   
ref|XP_002510127.1|  Aspartic proteinase nepenthesin-1 precursor,...  64.3    1e-08   
ref|XP_010087280.1|  Aspartic proteinase-like protein 2               64.3    1e-08   
ref|XP_003550988.1|  PREDICTED: aspartic proteinase-like protein ...  64.3    1e-08   
gb|KHN36268.1|  Metal transporter Nramp3                              64.3    1e-08   
emb|CDY22367.1|  BnaA06g36890D                                        64.3    1e-08   
gb|KDP41653.1|  hypothetical protein JCGZ_16060                       64.3    1e-08   
ref|XP_009101813.1|  PREDICTED: aspartic proteinase-like protein 2    63.9    1e-08   
ref|XP_010652753.1|  PREDICTED: aspartic proteinase nepenthesin-1...  63.9    1e-08   
ref|XP_004509090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  63.9    1e-08   
ref|XP_010271615.1|  PREDICTED: aspartic proteinase-like protein ...  63.9    1e-08   
ref|XP_011015887.1|  PREDICTED: aspartic proteinase-like protein 2    63.9    1e-08   
ref|XP_009780676.1|  PREDICTED: aspartic proteinase-like protein ...  63.9    2e-08   
ref|XP_011016146.1|  PREDICTED: aspartic proteinase-like protein 2    63.9    2e-08   
gb|EYU43423.1|  hypothetical protein MIMGU_mgv1a0027552mg             63.5    2e-08   
ref|XP_006339969.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    2e-08   
gb|EYU37054.1|  hypothetical protein MIMGU_mgv1a003205mg              63.5    2e-08   
ref|XP_009780684.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    2e-08   
ref|XP_009780671.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    2e-08   
ref|XP_009627686.1|  PREDICTED: aspartic proteinase CDR1-like iso...  63.5    2e-08   
ref|XP_010070617.1|  PREDICTED: aspartic proteinase CDR1-like         63.5    2e-08   
ref|XP_006339968.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    2e-08   
ref|XP_009627749.1|  PREDICTED: aspartic proteinase-like protein ...  63.2    2e-08   
ref|XP_001690254.1|  pepsin-type aspartyl protease                    63.2    2e-08   
ref|XP_009360296.1|  PREDICTED: aspartic proteinase CDR1-like         63.2    2e-08   
ref|XP_008811545.1|  PREDICTED: uncharacterized protein LOC103722...  60.1    2e-08   
gb|KHG05352.1|  hypothetical protein F383_31391                       62.8    3e-08   
gb|KHG05353.1|  hypothetical protein F383_31391                       62.8    3e-08   
ref|XP_004244902.1|  PREDICTED: aspartic proteinase-like protein 2    62.8    3e-08   
ref|XP_006374851.1|  hypothetical protein POPTR_0014s02040g           62.8    4e-08   
ref|XP_002865453.1|  predicted protein                                62.8    4e-08   
ref|XP_006404068.1|  hypothetical protein EUTSA_v10010198mg           62.4    4e-08   
ref|XP_010679567.1|  PREDICTED: aspartic proteinase nepenthesin-2...  62.4    4e-08   
ref|XP_009393844.1|  PREDICTED: aspartic proteinase nepenthesin-2...  62.4    5e-08   
ref|XP_009798809.1|  PREDICTED: aspartic proteinase-like protein 2    62.0    5e-08   
emb|CDY57356.1|  BnaC08g48640D                                        62.0    6e-08   
ref|XP_010277146.1|  PREDICTED: aspartic proteinase-like protein ...  62.0    6e-08   
ref|XP_010277145.1|  PREDICTED: aspartic proteinase-like protein ...  62.0    6e-08   
ref|XP_003562781.1|  PREDICTED: aspartic proteinase-like protein 2    62.0    6e-08   
ref|XP_009593347.1|  PREDICTED: aspartic proteinase-like protein 2    62.0    7e-08   
ref|XP_011029041.1|  PREDICTED: aspartic proteinase-like protein 2    61.6    8e-08   
dbj|BAK02500.1|  predicted protein                                    61.6    8e-08   
ref|XP_004958189.1|  PREDICTED: aspartic proteinase-like protein ...  61.2    1e-07   
ref|XP_006426021.1|  hypothetical protein CICLE_v10025144mg           61.2    1e-07   
gb|KJB14599.1|  hypothetical protein B456_002G132900                  60.8    1e-07   
gb|KJB14595.1|  hypothetical protein B456_002G132900                  60.8    1e-07   
ref|XP_004511876.1|  PREDICTED: aspartic proteinase-like protein ...  60.8    1e-07   
gb|KJB14598.1|  hypothetical protein B456_002G132900                  60.8    1e-07   
ref|XP_004289182.1|  PREDICTED: aspartic proteinase CDR1              60.8    1e-07   
gb|KJB14596.1|  hypothetical protein B456_002G132900                  60.8    2e-07   
ref|XP_009115686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.8    2e-07   
ref|XP_010939091.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
ref|XP_011458846.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
gb|KHG13614.1|  hypothetical protein F383_03676                       60.5    2e-07   
emb|CDX71501.1|  BnaC04g17360D                                        60.5    2e-07   
gb|KHG13615.1|  hypothetical protein F383_03676                       60.5    2e-07   
ref|XP_010939093.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
ref|XP_004292749.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
gb|KFK34265.1|  hypothetical protein AALP_AA5G122600                  60.5    2e-07   
ref|XP_006466523.1|  PREDICTED: aspartic proteinase-like protein ...  60.5    2e-07   
ref|XP_004141399.1|  PREDICTED: aspartic proteinase-like protein ...  60.1    2e-07   
ref|XP_004164029.1|  PREDICTED: aspartic proteinase-like protein ...  60.1    2e-07   
emb|CDP15549.1|  unnamed protein product                              60.1    2e-07   
ref|XP_006433595.1|  hypothetical protein CICLE_v10000565mg           60.1    2e-07   
ref|NP_001060161.1|  Os07g0592200                                     60.1    2e-07   
gb|KDO79034.1|  hypothetical protein CISIN_1g047816mg                 60.1    2e-07   
ref|XP_009101633.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.1    2e-07   
gb|KDO81580.1|  hypothetical protein CISIN_1g010556mg                 59.7    3e-07   
gb|KDO81579.1|  hypothetical protein CISIN_1g010556mg                 59.7    3e-07   
gb|EEE67511.1|  hypothetical protein OsJ_24961                        60.1    3e-07   
gb|EEC82371.1|  hypothetical protein OsI_26705                        60.1    3e-07   
emb|CDX68564.1|  BnaC01g26420D                                        60.1    3e-07   
gb|KHG08698.1|  hypothetical protein F383_11875                       60.1    3e-07   
ref|NP_001168795.1|  uncharacterized protein LOC100382594 precursor   60.1    3e-07   
gb|KDO81574.1|  hypothetical protein CISIN_1g010556mg                 59.7    3e-07   
ref|XP_003611647.1|  Aspartic proteinase-like protein                 59.3    3e-07   
gb|KHG08697.1|  hypothetical protein F383_11875                       59.7    3e-07   
ref|XP_002283258.1|  PREDICTED: aspartic proteinase CDR1              59.7    3e-07   
ref|XP_006472263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.7    3e-07   
gb|AES94605.2|  eukaryotic aspartyl protease family protein           59.7    3e-07   
ref|XP_006433596.1|  hypothetical protein CICLE_v10000565mg           59.7    4e-07   
ref|XP_009354126.1|  PREDICTED: aspartic proteinase CDR1-like         59.7    4e-07   
ref|XP_003611646.1|  Aspartic proteinase-like protein                 59.7    4e-07   
gb|KDO81575.1|  hypothetical protein CISIN_1g010556mg                 59.3    4e-07   
ref|XP_010426548.1|  PREDICTED: aspartic proteinase CDR1-like         59.7    4e-07   
ref|XP_010503675.1|  PREDICTED: aspartic proteinase CDR1-like         59.3    4e-07   
ref|XP_001759733.1|  predicted protein                                58.9    5e-07   
ref|XP_002463116.1|  hypothetical protein SORBIDRAFT_02g038150        58.9    6e-07   
ref|XP_006658761.1|  PREDICTED: aspartic proteinase-like protein ...  58.9    6e-07   
ref|XP_010515370.1|  PREDICTED: aspartic proteinase CDR1-like iso...  58.9    6e-07   
gb|KDO81578.1|  hypothetical protein CISIN_1g010556mg                 58.5    7e-07   
ref|XP_010515369.1|  PREDICTED: aspartic proteinase CDR1-like iso...  58.9    7e-07   
ref|XP_007155866.1|  hypothetical protein PHAVU_003G238400g           58.9    7e-07   
ref|XP_009395627.1|  PREDICTED: aspartic proteinase nepenthesin-1...  58.5    7e-07   
ref|XP_001767804.1|  predicted protein                                58.5    7e-07   
ref|XP_011091937.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    1e-06   
gb|KJB58594.1|  hypothetical protein B456_009G217300                  58.2    1e-06   
dbj|BAK03251.1|  predicted protein                                    58.2    1e-06   
gb|KJB58595.1|  hypothetical protein B456_009G217300                  58.2    1e-06   
ref|XP_007156750.1|  hypothetical protein PHAVU_002G014200g           58.2    1e-06   
ref|XP_011091936.1|  PREDICTED: aspartic proteinase-like protein ...  58.2    1e-06   
gb|KJB40297.1|  hypothetical protein B456_007G056000                  57.8    1e-06   



>ref|XP_009631909.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=431

 Score =   246 bits (628),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+ VVFDSGSS+SY+NSQ Y+  +  + KEL GKPLREA DD TLP CWKGRRP
Sbjct  273  KATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELNGKPLREAKDDYTLPLCWKGRRP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I+DVKKYFK+FALSF +GW+S+  FEI PESYLIISSKGSVCLGVLNGTEAGL N N
Sbjct  333  FKTINDVKKYFKNFALSFPHGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTEAGLQNVN  392

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  167
            +IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N
Sbjct  393  LIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSN  427



>ref|XP_006346815.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=437

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+KN+ VVFDSGSS+SY+N+  YE  +  + KEL GKPLRE  DD TLP CWKGRRP
Sbjct  279  KGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELNGKPLRETKDDYTLPLCWKGRRP  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I+DVKKYFK FALSF NGW+S+  FEI PESYLIISSKGSVCLGVLNGTEAGL N N
Sbjct  339  FKTINDVKKYFKQFALSFGNGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTEAGLQNVN  398

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK AIGWT ANCDRPP
Sbjct  399  LIGDISMQDKMVIYDNEKQAIGWTSANCDRPP  430



>ref|XP_009766881.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=433

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+ VVFDSGSS+SY+NSQ Y+  +  + KEL GKPL+EA DD TLP CWKGRRP
Sbjct  275  KATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELNGKPLKEAKDDYTLPLCWKGRRP  334

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I+DVKKYFK+F LSF +GW+S+  FEI PESYLIISSKGSVCLGVLNGTEAGL N N
Sbjct  335  FKTINDVKKYFKNFVLSFPHGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTEAGLQNVN  394

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  167
            +IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N
Sbjct  395  LIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSN  429



>ref|XP_004240685.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=427

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+KN+ VVFDSGSS+SY+N+  YE  +  + KEL GKPLRE  DD TLP CWKGRRP
Sbjct  269  KGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELNGKPLRETKDDYTLPLCWKGRRP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I+D KKYFK FALSF NGW+S+  FEI PESYLIISSKGSVCLGVLNGTEAGL N N
Sbjct  329  FKTINDAKKYFKQFALSFGNGWKSKAHFEIPPESYLIISSKGSVCLGVLNGTEAGLQNVN  388

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK AIGW  ANCDRPP
Sbjct  389  LIGDISMQDKMVIYDNEKQAIGWMSANCDRPP  420



>gb|KFK29973.1| hypothetical protein AALP_AA7G201200 [Arabis alpina]
Length=422

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  261  KTTGLKNLMTVFDSGSSYTYFNSKAYQAVTYMIKRELSGKPLKEARDDHTLPLCWQGRRP  320

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI DVKKYFK  ALSF  GWRS+TLF+I PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  321  FMSIEDVKKYFKPLALSFKTGWRSKTLFQIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  380

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW +A+CD 
Sbjct  381  LIGDISMQDQMIIYDNEKQSIGWIQADCDE  410



>emb|CDP04854.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K  G+KN+ V+FDSGSSYSY+NSQ Y A +  + K+L+GKPL+EA DD TLP CW+GR+P
Sbjct  252  KGVGIKNLDVIFDSGSSYSYLNSQAYRAIISLIEKDLKGKPLKEAKDDRTLPECWRGRKP  311

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+KYFK   LSF +G R RT FEI P++YLIISSKG+ CLG+LNGTE GL N N
Sbjct  312  FKSVHDVRKYFKPLGLSFHHGQRVRTQFEIPPDAYLIISSKGNACLGILNGTEIGLQNVN  371

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SMQD+MVIYDNEK AIGW+ ANC RPP  N   +
Sbjct  372  LIGDISMQDKMVIYDNEKGAIGWSPANCSRPPKSNTFIM  410



>ref|XP_006412352.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
 dbj|BAJ34094.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53805.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
Length=424

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  261  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  320

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  321  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  380

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  381  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  410



>ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>emb|CDX68982.1| BnaC01g04710D [Brassica napus]
Length=430

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  267  RTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYVLKRELSGKPLKEARDDHTLPLCWQGRRP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  327  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTEIGLQNMN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  387  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  416



>ref|XP_009121783.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=427

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTEIGLQNMN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>dbj|BAD80835.1| nucellin-like protein [Daucus carota]
Length=426

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S+G+KN+ VVFDSGSSY+Y N+Q Y+  L  + K+L GKPL+EA +D TLP CW+G++P
Sbjct  268  RSSGLKNLLVVFDSGSSYTYFNTQTYQTLLSFIKKDLHGKPLKEAVEDDTLPVCWRGKKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D KKYFK  ALSF +GW++++ FEI  ESYLIISSKGSVCLG+LNGTE GL NYN
Sbjct  328  FKSIRDAKKYFKPLALSFGSGWKTKSQFEIQQESYLIISSKGSVCLGILNGTEVGLQNYN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQ+++VIYDNEK  IGW  +NCDRPP
Sbjct  388  IIGDISMQEKLVIYDNEKQVIGWQPSNCDRPP  419



>dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana]
Length=413

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  252  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  311

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  312  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  371

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  372  LIGDISMQDQMIIYDNEKQSIGWMPVDCDE  401



>ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWMPVDCDE  413



>emb|CDX75359.1| BnaA01g03430D [Brassica napus]
Length=429

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  +FDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  266  RTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F +I +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  326  FMNIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISRKGNVCLGILNGTEIGLQNMN  385

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  386  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  415



>ref|XP_006282959.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
 gb|EOA15857.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
Length=425

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GK L+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKALKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>ref|XP_011099684.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=422

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG KN+ V+FDSGSSY+Y +S  Y   L  + KELR   LREA DD TLPFCWKG++P
Sbjct  264  KSTGFKNLNVIFDSGSSYTYFSSHIYHTLLSLINKELRRTSLREATDDHTLPFCWKGKKP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S  DV+KYFK  +LSF NGWR++  FEI PE YLIISSKG+ CLG+LNGT+ GL N+N
Sbjct  324  FKSTRDVRKYFKPLSLSFPNGWRAKAQFEIPPEGYLIISSKGNACLGILNGTDVGLSNFN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            +IGD+SMQD+M+IYDNEK+ IGWT ANCD+ P  N V
Sbjct  384  MIGDISMQDKMLIYDNEKHVIGWTPANCDQRPTSNSV  420



>ref|XP_010432554.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F +I +VKKYFK  ALSF   WRS++LFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>ref|XP_010437756.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F +I +VKKYFK  ALSF   WRS++LFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  FMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>gb|EYU20602.1| hypothetical protein MIMGU_mgv1a007047mg [Erythranthe guttata]
Length=422

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG KN+ V+FDSGSSY+Y NSQ Y   +  + KEL GK L+EA DD TLPFCWKG++P
Sbjct  265  KSTGFKNLNVIFDSGSSYTYFNSQIYHTLISLIKKELSGKSLKEASDDRTLPFCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++  DV+KYFKS +LSF NGWR++  F+I PE YLIISSKG+ CLG+LNGT+ GL N+N
Sbjct  325  FKTTRDVRKYFKSLSLSFVNGWRTKAQFDIPPEGYLIISSKGNACLGILNGTDVGLSNFN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD++++YDNEK  IGWT ANCD+ P
Sbjct  385  MIGDISMQDKLLVYDNEKQVIGWTPANCDQIP  416



>gb|KJB40494.1| hypothetical protein B456_007G066800 [Gossypium raimondii]
Length=426

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ V+FDSGSSY+Y+NSQ Y+A    + KEL G+ L+EA +D TLP CWKGR+P
Sbjct  266  KATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELSGRSLKEAPEDQTLPLCWKGRKP  325

Query  451  FRSISDVKKYFK-SFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            FRS+ D KKYFK S AL+FAN  R +T FE+ PE+YLIIS+KG+VCLG+LNGT+ GL N 
Sbjct  326  FRSVHDAKKYFKTSLALAFANSGRRKTQFELHPEAYLIISNKGNVCLGILNGTQVGLQNL  385

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NVIGD+SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  386  NVIGDISMQDRMVVYDNEKQVIGWSPANCDHLP  418



>ref|XP_002310541.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
 gb|EEE90991.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
Length=430

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+ V FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA DD TLP CWKGR+P
Sbjct  272  KTTGFKNLIVAFDSGASYTYLNSQVYQGLISLIKRELSTKPLREALDDQTLPICWKGRKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKKYFK+FALSFAN  +S+T  E  PE+YLI+SSKG+ CLGVLNGTE GL++ N
Sbjct  332  FKSVRDVKKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNACLGVLNGTEVGLNDLN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            VIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  392  VIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPKSRSIII  430



>ref|XP_010527074.1| PREDICTED: aspartic proteinase Asp1-like [Tarenaya hassleriana]
Length=420

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ VVFDSGSSY+Y NS+ Y+A  Y + +EL GKPL EA DD TLP CW+GRR 
Sbjct  259  KTTGLKNLLVVFDSGSSYTYFNSKAYQAVTYLLRRELSGKPLTEARDDHTLPLCWQGRRR  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  + SF  GWRS++LFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  319  FSSIGEVKKYFKPLSFSFKTGWRSKSLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  378

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IGDVSMQD+MVIYDNEK +IGW  ANC+
Sbjct  379  LIGDVSMQDQMVIYDNEKQSIGWMPANCN  407



>gb|ABK95151.1| unknown [Populus trichocarpa]
Length=393

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA DD TLP CWKGR+P
Sbjct  235  KTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPLCWKGRKP  294

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ CLG+LNGTE GL++ N
Sbjct  295  FKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTEVGLNDLN  354

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  355  VIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  386



>ref|XP_002307058.2| nucellin family protein [Populus trichocarpa]
 gb|EEE94054.2| nucellin family protein [Populus trichocarpa]
Length=394

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA DD TLP CWKGR+P
Sbjct  236  KTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPLCWKGRKP  295

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ CLG+LNGTE GL++ N
Sbjct  296  FKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTEVGLNDLN  355

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  356  VIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  387



>ref|XP_006382886.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
 gb|ERP60683.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
Length=393

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA DD TLP CWKGR+P
Sbjct  235  KTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREALDDQTLPLCWKGRKP  294

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ CLG+LNGTE GL++ N
Sbjct  295  FKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNACLGILNGTEVGLNDLN  354

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  355  VIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  386



>ref|XP_010447234.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  264  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
              +I +VKKYFK  ALSF   WRS++LFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  324  LMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  384  LIGDISMQDQMIIYDNEKQSIGWFPADCDE  413



>ref|XP_007048530.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92687.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VKN+ VVFDSGSSY+Y+NSQ Y+     + KEL G+ L+EA +D TLP CWKGR+P
Sbjct  263  KATSVKNLIVVFDSGSSYTYLNSQAYQTLTVLLKKELSGRSLKEAPEDQTLPLCWKGRKP  322

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKKYFK+ AL+FA+  R++T FE+ PE+YLIIS+KG+VCLG+LNGT+ GL N N
Sbjct  323  FKNVRDVKKYFKTLALAFASSSRTKTQFELPPEAYLIISNKGNVCLGILNGTQVGLQNLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDRMVIYDNEK  IGW  ANCD+ P
Sbjct  383  VIGDISMQDRMVIYDNEKQVIGWAPANCDQLP  414



>ref|XP_010025734.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62453.1| hypothetical protein EUGRSUZ_H05088 [Eucalyptus grandis]
Length=436

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG KNM +VFDSGSSY+Y +SQ Y+A    V KEL  KP  EA DDPTLP CW+G++P
Sbjct  278  KPTGQKNMFLVFDSGSSYTYFSSQAYQALSSDVKKELSRKPFTEALDDPTLPLCWRGKKP  337

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I DV KYFK FALSF +G R++T FE+ PESYLIISSKG+VC+GVLNGT+AGL N N
Sbjct  338  FKNIRDVTKYFKPFALSFNSGGRTKTQFEVLPESYLIISSKGNVCMGVLNGTQAGLQNMN  397

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQD+MVIYDNE+  +GW   +C RPP
Sbjct  398  VIGDISMQDKMVIYDNERQLLGWESKDCSRPP  429



>ref|XP_006380399.1| nucellin family protein [Populus trichocarpa]
 gb|ERP58196.1| nucellin family protein [Populus trichocarpa]
Length=387

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG  N+ V FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA DD TLP CWKGR+P
Sbjct  229  KTTGFINLIVAFDSGASYTYLNSQAYQGLISLIKRELSTKPLREALDDQTLPICWKGRKP  288

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV KYFK+FALSFAN  +S+T  E  PE+YLI+SSKG+ CLGVLNGTE GL++ N
Sbjct  289  FKSVHDVNKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNACLGVLNGTEVGLNDLN  348

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            VIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  349  VIGDISMQDRVVIYDNEKQLIGWAPRNCDRIPKSRSIII  387



>gb|EPS67652.1| hypothetical protein M569_07122 [Genlisea aurea]
Length=401

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG KN+ VVFDSGSSY+Y  S  Y+A +  + K+L GKPL    +D TLP CWKG++P
Sbjct  242  RSTGFKNLNVVFDSGSSYTYFTSHIYQAVVSMITKDLNGKPLTAEPEDQTLPMCWKGKKP  301

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FR+  DVKKYFK+ A +F NGWRS+  F+++PE YL++SSKG+ CLG+LNGT  GL N+N
Sbjct  302  FRTTRDVKKYFKTLAFAFPNGWRSKASFDVTPEGYLVVSSKGNACLGILNGTSVGLENFN  361

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+SMQD+MVIYDNEK  IGWT ANCD+
Sbjct  362  VIGDISMQDKMVIYDNEKQMIGWTAANCDQ  391



>gb|KDP24798.1| hypothetical protein JCGZ_25323 [Jatropha curcas]
Length=424

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG++N+ V FDSGSSY+Y+NSQ Y   LYS+   L GKPL E  D  TLP CWKG++P
Sbjct  268  KSTGIQNLLVAFDSGSSYTYLNSQAYRGLLYSLRTALSGKPLSEVPDQ-TLPVCWKGKKP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKKYFKSFAL FAN  R+RT FE  PE+YLIISSKG+ CLG+LNGT+ GL + N
Sbjct  327  FKSLRDVKKYFKSFALGFANSGRARTHFEFPPEAYLIISSKGNACLGILNGTQIGLRDLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDRM+IY+NEK  IGW  ANC+R P
Sbjct  387  VIGDISMQDRMMIYNNEKQVIGWAPANCERLP  418



>emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana]
 emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana]
Length=420

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 122/167 (73%), Gaps = 17/167 (10%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  242  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  301

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS-----------------SKGS  323
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS                  KG+
Sbjct  302  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISVWFSHTMLKGRFIKMLQMKGN  361

Query  322  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  362  VCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  408



>ref|XP_011031099.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
 ref|XP_011016209.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=432

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+   FDSG+SY+Y+NSQ Y+  +  + KEL GKPL+EA +D TLP CWKGR+P
Sbjct  271  KTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLKEALNDRTLPLCWKGRKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ CLG+LNGTE GL++ N
Sbjct  331  FKSIRDVKKYFKTFALSFKNERKSKTELEFPPEAYLIISSKGNACLGILNGTEVGLNDLN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW   NC+R P
Sbjct  391  VIGDISMQDRVVIYDNEKERIGWAPGNCNRLP  422



>gb|KGN62238.1| hypothetical protein Csa_2G338820 [Cucumis sativus]
Length=387

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+GR+P
Sbjct  229  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRGRKP  288

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  289  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTDVGLENSN  348

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  349  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  384



>ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
 emb|CBI21613.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T  KN+ V FDSGSSY+Y+NS  Y+A ++ V KEL  KP+REA DD TLP CW+G+RP
Sbjct  268  KTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELSEKPVREALDDQTLPLCWRGKRP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK+FK  ALSF  G R++T ++I  ESYLIIS KG+VCLG+LNGTEAGL ++N
Sbjct  328  FKSVRDVKKFFKPLALSFPGGGRTKTQYDIPLESYLIISLKGNVCLGILNGTEAGLQDFN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  388  LIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  419



>ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Cucumis sativus]
Length=418

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+GR+P
Sbjct  260  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRGRKP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  320  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTDVGLENSN  379

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  380  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>ref|XP_008227592.1| PREDICTED: aspartic proteinase Asp1 [Prunus mume]
Length=435

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG +N+ +VFDSGSSY+Y+NSQ Y+     + +EL GKPL+EA DD TLP CWKGR+P
Sbjct  276  KSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELTGKPLKEALDDKTLPLCWKGRKP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FR+I DVK YFK  AL FA+G +  T FE+ PE+YLIISSKG+VCLG+LNG+E GL N N
Sbjct  336  FRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLIISSKGNVCLGILNGSEVGLQNSN  395

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  396  IIGDISMQDKMVIYDNEKQMIGWGPGNCDQLP  427



>ref|XP_007211687.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
 gb|EMJ12886.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
Length=435

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG +N+ +VFDSGSSY+Y+NSQ Y+     + +EL GKPL+EA DD TLP CWKGR+P
Sbjct  276  KSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELTGKPLKEALDDRTLPLCWKGRKP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FR+I DVK YFK  AL FA+G +  T FE+ PE+YLIISSKG+VCLG+LNG+E GL N N
Sbjct  336  FRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLIISSKGNVCLGILNGSEVGLQNSN  395

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  396  IIGDISMQDKMVIYDNEKQMIGWGPGNCDKLP  427



>ref|XP_002522918.1| nucellin, putative [Ricinus communis]
 gb|EEF39461.1| nucellin, putative [Ricinus communis]
Length=433

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG++N+ VVFDSGSSY+Y+N+Q Y+  ++S+ +EL  KP+ EA DD TLP CWKG+RP
Sbjct  273  KSTGIRNLLVVFDSGSSYTYLNAQAYQHLVFSLKRELSRKPISEALDDQTLPLCWKGKRP  332

Query  451  FRSISDVKKYFKSFALSF--ANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHN  278
            F+SI DVKKYFK FAL F  ++G  S+T FE SPE+YLIISSKG+ CLG+LNGTE GL +
Sbjct  333  FKSIRDVKKYFKPFALVFKTSSGRSSKTQFEFSPEAYLIISSKGNACLGILNGTEVGLRD  392

Query  277  YNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             NVIGDVSM DR+VIY+NEK  IGW  A+CDR P
Sbjct  393  LNVIGDVSMLDRLVIYNNEKQMIGWAAASCDRLP  426



>ref|XP_011022861.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Populus euphratica]
Length=429

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG KN+ V FDSG+SY+Y+NSQ Y+  +  + +EL  K L EA DD TLP CWKGR+P
Sbjct  271  KSTGFKNLIVAFDSGASYTYLNSQAYQGVISLIKRELSTKSLSEALDDRTLPICWKGRKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D+KKYFK+FALSF NG +S+T  E  PE+YLI+SSKG+ CLG+LNGTE  L++ N
Sbjct  331  FKSVRDIKKYFKTFALSFMNGGKSKTQLEFPPEAYLIVSSKGNACLGILNGTEVHLNDLN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            VIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  391  VIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=418

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+GR+P
Sbjct  260  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRGRKP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  320  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMIISSMGNVCLGILNGTDVGLENSN  379

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  380  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>ref|XP_008460824.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Cucumis melo]
Length=391

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+ R+P
Sbjct  233  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRERKP  292

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  293  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTDVGLENSN  352

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  353  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  388



>ref|XP_008460823.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=429

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+ R+P
Sbjct  271  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRERKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  331  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTDVGLENSN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  391  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  426



>ref|XP_008460822.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=433

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL GKPLREA DD TLP CW+ R+P
Sbjct  275  RSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELAGKPLREAMDDDTLPLCWRERKP  334

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+IISS G+VCLG+LNGT+ GL N N
Sbjct  335  IKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMIISSMGNVCLGILNGTDVGLENSN  394

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  164
            +IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  395  IIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  430



>ref|XP_009350136.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL GKPL+EA DD TLP CWKGR+P
Sbjct  270  KSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELTGKPLKEAPDDGTLPLCWKGRKP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  AL F +G +    +E+ PE+YLI+SSKG+VCLG+LNGTE GL + N
Sbjct  330  FKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTEVGLQDNN  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  158
            +IGD+SMQD+MVIYDNEK  IGW   NCD  P P   F
Sbjct  390  IIGDISMQDKMVIYDNEKQMIGWAPGNCDHLPKPRSSF  427



>ref|XP_011022860.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=429

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG KN+ + FDSG+SY+Y+NSQ Y+  +  +  EL  K L EA DD TLP CWKG +P
Sbjct  271  KTTGFKNLIIAFDSGASYTYLNSQAYQGLISLIKGELSKKFLSEALDDHTLPICWKGWKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ DVKKYFK+FALSF NG +S+T  E  PE+YLIISSKG+ CLG+LNGTE GL++ N
Sbjct  331  FESVRDVKKYFKTFALSFMNGGKSKTQLEFPPEAYLIISSKGNACLGILNGTEVGLNDLN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            VIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  391  VIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera]
Length=424

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T  KN+ V FDSGSSY+Y+NS  Y+A ++ V KEL  KP+REA DD TLP CW+G+RP
Sbjct  268  KTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELSEKPVREALDDQTLPLCWRGKRP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+K+FK  ALSFA G R++T ++I  ESYLIIS  G+VCLG+LNGTEAGL ++N
Sbjct  328  FKSVRDVRKFFKPLALSFAGGGRTKTQYDIPLESYLIIS--GNVCLGILNGTEAGLQDFN  385

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  386  LIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  417



>ref|XP_010547875.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=425

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ V FDSGSSY+Y NS+ Y A    + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  261  KTTGLKNLLVAFDSGSSYTYFNSKAYHAVTNLLKRELSGKPLKEARDDSTLPLCWQGRRP  320

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F ++ + KKYF+  ++SF  GWRS++L+EI PE+YLIIS++G+VCLG+LNGTE GL N N
Sbjct  321  FLNVDEAKKYFRPLSVSFKTGWRSKSLYEIPPEAYLIISTEGNVCLGILNGTEIGLENVN  380

Query  271  VIGDVSMQDRMVIYDNEKNAIGW  203
            +IGD+SMQD+MVIYDNEK+AIGW
Sbjct  381  LIGDISMQDQMVIYDNEKHAIGW  403



>ref|XP_010111255.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXC30733.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=432

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+KN+  VFDSGSSY+Y+ SQ Y+   + + +EL  K LREA DD TLP CWKG+RP
Sbjct  273  KPTGLKNLLTVFDSGSSYTYLTSQAYQTLTFLIKRELPRKVLREATDDQTLPLCWKGKRP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+ +SDV+KYFK  AL F  G +++T +E+ PE+YLI+SSKG+VCLG+LNG+E GL N N
Sbjct  333  FKRVSDVRKYFKPLALDFTTGGKTKT-YELPPEAYLIVSSKGNVCLGILNGSEIGLQNSN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK  IGW  ANCD+ P
Sbjct  392  IIGDISMQDKMVIYDNEKQMIGWASANCDKLP  423



>ref|XP_008361087.1| PREDICTED: aspartic proteinase Asp1-like [Malus domestica]
Length=430

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG+ N+ +VFDSGSSY+Y++SQ Y+     + +EL GKPL+EA DD TLP CWKGR+P
Sbjct  270  KSTGIGNLRMVFDSGSSYTYLSSQVYQFLTSWLKRELTGKPLKEAPDDRTLPLCWKGRKP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  AL F +G +    +E+ PE+YLI+SS G+VCLG+LNGTE GL  YN
Sbjct  330  FKSIRDVKKYFKPLALRFNSGRKDTAQYELPPEAYLILSSMGNVCLGILNGTEVGLQXYN  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  158
            +IGD+SMQD+MVIYDNEK  IGW    CD  P P   F
Sbjct  390  IIGDISMQDKMVIYDNEKQMIGWAPGKCDHLPKPRSSF  427



>ref|XP_006464925.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=436

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+EA +D TLP CWKG+RP
Sbjct  279  KTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLKEAPEDRTLPLCWKGKRP  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKKYFK+ ALSF +G ++RTLFE++PE+YLIIS++G+VCLG+LNG E GL + N
Sbjct  339  FKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGNVCLGILNGAEVGLQDLN  397

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  398  VIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>ref|XP_010674354.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674355.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TGV+N+ V+FDSGSSY+Y  S+ Y   +  + ++L    L++A DD TLP CWKGRRP
Sbjct  235  RTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKDATDDDTLPVCWKGRRP  294

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  ALSF +G R  + ++I PE+YLIIS KG+VCLG+LNGTE GL NYN
Sbjct  295  FKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNVCLGILNGTEVGLQNYN  354

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  355  IIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  393



>ref|XP_006432088.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
 gb|ESR45328.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
Length=451

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+EA +D TLP CWKG+RP
Sbjct  294  KTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLKEAPEDRTLPLCWKGKRP  353

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKKYFK+ ALSF +G ++RTLFE++PE+YLIIS++G+VCLG+LNG E GL + N
Sbjct  354  FKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGNVCLGILNGAEVGLQDLN  412

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  413  VIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  444



>gb|KDO52221.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
 gb|KDO52222.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
Length=436

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ VVFDSGSSY+Y++   Y+     + +EL  K L+EA +D TLP CWKG+RP
Sbjct  279  KTTGLKNLPVVFDSGSSYTYLSHVAYQTLTSMMKRELSAKSLKEAPEDRTLPLCWKGKRP  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKKYFKS ALSF +G ++RTLFE++ E+YLIIS++G+VCLG+LNG E GL + N
Sbjct  339  FKNVRDVKKYFKSLALSFTDG-KTRTLFELTTEAYLIISNRGNVCLGILNGAEVGLQDLN  397

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  398  VIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>ref|XP_010674353.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TGV+N+ V+FDSGSSY+Y  S+ Y   +  + ++L    L++A DD TLP CWKGRRP
Sbjct  279  RTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKDATDDDTLPVCWKGRRP  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  ALSF +G R  + ++I PE+YLIIS KG+VCLG+LNGTE GL NYN
Sbjct  339  FKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNVCLGILNGTEVGLQNYN  398

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  399  IIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  437



>ref|XP_009355861.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL  KPL+EA DD TLP CWKGR+P
Sbjct  270  KSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELTEKPLKEAPDDGTLPLCWKGRKP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  AL F +G +    +E+ PE+YLI+SSKG+VCLG+LNGTE GL + N
Sbjct  330  FKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTEVGLQDNN  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  390  IIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  421



>ref|XP_006432093.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 ref|XP_006464929.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Citrus sinensis]
 gb|ESR45333.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=408

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  251  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  310

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  311  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  369

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  370  VIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  401



>ref|XP_009355862.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=428

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG  N+ +VFDSGS+Y+Y++SQ Y+     + +EL  KPL+EA DD TLP CWKGR+P
Sbjct  268  KSTGFGNLHMVFDSGSTYTYLSSQVYQFLTSWLKRELTEKPLKEAPDDGTLPLCWKGRKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVKKYFK  AL F +G +    +E+ PE+YLI+SSKG+VCLG+LNGTE GL + N
Sbjct  328  FKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLILSSKGNVCLGILNGTEVGLQDNN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  388  IIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  419



>ref|XP_006464928.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=427

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  270  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  330  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  388

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  389  VIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  420



>ref|XP_006432092.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 gb|ESR45332.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=453

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  296  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  355

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  356  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  414

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  415  VIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  446



>ref|XP_006464927.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=459

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  302  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  361

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  362  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  420

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  421  VIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  452



>gb|AFK47184.1| unknown [Lotus japonicus]
Length=245

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+  +  VFD+GSSY+Y NS  Y+A +  + KEL GKPL+EA DD TLP CW G+RP
Sbjct  87   KKTGIGGLLPVFDTGSSYTYFNSNAYQAVISWLKKELAGKPLKEAPDDQTLPLCWHGKRP  146

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRS+ +V+KYFKS ALSF +  R+ T FEI PE+YLI+S+ G+VCLG+L+G+E G+ + N
Sbjct  147  FRSVYEVRKYFKSMALSFTSSGRTNTQFEIPPEAYLIVSNMGNVCLGILDGSEVGMGDLN  206

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+++++DNEK  IGW  A+C+R P
Sbjct  207  LIGDISMLDKVMVFDNEKRLIGWAPADCNRVP  238



>ref|XP_009393816.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GVK   VVFD+GS+Y+Y   QPY+A L +V  +L   PL+E  DDP+L  CW+G++P
Sbjct  261  RSLGVKQKEVVFDTGSTYTYFGFQPYQAFLSAVKSDLSKTPLKEVSDDPSLSVCWRGQKP  320

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S++DVK+YFK+ ALSF N    RTL E+ PE+YLII+  G+ CLG+L+GTE GL N N
Sbjct  321  FKSVNDVKQYFKTLALSFVNA--KRTLLEVPPENYLIITQHGNACLGILDGTEVGLGNLN  378

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+QD  V+YDNE+  IGW RA CDRPP
Sbjct  379  VIGDISLQDLTVVYDNERQQIGWVRAACDRPP  410



>ref|XP_009420564.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 117/155 (75%), Gaps = 3/155 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV  M VVFD+GS+++Y   QPY+A L +V  +L  KPL+E  DDPTLP CWKG + 
Sbjct  276  RSLGVNQMEVVFDTGSTFTYFGFQPYQAFLSAVKSDLSKKPLKEEFDDPTLPVCWKGPKA  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH-NY  275
            F+S+ DVKKYFK+ AL+F NG  +R L E+ PE+YLII+  G+ CLG+LNGTEAGL+ + 
Sbjct  336  FKSVKDVKKYFKTLALNFVNG--NRALLEVPPENYLIITKHGNACLGILNGTEAGLNKDL  393

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  170
            N+IGD+SMQDRMV+YDNE+  IGW +  CDR P P
Sbjct  394  NIIGDISMQDRMVVYDNERQHIGWVQIGCDRLPKP  428



>ref|XP_007159874.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
 gb|ESW31868.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
Length=431

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGV ++  VFD+GSSYSY NS+ Y+A L  + K+L GKPL+ A DD TLP CW GRRP
Sbjct  273  RKTGVGSLTAVFDTGSSYSYFNSRAYQALLSWLKKDLTGKPLKAAPDDQTLPLCWHGRRP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI +V++YFK  AL+F NG R +  FEI+PE+YLIIS+ G+VCLG+LNG+E GL   N
Sbjct  333  FKSIREVRRYFKPVALTFNNGGRVKAQFEIAPEAYLIISNLGNVCLGILNGSEIGLEELN  392

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD++++++NEKN IGW  A C R P
Sbjct  393  LIGDISMQDKVMVFENEKNLIGWGPAECSRVP  424



>gb|KHN20145.1| Aspartic proteinase Asp1 [Glycine soja]
Length=452

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK L+ A DDP+LP CWKG + 
Sbjct  270  KATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQLKRATDDPSLPICWKGAKS  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+S+SDVKKYFK  ALSF    +++ L   + PE+YLII+  G+VCLG+L+GTE GL N 
Sbjct  330  FKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITKHGNVCLGILDGTEVGLENL  386

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  387  NIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>gb|AAG51657.1|AC010704_1 nucellin-like protein; 27671-25467 [Arabidopsis thaliana]
Length=427

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +  DD +LP CWKG++P
Sbjct  268  KTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPVCWKGKKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VCLG+LNGTE GL  YN
Sbjct  328  LKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTEIGLEGYN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  158
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  387  IIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  424



>ref|NP_177872.3| aspartyl protease [Arabidopsis thaliana]
 gb|AEE35983.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=432

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +  DD +LP CWKG++P
Sbjct  273  KTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPVCWKGKKP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VCLG+LNGTE GL  YN
Sbjct  333  LKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTEIGLEGYN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  158
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  392  IIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  429



>ref|XP_006596210.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Glycine 
max]
Length=452

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK L+ A DDP+LP CWKG + 
Sbjct  270  KATVVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQLKRATDDPSLPICWKGAKS  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+S+SDVKKYFK  ALSF    +++ L   + PE+YLII+  G+VCLG+L+GTE GL N 
Sbjct  330  FKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITKHGNVCLGILDGTEVGLENL  386

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  387  NIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>ref|NP_850981.1| aspartyl protease [Arabidopsis thaliana]
 gb|AAL32740.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AAN65112.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE35984.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=466

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +  DD +LP CWKG++P
Sbjct  273  KTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPVCWKGKKP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VCLG+LNGTE GL  YN
Sbjct  333  LKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVCLGILNGTEIGLEGYN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  167
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  392  IIGDISFQGIMVIYDNEKQRIGWISSDCDKLPNVN  426



>gb|KHN20610.1| Aspartic proteinase Asp1 [Glycine soja]
Length=454

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + ++FDSGSSY+Y NSQ Y+A +  V K+L+GK L+ A DDP+LP CWKG + 
Sbjct  270  KATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTKDLKGKQLKRATDDPSLPICWKGAKS  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+SDVKKYFK  ALSF      +    + PESYLII+  G+VCLG+L+GTE GL N N
Sbjct  330  FESLSDVKKYFKPLALSFKKIMNLQ--MHLPPESYLIITKHGNVCLGILDGTEVGLENLN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+++QD+MVIYDNEK  IGW  +NCDR P
Sbjct  388  IIGDITLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>gb|AES72936.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=445

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG  N+  VFD+GSSY+Y NS  Y+A +  + KEL GKP++EA +D TLP CW G+RP
Sbjct  287  KRTGFGNLLAVFDAGSSYTYFNSNAYQALISWLTKELAGKPIKEAPEDQTLPLCWYGKRP  346

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRS+ +VKKYFK  ALSF    RS+  FEI PE+YLIIS+ G+VCLG+L+G+E G+ + N
Sbjct  347  FRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMGNVCLGILDGSEVGVEDLN  406

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  407  LIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  445



>ref|XP_003532363.2| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN16936.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL GKPL+ A DD TLP CW G+RP
Sbjct  273  RKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLKKELSGKPLKVAPDDQTLPLCWHGKRP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ +V+KYFK  AL F NG R++  FEI PE+YLIIS+ G+VCLG+LNG+E GL   N
Sbjct  333  FTSLREVRKYFKPVALGFTNGGRTKAQFEILPEAYLIISNLGNVCLGILNGSEVGLEELN  392

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SMQD++++++NEK  IGW  A+C R P    V I
Sbjct  393  LIGDISMQDKVMVFENEKQLIGWGPADCSRIPKSGDVSI  431



>ref|XP_009404862.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G K + VV D+GS+++Y  S PY+A L +V  +L   PL E  DD  LP CWKG++P
Sbjct  281  QSLGAKQIEVVLDTGSTFTYFESHPYQAFLSAVKSDLSKTPLIEEFDDSALPVCWKGQKP  340

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+SDVKKYFK+ AL F  G   R L E+SPE+YLII+  G+ CLG+LNG+EAGL N N
Sbjct  341  FKSVSDVKKYFKTLALDFVKG--KRALLELSPENYLIITKHGNACLGILNGSEAGLRNLN  398

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+QD MV+YDNEK  IGW RA C+R P
Sbjct  399  VIGDISLQDHMVVYDNEKQHIGWVRAACNRLP  430



>ref|XP_010027413.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=435

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 114/156 (73%), Gaps = 4/156 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG KN+ +VFDSGS+Y+Y +S+ Y A   SV +ELR K   EA DD TLP CWKGR+P
Sbjct  273  KPTGQKNLLLVFDSGSTYTYFSSKAYRALSLSVDEELRRKHFTEAVDDRTLPLCWKGRKP  332

Query  451  FRSISDVKKYFKSFALSFA----NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGL  284
            F++I DV KYFK FALSFA    +G R++  FE+ PESYLIIS KG+VC+GVLNGTE G 
Sbjct  333  FKNIGDVTKYFKPFALSFALSFNSGGRAQNQFEVPPESYLIISDKGNVCMGVLNGTEVGF  392

Query  283  HNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  393  QNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  428



>gb|KCW62450.1| hypothetical protein EUGRSUZ_H05085 [Eucalyptus grandis]
Length=238

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 4/156 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG +N+ ++FDSGS+++Y +S+ Y+A    V +ELR K   EA DD TLP CWKG++P
Sbjct  76   KPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEELRRKDFAEAVDDDTLPLCWKGQKP  135

Query  451  FRSISDVKKYFKSFALSFA----NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGL  284
            F++I DV KYFK FALSFA    +G R++  FE+ PESY IIS KG+VC+GVLNGTE G 
Sbjct  136  FKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPPESYFIISDKGNVCMGVLNGTEVGF  195

Query  283  HNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  196  QNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  231



>ref|XP_010463205.1| PREDICTED: aspartic proteinase Asp1-like, partial [Camelina sativa]
Length=241

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+ G+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+G PL++A +D TLP CWKG +P
Sbjct  89   KAAGLKGLKLIFDTGSSYTYFNSKTYQTLVKLIENDLKGTPLKDAKEDKTLPVCWKGAKP  148

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YFK+  ++F NG R  T  +I PESYLIIS+ G+VCLG+LNG+E GL + N
Sbjct  149  FKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLGLLNGSEVGLQDSN  207

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  M+IYDNEK  +GW  A+C++ P
Sbjct  208  VIGDISMQGLMMIYDNEKQQLGWVTADCNKLP  239



>ref|XP_002889144.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65403.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL +  DD +LP CWKG++P
Sbjct  274  KTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDTKDDKSLPVCWKGKKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F    ++  LF++ PESYLII+ KG+VCLG+LNGTE GL +YN
Sbjct  334  LKSLDEVKKYFKTITLRFGY-QKNGQLFQVPPESYLIITEKGNVCLGILNGTEVGLDSYN  392

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  167
            ++GD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  393  IVGDISFQGIMVIYDNEKQRIGWISSDCDKIPNVN  427



>ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AET04824.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=435

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++ A DD TLP CW G+RP
Sbjct  277  RKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIKAAPDDQTLPMCWHGKRP  336

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRSI++VKKYFK   LSF NG R +  FEI PE+YLIIS+ G+VCLG+LNG E GL   N
Sbjct  337  FRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGNVCLGILNGPEVGLGELN  396

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+++++DNEK  IGW  A+C+  P
Sbjct  397  LIGDISMLDKVMVFDNEKQLIGWGPADCNSVP  428



>emb|CDX88370.1| BnaC06g38140D [Brassica napus]
Length=460

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++ +D +LP CWK +R 
Sbjct  268  KATGVKGVSFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDSKEDKSLPVCWKDKRA  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+ +L F    ++  +F+I PESYLII+ KG+VCLG+LNGTE GL NYN
Sbjct  328  LKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVCLGILNGTEIGLENYN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  388  IIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>gb|KHN31194.1| Aspartic proteinase Asp1 [Glycine soja]
Length=317

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKPL+EA DD TLP CW+GRRP
Sbjct  159  KKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKPLKEAHDDQTLPLCWRGRRP  218

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRSI +V+KYFK   LSF +  RS+  FE+ PE+YLI+S+ G+VCLG+LNG+E G+ + N
Sbjct  219  FRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNMGNVCLGILNGSEVGMGDLN  278

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  279  LIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  317



>emb|CDX87518.1| BnaA07g33550D [Brassica napus]
Length=461

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++ +D +LP CWK +R 
Sbjct  269  KATGVKGVNFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDSKEDKSLPVCWKDKRG  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+ +L F    ++  +F+I PESYLII+ KG+VCLG+LNGTE GL NYN
Sbjct  329  LKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVCLGILNGTEIGLENYN  388

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  389  IIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  420



>ref|XP_006472808.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=418

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +  ++  LP CWKG +P
Sbjct  267  KSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPVCWKGTKP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVK YFK   LSF           I PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  327  FKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTEVGLENFN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  385  LVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_010532199.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=414

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG K + ++FDSGSSY+Y NS+ Y+  +  +  +L+GKPL++A +D TLP CWKG +P
Sbjct  262  KSTGEKGLDLIFDSGSSYTYFNSKTYQTIVNLITNDLKGKPLKDAKEDRTLPICWKGAKP  321

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D K +FK+  +SF+ GW  +T F+I PESYLI+++ G+VCLG+LNG+E GL N N
Sbjct  322  FKSVLDAKSFFKTLTISFS-GWIRKTQFQIQPESYLIVTT-GNVCLGILNGSEVGLQNAN  379

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  380  VIGDIFMQGTMVIYDNEKQQLGWVSADCDKHP  411



>ref|XP_010243511.1| PREDICTED: aspartic proteinase Asp1 [Nelumbo nucifera]
Length=460

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGVK +  VFDSGSSY+Y NS+ Y+  +  V K+L GKPL+EA DD TLP CWKG +P
Sbjct  277  QHTGVKGLMTVFDSGSSYTYFNSKFYQTFISLVRKDLTGKPLKEARDDQTLPICWKGTKP  336

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVK++FK   LSF+NG  +R   EI PESYLIISS G+ CLG+LNGTE GL + N
Sbjct  337  FKSIRDVKEHFKPLTLSFSNGKNAR--LEILPESYLIISSHGNACLGILNGTEIGLQDIN  394

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD  ++D++VIYDNEK  IGW    C+R P
Sbjct  395  IIGDTLLRDKIVIYDNEKRQIGWIATYCNRLP  426



>emb|CDY41786.1| BnaC02g13700D [Brassica napus]
Length=452

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  +FDSGSSY+Y N++ Y+  L  + K+L+GKPL++  +D +LP CWK  +P
Sbjct  268  KTTGVKGINFIFDSGSSYTYFNAEAYQTILDLIRKDLKGKPLKDTKEDKSLPVCWKDMKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+  L F +  ++  LF+I PESYLII+ KG+VCLG+LNGTE GL NYN
Sbjct  328  LKSVHDVKKYFKTITLRFGS-QKNGQLFQIPPESYLIITEKGNVCLGILNGTEIGLENYN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  387  IIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  418



>ref|XP_006472807.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=458

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +  ++  LP CWKG +P
Sbjct  267  KSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPVCWKGTKP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DVK YFK   LSF           I PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  327  FKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTEVGLENFN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  385  LVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_003524315.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN17403.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL GKPL+ A DD TL  CW G+RP
Sbjct  273  RKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLNKELSGKPLKVAPDDQTLSLCWHGKRP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ +V+KYFK  ALSF NG R +  FEI PE+YLIIS+ G+VCLG+LNG E GL   N
Sbjct  333  FTSLREVRKYFKPVALSFTNGGRVKAQFEIPPEAYLIISNLGNVCLGILNGFEVGLEELN  392

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            ++GD+SMQD++++++NEK  IGW  A+C R P    V I
Sbjct  393  LVGDISMQDKVMVFENEKQLIGWGPADCSRVPKSGDVSI  431



>ref|XP_007137749.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
 gb|ESW09743.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
Length=438

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGV N+  +FD+GSSY+Y NS  Y+  +  + KE  GKPL+EA  D TLP CW G+RP
Sbjct  280  KRTGVGNLHAIFDTGSSYTYFNSNAYQTLISLLRKESGGKPLKEAHGDQTLPLCWHGKRP  339

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI +V+KYFK   LSF++  RS+  FEI PE YLIIS+ G+VCLG+LNG+E G+ + N
Sbjct  340  FKSIYEVRKYFKPITLSFSSNGRSKAQFEIPPEGYLIISNMGNVCLGILNGSEVGMGDLN  399

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM ++++++DN+K  IGWT A+CDR P    V I
Sbjct  400  LIGDISMLNKVMVFDNDKQLIGWTPADCDRVPKSRDVSI  438



>ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=440

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 116/159 (73%), Gaps = 5/159 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG  N+  VFD+GSSY+Y NS  Y+     + KEL GKP++EA +D TLP CW G+RP
Sbjct  287  KRTGFGNLLAVFDAGSSYTYFNSNAYQ-----LTKELAGKPIKEAPEDQTLPLCWYGKRP  341

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRS+ +VKKYFK  ALSF    RS+  FEI PE+YLIIS+ G+VCLG+L+G+E G+ + N
Sbjct  342  FRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMGNVCLGILDGSEVGVEDLN  401

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  402  LIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  440



>ref|XP_006434233.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
 gb|ESR47473.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
Length=459

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L+GKPL +  ++  LP CWKG +P
Sbjct  267  KSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDLKGKPLEDTAEEKALPVCWKGTKP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DV+ YFK   LSF           I PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  327  FKSIQDVEDYFKPLLLSFTK--TKNVHLHIPPEAYLIVTEHGNVCLGILNGTEVGLENFN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  385  LVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_003522473.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=440

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKPL+EA DD TLP CW+GRRP
Sbjct  282  KKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKPLKEAHDDQTLPLCWRGRRP  341

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRSI +V+KYFK   LSF +  RS+  FE+ PE+YLI+S+ G+VCLG+LNG+E G+ + N
Sbjct  342  FRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNMGNVCLGILNGSEVGMGDLN  401

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  402  LIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  440



>ref|XP_007203973.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
 gb|EMJ05172.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
Length=377

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + ++FDSGSSY+Y NSQ Y+A +  V  +L+GKPL++A +D +LP CWKGR+P
Sbjct  218  KATSVKGLNMIFDSGSSYTYFNSQAYQAIVTLVRNDLKGKPLKDATEDQSLPICWKGRKP  277

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+ + D K YFK  ALSF N    +   ++SPE+YLI++  G+VCLG+LNGTE GL N N
Sbjct  278  FKFVRDAKNYFKPLALSFTNAKNVQP--QLSPETYLIVTKHGNVCLGILNGTEVGLGNLN  335

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD++++D+M+IYDNE   IGW   NC+  P    V I
Sbjct  336  IIGDITLRDKMLIYDNENRQIGWAPVNCNMLPKSRTVAI  374



>ref|XP_008219614.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Prunus mume]
Length=420

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E  +D +LP CWKGR+P
Sbjct  269  KSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETSEDKSLPICWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D K +FK  ALSF N        ++SPE YLI+S  G+VCLG+LNG+E GL N N
Sbjct  329  FKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCLGILNGSEVGLGNLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  387  IIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_003528065.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN09648.1| Aspartic proteinase Asp1 [Glycine soja]
Length=438

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K +G+ ++  VFD+GSSY+Y N   Y+A +  + KE  GKPL+EA DD TLP CW+GRRP
Sbjct  280  KKSGIGSLHAVFDTGSSYTYFNPYAYQALISWLGKESGGKPLKEAHDDQTLPLCWRGRRP  339

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRSI +V+KYFK   LSF +  RS+  FE+ PE+YLIIS+ G+VCLG+LNG+E G+ + N
Sbjct  340  FRSIYEVRKYFKPIVLSFTSNGRSKAQFEMPPEAYLIISNMGNVCLGILNGSEVGMGDLN  399

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            +IGD+SM ++++++DN+K  IGWT A+CD+ P    V I
Sbjct  400  LIGDISMLNKVMVFDNDKQLIGWTPADCDQVPKSRDVSI  438



>ref|XP_011458802.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458803.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A DD +LP CWKG +P
Sbjct  264  KPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPDDKSLPICWKGSKP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+ YFK  ALSF N        +ISPE+YLI+S  G+VCLG+LNG+E GL + N
Sbjct  324  FKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLGILNGSEVGLGSMN  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  382  VIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>ref|XP_007223384.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24583.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=420

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E  +D +LP CWKGR+P
Sbjct  269  KSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETNEDKSLPICWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D K +FK  ALSF N        ++SPE YLI+S  G+VC G+LNG+E GL N N
Sbjct  329  FKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCFGILNGSEVGLENLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  387  IIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>gb|EMT17342.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=148

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -3

Query  610  MXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDV  431
            M VV DSGSS++Y ++QPY+A L + +K    K L+E  D P+LP CWKG++PF+S+ DV
Sbjct  1    MEVVLDSGSSFTYFSAQPYQA-LVTALKGDLSKTLKEVSD-PSLPLCWKGKKPFKSVLDV  58

Query  430  KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  251
            KK FKS  L+FANG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N++GD++M
Sbjct  59   KKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEIGLKDLNIVGDITM  116

Query  250  QDRMVIYDNEKNAIGWTRANCDRPP  176
            QD+MVIYDNE+  IGW RA CDR P
Sbjct  117  QDQMVIYDNERGQIGWIRAPCDRIP  141



>ref|XP_004977228.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Setaria 
italica]
Length=390

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP CWKG++P
Sbjct  206  RSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPLCWKGKKP  263

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  264  FKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  321

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            ++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  322  ILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  358



>ref|XP_010479040.1| PREDICTED: aspartic proteinase Asp1 [Camelina sativa]
Length=410

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL++A +D TLP CWKG +P
Sbjct  258  KPTGLKGLKLIFDTGSSYTYFNSKTYQTIVKLIETDLKATPLKDAKEDKTLPICWKGAKP  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YFK+  ++F NG R  T  +I PESYLIIS+ G+VCLG+LNG+E GL + N
Sbjct  318  FKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLGLLNGSEVGLQDSN  376

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  +GW  A+C++ P
Sbjct  377  VIGDISMQGLMVIYDNEKQQLGWVTADCNKLP  408



>ref|XP_008219613.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Prunus mume]
Length=451

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E  +D +LP CWKGR+P
Sbjct  269  KSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETSEDKSLPICWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D K +FK  ALSF N        ++SPE YLI+S  G+VCLG+LNG+E GL N N
Sbjct  329  FKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCLGILNGSEVGLGNLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  387  IIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_004503902.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=437

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + +G  N+ ++FD+GSSY+Y NSQ Y+  +  + KEL  KP++ A DD TLP CW G++P
Sbjct  279  RKSGAGNLNIIFDTGSSYTYFNSQAYQVLISLLSKELNRKPIKAAPDDQTLPICWHGKKP  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I++VKKYFK  ALSF  G R +  FEI PE+YLIIS+ G+VCLG+LNG E GL   N
Sbjct  339  FKNINEVKKYFKPLALSFTKGGRVKPQFEIPPEAYLIISNMGNVCLGILNGFEVGLGELN  398

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SM ++++++DNEK  IGW  A+C+R P
Sbjct  399  VIGDISMLEKVMVFDNEKQLIGWGAADCNRDP  430



>ref|XP_004290889.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A DD +LP CWKG +P
Sbjct  264  KPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPDDKSLPICWKGSKP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+ YFK  ALSF N        +ISPE+YLI+S  G+VCLG+LNG+E GL + N
Sbjct  324  FKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLGILNGSEVGLGSMN  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  382  VIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>ref|XP_007223385.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24584.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=451

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L GKP++E  +D +LP CWKGR+P
Sbjct  269  KSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDLDGKPIKETNEDKSLPICWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D K +FK  ALSF N        ++SPE YLI+S  G+VC G+LNG+E GL N N
Sbjct  329  FKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLIVSKHGNVCFGILNGSEVGLENLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  387  IIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_010025732.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=436

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 4/156 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG +N+ ++FDSGS+++Y +S+ Y+A    V +ELR K   EA DD TLP CWKG++P
Sbjct  274  KPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEELRRKDFAEAVDDDTLPLCWKGQKP  333

Query  451  FRSISDVKKYFKSFALSFA----NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGL  284
            F++I DV KYFK FALSFA    +G R++  FE+ PESY IIS KG+VC+GVLNGTE G 
Sbjct  334  FKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPPESYFIISDKGNVCMGVLNGTEVGF  393

Query  283  HNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  394  QNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  429



>ref|XP_008466731.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=437

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +D +LP CWKG RP
Sbjct  260  KATGIKDLTLVFDSGSSYTYFNSQAYNSILALVRNNLRGKPLEDAPEDKSLPVCWKGPRP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKKYF   AL F    +++   +++PE+YLII+  G+VC G+LNGTE GL N N
Sbjct  320  FKSLHDVKKYFNPLALRFTKTKKAQ--IQLAPEAYLIITKYGNVCFGILNGTEVGLGNLN  377

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  378  IIGDISLKDKMVIYDNERRQIGWFPTNCNK  407



>ref|XP_004502990.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=434

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG  N+  VFD+GSSY+Y NS  Y+A +  + KEL GKP++EA +D TLP CW G+RP
Sbjct  276  KRTGFGNLFAVFDTGSSYTYFNSDAYQALVSWLKKELAGKPIKEAPEDQTLPMCWYGKRP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRS+ +V+KYFK  A SF +  R +  FEI PE+YLIIS+ G+VCLG+LNG+E G+ + N
Sbjct  336  FRSVYEVRKYFKPIAFSFPSSGRMKAQFEIPPEAYLIISNMGNVCLGILNGSEVGMGDLN  395

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+++I+DN+K  IGW   +C+R P
Sbjct  396  LIGDISMLDKVMIFDNDKQLIGWAPTDCNRVP  427



>gb|KHN47012.1| Aspartic proteinase Asp1 [Glycine soja]
Length=395

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A +DP+LP CWKG +P
Sbjct  244  KATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRATEDPSLPICWKGPKP  303

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV   FK   LSF     S  LF++ PE+YLI++  G+VCLG+L+GTE GL N N
Sbjct  304  FKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCLGILDGTEIGLGNTN  361

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  362  IIGDISLQDKLVIYDNEKQQIGWASANCDR  391



>ref|XP_006393742.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
 gb|ESQ31028.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
Length=411

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  EL+GKPL++A +D TLP CWKG +P
Sbjct  259  KPTGLKGLKIIFDTGSSYTYFNSKTYQTIVNLIGNELKGKPLKDAKEDKTLPICWKGAKP  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VK  FK+  ++F N  R  T  +I PESYLIIS  G+VCLG+LNG+E GL + N
Sbjct  319  LKSVLEVKNLFKTLTINFMNS-RRNTQLQIPPESYLIISKTGNVCLGILNGSEIGLQDSN  377

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  IGW  A+CD+ P
Sbjct  378  VIGDISMQGIMVIYDNEKQQIGWVSADCDKLP  409



>ref|XP_003523437.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN47011.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + ++FDSGSSY+Y NSQ ++A +  +  +LRGKPL  A  DP+LP CWKG +P
Sbjct  270  KTTSVKGLELIFDSGSSYTYFNSQAHKALVNLIANDLRGKPLSRATGDPSLPICWKGPKP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV   FK   LSF     S    ++ PE+YLI++  G+VCLG+L+GTE GL N N
Sbjct  330  FKSLHDVTSNFKPLLLSFTKSKNSP--LQLPPEAYLIVTKHGNVCLGILDGTEIGLGNTN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  388  IIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>ref|XP_004142705.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161182.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54551.1| hypothetical protein Csa_4G361850 [Cucumis sativus]
Length=410

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  625  TGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFR  446
             G++ + + FDSGSSY+Y NSQ Y A L  +   L+G+PLR+A +D TLP CWKG + F+
Sbjct  262  VGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKGQPLRDAPEDKTLPICWKGSKAFK  321

Query  445  SISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVI  266
            S++DV+ +FK  ALSF N   S+  F+I PE+YLIIS+ G+VCLG+LNG++ GL N N+I
Sbjct  322  SVADVRNFFKPLALSFGN---SKVQFQIPPEAYLIISNLGNVCLGILNGSQVGLGNVNLI  378

Query  265  GDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            GD+SM D+M++YDNE+  IGW  ANC +PP
Sbjct  379  GDISMLDKMMVYDNERQQIGWAPANCSKPP  408



>ref|XP_004977226.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP CWKG++P
Sbjct  267  RSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            ++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  383  ILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=401

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+  VFDSGSSY+Y NS+ Y+A  Y + +EL GKPL+EA DD TLP CW+GRRP
Sbjct  261  RTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKRELSGKPLKEARDDHTLPLCWQGRRP  320

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLIIS KG+VCLG+LNGTE GL N N
Sbjct  321  FMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLIISMKGNVCLGILNGTEIGLQNLN  380

Query  271  VIG  263
            +IG
Sbjct  381  LIG  383



>ref|XP_004977227.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Setaria 
italica]
Length=422

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E   DP+LP CWKG++P
Sbjct  267  RSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKEV-SDPSLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  383  ILGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_010095410.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB60102.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=458

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K  G+K + V+FDSGSSY+Y NS  YEA +  V K L GKPL++  +D +LP CWKG + 
Sbjct  270  KPAGIKGLEVIFDSGSSYTYFNSPAYEAVVNLVKKSLNGKPLKDTAEDKSLPICWKGNKA  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D KK+F   ALSF N        ++ PE+YLI++  GSVCLG+LNGT+ GL N N
Sbjct  330  FKSVQDAKKFFTPLALSFTN--FKHVQLQLLPEAYLIVTKLGSVCLGILNGTQVGLENLN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGDVS+Q++MVIYDNEK  IGW   NCDR P
Sbjct  388  IIGDVSLQEKMVIYDNEKKQIGWGPVNCDRLP  419



>ref|XP_003523438.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=407

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A +DP+LP CWKG +P
Sbjct  256  KATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRATEDPSLPICWKGPKP  315

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV   FK   LSF     S  LF++ PE+YLI++  G+VCLG+L+GTE GL N N
Sbjct  316  FKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCLGILDGTEIGLGNTN  373

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  374  IIGDISLQDKLVIYDNEKQRIGWASANCDR  403



>ref|XP_010416691.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=457

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL++  +D +LP CWKG++P
Sbjct  268  KTTGVKGIDVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT-EDKSLPVCWKGKKP  326

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  LF++  ESYLII+ KG+VCLG+LNGTE GL +YN
Sbjct  327  MKSLDEVKKYFKTITLRFGN-QKNGQLFQVPSESYLIITEKGNVCLGILNGTEVGLDSYN  385

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  386  IIGDIFFQGIMVIYDNEQHRIGWISTDCDKTP  417



>ref|XP_006302228.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
 gb|EOA35126.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
Length=465

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+L GK L++  +D +LP CWKG++ 
Sbjct  272  KTTGVKGINLVFDSGSSYTYFNAEAYQAILDLIRKDLNGKLLKDTKEDKSLPVCWKGKKA  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI +VKKYFK   L F N  ++  LFE+ PESYLII+ KG+VCLG+LNGTE GL +YN
Sbjct  332  LKSIDEVKKYFKKITLRFGN-QKNGQLFEVPPESYLIITQKGNVCLGILNGTEVGLDSYN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  167
            +IGD+  Q  +VIYDNEK  IGW   +CD+ P  N
Sbjct  391  IIGDIFFQGILVIYDNEKQRIGWIPTDCDKLPKVN  425



>ref|XP_010063407.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Eucalyptus grandis]
 ref|XP_010063408.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Eucalyptus grandis]
 gb|KCW70627.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
 gb|KCW70628.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=418

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A +D +LP CWKG +P
Sbjct  268  KPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAVEDKSLPICWKGAKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ +VK +FK   L+F  G       ++ PE+YLI++  G+ CLG+LNG E  L   N
Sbjct  328  FKSVHEVKNHFKPLQLNFGKG---NAQLQLLPEAYLIVTKHGNACLGILNGGEVRLGELN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  385  LIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_010930726.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G K + VV DSGSSY+Y   QPY+  L ++ ++L  +PL E  DD +LP CWKG +P
Sbjct  278  QSLGSK-LPVVLDSGSSYTYFGFQPYQDFLSAIKRDLSRQPLTETSDDKSLPLCWKGPKP  336

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHN-Y  275
            F+S+ DV KYFK   LSF NG ++R   EI PE+YLI++ KG+ CLG+LNGTE GLH   
Sbjct  337  FKSVLDVIKYFKPLILSFGNGRKAR--MEIPPENYLIVTKKGNACLGILNGTEVGLHQEL  394

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NVIGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  395  NVIGDISLQDLVVIYDNEKQQIGWGRANCDRLP  427



>ref|XP_010063406.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Eucalyptus grandis]
 gb|KCW70626.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=438

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A +D +LP CWKG +P
Sbjct  268  KPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAVEDKSLPICWKGAKP  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ +VK +FK   L+F  G       ++ PE+YLI++  G+ CLG+LNG E  L   N
Sbjct  328  FKSVHEVKNHFKPLQLNFGKG---NAQLQLLPEAYLIVTKHGNACLGILNGGEVRLGELN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  385  LIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_008444185.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=411

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  625  TGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFR  446
             G++ + + FDSGSSY+Y NSQ Y A L  +   L+G+PLR+A +D TLP CWKG + F+
Sbjct  262  VGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKGQPLRDAPEDKTLPMCWKGSKAFK  321

Query  445  SISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVI  266
            S++D + +FK  ALSF N    +  F+I PE+YLIIS+ G+VCLG+LNG++ GL N N+I
Sbjct  322  SVADARNFFKPLALSFGN--SKKVQFQIPPEAYLIISNLGNVCLGILNGSQVGLGNVNLI  379

Query  265  GDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            GD+SM D+M++YDNE+  IGW  ANC RPP
Sbjct  380  GDISMLDKMMVYDNERQQIGWAPANCSRPP  409



>ref|XP_006663866.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=360

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+ M VVFDSGSS++Y  +QPY+A L + +K+   K L+E  D  +LP CWKG++P
Sbjct  206  RSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVAAIKDDLSKNLKEVPDH-SLPLCWKGKKP  263

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  LSF+NG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  264  FKSVLDVKKEFKSVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  321

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  322  IVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  353



>ref|XP_008781591.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=461

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G K + VV DSGSSY+Y   QPY   + ++ K+L  +PL++A DD +LP CWKG R 
Sbjct  280  QSLGSK-LQVVLDSGSSYTYFGFQPYRDFISAIKKDLSRQPLKDAPDDKSLPLCWKGPRS  338

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGL-HNY  275
            FRS+ DVKKYFK   LSF NG ++    EI PE+YLI+S KG+ CLG+LNGTEAGL H+ 
Sbjct  339  FRSVLDVKKYFKPLVLSFGNGRKAT--MEIPPENYLIVSKKGNACLGILNGTEAGLPHDL  396

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NVIGD+S+QD +VIYDNE+  IGW +ANCDR P
Sbjct  397  NVIGDISLQDLVVIYDNERRQIGWGQANCDRVP  429



>ref|XP_009106403.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=457

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  VFDSGSSY+Y N++ Y A L  V K+L+GK L++  +D +LP CWK +R 
Sbjct  269  KATGVKGVNFVFDSGSSYTYFNAEAYRAVLDLVRKDLKGKALKDTKEDKSLPVCWKDKRA  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+ +L F    +    F+I PESYLII+ KG+VCLG+LNGTE GL NYN
Sbjct  329  LKSVHDVKKYFKTISLRFGGSQK----FQIPPESYLIITEKGNVCLGILNGTEIGLENYN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S Q  M+IYDNEK  IGW  ++CD+ P
Sbjct  385  IIGDISFQGIMMIYDNEKQRIGWIPSDCDKLP  416



>ref|XP_010930728.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G K + VV DSGSSY+Y   QPY+  ++++ K+L  + L+E  DD  LP CWKGR+P
Sbjct  274  QSLGSK-LLVVLDSGSSYTYFGFQPYKDFVFAIKKDLS-RQLKETFDDSLLPLCWKGRKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH-NY  275
            F+S+ DV KYFK   LSF NG ++R   EI PE YLI++ KG+ CLG+LNGTEAGLH + 
Sbjct  332  FKSVLDVNKYFKPLVLSFGNGRKAR--MEIPPEKYLIVTKKGNACLGILNGTEAGLHRDL  389

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            N+IGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  390  NLIGDISLQDLVVIYDNEKQQIGWGRANCDRVP  422



>ref|XP_010428825.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  VFDSGSSY+Y N++ Y+A L  + K+L GKPL++  +D +LP CWKG++P
Sbjct  273  KTTGVKGINFVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT-EDQSLPVCWKGKKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  L ++ PESYLII+ KG+VCLG+LNGTE GL +YN
Sbjct  332  LKSLDEVKKYFKTITLRFGN-QKNGQLLQVPPESYLIITEKGNVCLGILNGTEVGLDSYN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  391  IIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  422



>ref|XP_010471942.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK +  VFDSGSSY+Y N++ Y+  L  + K+L GKPL++  +D  LP CWKG++P
Sbjct  274  KTTGVKGINFVFDSGSSYTYFNAEAYQTILDLIRKDLNGKPLKDT-EDKNLPVCWKGKKP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG++CLG+LNGTE GL +YN
Sbjct  333  LKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGNICLGILNGTEVGLDSYN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  392  IIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  423



>ref|XP_010238658.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=451

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+ M VV DSGSS++Y  +QPY+A L + +K    K L+E   DP+LP CWKG++P
Sbjct  267  RSLGVRPMEVVLDSGSSFTYFGAQPYQA-LVTALKSDLSKTLKEV-FDPSLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  LSF+NG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFKSLVLSFSNG--KKALMEIPPENYLIVTKFGNACLGILNGSEIGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            ++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  383  IVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNENTI  419



>ref|XP_011468243.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL GKPL+E  DD TLP CWKGR+P
Sbjct  269  KTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELNGKPLKETSDDRTLPLCWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I +VKKYFK  AL FA G +    FE+SPE+YLIISSKG+VCLG+L+GTE GL N N
Sbjct  329  FKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLIISSKGNVCLGILDGTEVGLQNSN  388

Query  271  VIGDVSMQDRMV  236
            +IGD+SMQD+M+
Sbjct  389  IIGDISMQDKMI  400



>ref|XP_006390086.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
 gb|ESQ27372.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
Length=468

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+++GK L +A +D +LP CWK ++P
Sbjct  275  KTTGVKGINLVFDSGSSYTYFNAEAYKAILDLIRKDVKGKALMDAKEDKSLPVCWKDKKP  334

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+  L F +  +S  LF + PESYLII+  G+VCLG+LNGTE GL NYN
Sbjct  335  LKSVHDVKKYFKTITLRFGS-QKSGQLFHVPPESYLIITENGNVCLGILNGTEIGLENYN  393

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+  Q  MVIYDNEK  IGW  ++C++ P
Sbjct  394  IIGDIFFQGIMVIYDNEKQRIGWIPSDCNKLP  425



>gb|EMS63812.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=441

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 10/155 (6%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG---KPLREAGDDPTLPFCWKG  461
            +S GV+ M VV DSGSS++Y +SQPY+    S+V  L+G   K L+E   DP+LP CWKG
Sbjct  287  RSLGVRPMEVVLDSGSSFTYFSSQPYQ----SLVTALKGDLSKALKEV-SDPSLPLCWKG  341

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            ++PF+S+ DVKK FKS  L+FANG   + L EI PE+YLI++  G+ CLG+LNG+E GL 
Sbjct  342  KKPFKSVLDVKKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEIGLK  399

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  400  DLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  434



>ref|XP_004149806.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN47712.1| hypothetical protein Csa_6G383000 [Cucumis sativus]
Length=437

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +D +LP CWKG RP
Sbjct  260  KATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPEDKSLPVCWKGTRP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKKYF   AL F     ++   ++ PE+YLII+  G+VC G+LNGTE GL + N
Sbjct  320  FKSLRDVKKYFNPLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFGILNGTEVGLGDLN  377

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  378  IIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>ref|XP_003526637.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN21715.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T VK + ++FDSGSSY+Y NS+ ++A +  V  +LRGKPL  A +D +LP CW+G +P
Sbjct  270  KPTSVKGLQLIFDSGSSYTYFNSKAHKALVNLVTNDLRGKPLSRATEDSSLPICWRGPKP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV   FK   LSF     S  L ++ PE+YLI++  G+VCLG+L+GTE GL N N
Sbjct  330  FKSLHDVTSNFKPLLLSFTKSKNS--LLQLPPEAYLIVTKHGNVCLGILDGTEIGLGNTN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  388  IIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>ref|XP_004171754.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=437

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +D +LP CWKG RP
Sbjct  260  KATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPEDKSLPVCWKGTRP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKKYF   AL F     ++   ++ PE+YLII+  G+VC G+LNGTE GL + N
Sbjct  320  FKSLRDVKKYFNLLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFGILNGTEVGLGDLN  377

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  378  IIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>ref|XP_007019123.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY16348.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=463

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 5/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ +VFDSGSSY+Y   + YEA L  V + L GKPL    D   LP CWKG +P
Sbjct  272  KPTGIKDLKIVFDSGSSYTYFCLRVYEAVLDLVRRGLTGKPLNTVHDQ-ALPICWKGSKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+++ DVK YF +  LSF N   +R +  ++ PE+YLI++  G+ CLG+LNGTEAGL ++
Sbjct  331  FKTVHDVKHYFSTLTLSFTN---TRNIQLQLPPEAYLIVTEHGNACLGILNGTEAGLDDF  387

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            N+IGD+S+QD+MV+YDNEK  IGW  ANCDR P
Sbjct  388  NIIGDISLQDKMVVYDNEKQQIGWVSANCDRLP  420



>emb|CDY12535.1| BnaC06g00610D [Brassica napus]
Length=393

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+  + ++FDSGSSY+Y NS+ Y+A +  +  +L+GKPL++  +D TL  CWKG +P
Sbjct  242  KPTGLNGLKLIFDSGSSYTYFNSKTYQAIVNLIGNDLKGKPLKDVKEDKTLAICWKGAKP  301

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VK  FK+  ++F NG R  +  +I PESYLI+S  G+VCLG+LNG+E GL + N
Sbjct  302  LKSVLEVKNLFKTLTINFKNG-RKNSQLQIPPESYLIVSKTGNVCLGILNGSEVGLQDSN  360

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  361  VIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  392



>ref|XP_009123049.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=411

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+  + ++FDSGS+Y+Y N + Y+A +  +  +L+GKP+++  DD TL  CWKG +P
Sbjct  260  KPTGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNDLKGKPVKDVKDDKTLAICWKGAKP  319

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VK  FK+  ++F NG R+ +  +I PESYLI+S  G+VCLG+LNG+EAGL + N
Sbjct  320  LKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSEAGLQDSN  378

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  379  VIGDISMQGAMVIYDNEKQQLGWVSADCDKLP  410



>ref|XP_010521265.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010521266.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
Length=418

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E  +D +L  CWKG +P
Sbjct  266  KSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETKEDKSLSVCWKGVKP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV KYFK+  L F  G  ++  F+I P SYLII+  G+VCLG+LNGTE GLH YN
Sbjct  326  VKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCLGILNGTEVGLHGYN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  385  IIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>ref|XP_004498348.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=444

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T VK + ++FDSGSSY+Y NSQ Y   L  V+ +L+GK L+ A +D +LP CWKG + 
Sbjct  264  KPTAVKGLELIFDSGSSYTYFNSQAYNVVLDLVINDLKGKQLKRATEDASLPICWKGAKS  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+SDVK YFK  AL F     S  L  I PE YLI++  G+VCLG+L+GTE GL   N
Sbjct  324  FKSVSDVKNYFKPLALRFKKVKNSHML--IPPEGYLIVTKHGNVCLGILDGTEIGLGYLN  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD+S+QD+MVIYDNE+  IGW  +NCDR P
Sbjct  382  ILGDISLQDKMVIYDNERQQIGWISSNCDRIP  413



>emb|CDY10133.1| BnaC05g03760D [Brassica napus]
Length=427

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+  + ++FDSGS+Y+Y NS+ Y+A +  +  +L+GKPL++  +D TL  CWKG  P
Sbjct  276  KPTGLSGLKLIFDSGSTYTYFNSKTYQAIVNLIGNDLKGKPLKDVKEDKTLAICWKGATP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ + K  FK+  ++F NG R+ +  +I PESYLI+S  G+VCLG+LNG+E GLH+ N
Sbjct  336  LKSVLEAKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSEVGLHDSN  394

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  395  VIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  426



>gb|EYU31770.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=410

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA +D +LP CWKG +P
Sbjct  259  QATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEAVEDKSLPVCWKGAKP  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D   YFK  ALSF N    +  F+I PE YL+++ +G+VCLG+LNG + GL + N
Sbjct  319  FKSIRDATTYFKPLALSFTNAKNVQ--FQIRPEYYLVVTGQGNVCLGILNGGDVGLEDIN  376

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  377  VIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>ref|XP_010521264.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Tarenaya hassleriana]
Length=453

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E  +D +L  CWKG +P
Sbjct  266  KSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETKEDKSLSVCWKGVKP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DV KYFK+  L F  G  ++  F+I P SYLII+  G+VCLG+LNGTE GLH YN
Sbjct  326  VKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCLGILNGTEVGLHGYN  384

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  385  IIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>emb|CDP10935.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG-KPLREAGDDPTLPFCWKGRR  455
            +++GVK   +VFDSGS+Y+Y NSQ Y A +  + K++ G K L++A DD +LP CWK  +
Sbjct  267  QASGVKGQSIVFDSGSTYNYFNSQAYNAVVSLLKKDINGRKQLQDAVDDKSLPICWKAPK  326

Query  454  PFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            PF+SI DVK YFK  AL F +       F++ PE+YLI++ +G+ CLG+LNGTE G+  +
Sbjct  327  PFKSILDVKSYFKPLALVFTSA--KNVQFQLQPEAYLIVTKQGNACLGILNGTEVGIGKF  384

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NVIGD+S+QD++VIYDNEK  IGW  ANC+R P
Sbjct  385  NVIGDISLQDKLVIYDNEKQQIGWASANCNRLP  417



>gb|KFK42141.1| hypothetical protein AALP_AA2G216700 [Arabis alpina]
Length=461

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+ GVK++ +VFDSGSSY+Y N++ Y+  L  + K+L GKPL +  +D +LP CWK ++P
Sbjct  270  KTAGVKDINLVFDSGSSYTYFNAEAYQVILNLISKDLNGKPLVDK-EDKSLPVCWKDKKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ DVKKYFK+  L F +  ++  LF++ PESYLII+ KG+VCLG+LNGTE GL  YN
Sbjct  329  LKSLDDVKKYFKTITLRFGS-QKNGQLFQVPPESYLIITEKGNVCLGILNGTEIGLDGYN  387

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+  Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  388  IIGDIFFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>gb|KEH40514.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=415

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  L+ A +DP+LP CWKG + 
Sbjct  264  KPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQLKRATEDPSLPICWKGSKS  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++SDVK YFK  AL F     S+ L  I PE YLI++  G+VCLG+L+GTE GL + N
Sbjct  324  FKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKHGNVCLGILDGTEVGLGDLN  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  382  IIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>emb|CDY14973.1| BnaA10g08830D [Brassica napus]
Length=410

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+  + ++FDSGS+Y+Y N + Y+A +  +   L+GKP+++  DD TL  CWKG +P
Sbjct  259  KATGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNNLKGKPVKDVKDDKTLAICWKGAKP  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +S+ +VK  FK+  ++F NG R+ +  +I PESYLI+S  G+VCLG+LNG+E GL + N
Sbjct  319  LKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLGILNGSEVGLQDSN  377

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  378  VIGDISMQGVMVIYDNEKQQLGWVSADCDKLP  409



>gb|EEC68949.1| hypothetical protein OsI_37668 [Oryza sativa Indica Group]
Length=421

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D  +LP CWKG++P
Sbjct  267  RPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPDH-SLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FK+  LSF+NG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFKTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  383  IVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>gb|EYU31771.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=442

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA +D +LP CWKG +P
Sbjct  259  QATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEAVEDKSLPVCWKGAKP  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D   YFK  ALSF N       F+I PE YL+++ +G+VCLG+LNG + GL + N
Sbjct  319  FKSIRDATTYFKPLALSFTNA--KNVQFQIRPEYYLVVTGQGNVCLGILNGGDVGLEDIN  376

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  377  VIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>ref|XP_010025731.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62451.1| hypothetical protein EUGRSUZ_H05086 [Eucalyptus grandis]
Length=435

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 4/155 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELR---GKPLREAGDDPTLPFCWKG  461
            K TG KN+ +VFDS S+Y+Y +S+ Y A    V  EL    GKP  E   DP LP CWKG
Sbjct  275  KPTGQKNLLLVFDSASTYTYFSSEAYRALSLRVTNELEKLSGKPFTEI-RDPELPLCWKG  333

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            R+ F++I +V+KYFK FAL+F +G R++T FE+ PESYLIIS  G+VC+GVLNGT+  L 
Sbjct  334  RQSFKNIREVRKYFKPFALTFNSGKRTKTQFEVPPESYLIISKMGNVCMGVLNGTQEKLG  393

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            + NVIGD+SMQD+MVIYDN  + +GW   +C + P
Sbjct  394  DTNVIGDISMQDKMVIYDNANHCLGWASEDCSQLP  428



>gb|ABA96612.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
Length=451

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D  +LP CWKG++P
Sbjct  267  RPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPDH-SLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK F++  LSF+NG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            ++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  383  IVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|XP_011069472.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=408

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A +D +LP CWKG +P
Sbjct  257  QATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDAVEDRSLPVCWKGAKP  316

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DV  YFK   L+F N        ++ PESYLI++  G+VCLG+L+G E GL N N
Sbjct  317  FKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVCLGILDGGEVGLGNIN  374

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  375  VIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>ref|XP_011003438.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=425

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A ++  L  CWK  +P
Sbjct  274  KPTGIKGLQLIFDSGSSYTYFNAQVYQSTLNLVRKDLAGKPLKDAPEEKELAVCWKTAKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K YFK   +SF N    +   +++PE YLII+  G+VCLG+LNG+E  L N+N
Sbjct  334  IKSILDIKSYFKPLTISFMNAKNVQ--LQLAPEDYLIITKDGNVCLGILNGSEQHLGNFN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             IGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  392  AIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  423



>gb|KEH40515.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=441

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  L+ A +DP+LP CWKG + 
Sbjct  264  KPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQLKRATEDPSLPICWKGSKS  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++SDVK YFK  AL F     S+ L  I PE YLI++  G+VCLG+L+GTE GL + N
Sbjct  324  FKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKHGNVCLGILDGTEVGLGDLN  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  382  IIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>ref|NP_001066301.1| Os12g0177500 [Oryza sativa Japonica Group]
 gb|ABA96613.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29320.1| Os12g0177500 [Oryza sativa Japonica Group]
 dbj|BAG89196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D  +LP CWKG++P
Sbjct  267  RPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPDH-SLPLCWKGKKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK F++  LSF+NG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N
Sbjct  325  FKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLGILNGSEVGLKDLN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  383  IVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_002888605.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64864.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A +D TLP CWKG +P
Sbjct  258  KPTGLKGLKLIFDTGSSYTYFNSKTYQTIVNLIGNDLKVSPLKVAKEDKTLPICWKGAKP  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ +VK +FK+  ++F N  R  T  +I PESYLIIS  G+ CLG+LNG+E GL N N
Sbjct  318  FKSVLEVKNFFKTITINFTNA-RRNTQLQIPPESYLIISKTGNACLGLLNGSEVGLQNSN  376

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  ++IYDNEK  +GW  +NC++ P
Sbjct  377  VIGDISMQGLLIIYDNEKQQLGWVSSNCNKLP  408



>ref|XP_010268980.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
 ref|XP_010268981.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
Length=457

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
             STGV+ +  VFDSGSSY+Y+N++ Y A + S+  +L  KPL+E  D+ TLP CWKG +P
Sbjct  277  HSTGVEGLKTVFDSGSSYTYLNNRAYHALISSMKGDLARKPLKEVPDE-TLPVCWKGPKP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SISD+KKYFK   L F+NG     L EI PESYLIIS  G+ CLG+LNG E GL + N
Sbjct  336  FKSISDIKKYFKPLVLRFSNG--KNALMEIQPESYLIISPYGNACLGILNGAEVGLRDSN  393

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD  ++D+M+IYDNEK  +GW   +C+R P
Sbjct  394  LIGDTFLRDKMLIYDNEKQQLGWMPTDCNRIP  425



>ref|XP_006303534.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
 gb|EOA36432.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
Length=406

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +++  PL+ A DD TLP CWKG +P
Sbjct  254  KPTGLKGLKLIFDTGSSYTYFNSKTYQTVVKLIENDVKSTPLKVAKDDKTLPICWKGPKP  313

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ +VK  FK+  ++F NG R  T  +I PESYLI+S  G VCLG+LNG+E GL + N
Sbjct  314  FKSVLEVKNLFKTLTINFTNG-RKNTQLQIPPESYLIVSKTGHVCLGLLNGSEVGLQDSN  372

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  M+IYDNEK  +GW  ++C + P
Sbjct  373  VIGDISMQGLMMIYDNEKQQLGWVASDCKKLP  404



>ref|XP_011069464.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=440

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A +D +LP CWKG +P
Sbjct  257  QATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDAVEDRSLPVCWKGAKP  316

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI DV  YFK   L+F N        ++ PESYLI++  G+VCLG+L+G E GL N N
Sbjct  317  FKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVCLGILDGGEVGLGNIN  374

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  375  VIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>ref|NP_175079.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50556.1|AC074228_11 nucellin, putative [Arabidopsis thaliana]
 gb|AEE32023.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=405

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A +D TLP CWKG +P
Sbjct  253  KPTGLKGLKLIFDTGSSYTYFNSKAYQTIINLIGNDLKVSPLKVAKEDKTLPICWKGAKP  312

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ +VK +FK+  ++F NG R+  L+ ++PE YLI+S  G+VCLG+LNG+E GL N N
Sbjct  313  FKSVLEVKNFFKTITINFTNGRRNTQLY-LAPELYLIVSKTGNVCLGLLNGSEVGLQNSN  371

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQ  M+IYDNEK  +GW  ++C++ P
Sbjct  372  VIGDISMQGLMMIYDNEKQQLGWVSSDCNKLP  403



>ref|XP_002520345.1| nucellin, putative [Ricinus communis]
 gb|EEF42131.1| nucellin, putative [Ricinus communis]
Length=424

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG K    +FDSGSSY+Y N+Q Y++ L  + KEL GKPLR+A ++  L  CWKG + 
Sbjct  273  KPTGTKAEEFIFDSGSSYTYFNAQVYQSTLNLIRKELSGKPLRDAPEEKALAICWKGTKR  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+++VK YFK FALSF          +I PE YLI+++ G+VCLG+LNG+E GL N+N
Sbjct  333  FKSVNEVKSYFKPFALSFTKA--KSVQLQIPPEDYLIVTNDGNVCLGILNGSEVGLGNFN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD   QD++VIYD++K+ IGW  ANCDR P
Sbjct  391  VIGDNLFQDKLVIYDSDKHQIGWIPANCDRLP  422



>ref|XP_010322933.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=424

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K++ ++FDSGS+++Y +S+ Y+  L S+ K +  K L +A DD +LP CW G +P
Sbjct  239  QATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATDDKSLPVCWSGSKP  298

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S++D   YFK F LSF      +  F++ PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  299  FKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCLGILNGTEVGLENHN  356

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  357  LIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  388



>ref|XP_004242040.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=441

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K++ ++FDSGS+++Y +S+ Y+  L S+ K +  K L +A DD +LP CW G +P
Sbjct  256  QATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATDDKSLPVCWSGSKP  315

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S++D   YFK F LSF      +  F++ PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  316  FKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCLGILNGTEVGLENHN  373

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  374  LIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  405



>ref|XP_007137426.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
 gb|ESW09420.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
Length=416

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T VK + +VFDSGSSY+Y NS+ + A +  +  +++GK L  A  DP+LP CWKG +P
Sbjct  265  KPTSVKGLELVFDSGSSYTYFNSRAHRALVDLITNDIKGKSLTRATADPSLPICWKGPKP  324

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV + FK   LSF     S+   ++ PE+YLI++  G+VCLG+L+GTE G+ N N
Sbjct  325  FKSLHDVTRNFKPLVLSFTKSKNSQ--LQVPPEAYLIVTKHGNVCLGILDGTEVGMGNIN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  179
            +IGD+S+QD++VIYDNEK  IGW  A CD P
Sbjct  383  IIGDISLQDKIVIYDNEKQQIGWASAKCDGP  413



>ref|XP_009611015.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
 ref|XP_009611017.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=417

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K + ++FDSGS+YSY NS  Y+  + S+ K++  K L EA DD +LP CWKG + 
Sbjct  268  QATGIKGIPIIFDSGSTYSYFNSDAYKILVSSIKKDINTKQLTEAVDDKSLPVCWKGSKS  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D K YFK   LSF          ++SPE+YL+ +  G++CLG+L+G+E GL NYN
Sbjct  328  FKSIHDAKSYFKPLTLSFTKA--KNVQLQLSPEAYLVRTEHGNICLGILDGSEVGLGNYN  385

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  386  IIGDISMVDKMVIYDNEKQQIGWVPANCNKLP  417



>gb|KDP32842.1| hypothetical protein JCGZ_12134 [Jatropha curcas]
Length=478

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK    +FDSGSSYSY N+Q Y+  L  + K+L GK L++A ++  L  CWKG +P
Sbjct  278  KPTGVKGQRFIFDSGSSYSYFNAQLYKNMLNLIRKDLSGKQLKDAPEEKALSICWKGIKP  337

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++SD K YFK  ALSF          ++ PE YLI+++ G+VCLG+LNG+E GL N N
Sbjct  338  FKTVSDAKSYFKPLALSFTAA--KNVQLQLQPEDYLIVTNGGNVCLGILNGSEVGLGNLN  395

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  155
            VIGD+  QD++VIYDN+K+ IGW  ANCDR P  +  FI
Sbjct  396  VIGDIFFQDKLVIYDNDKHQIGWVPANCDRLPNVDRDFI  434



>gb|KJB29193.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=266

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP CWKG +P
Sbjct  115  KPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPICWKGTKP  173

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCLG+LNG EAGL   N
Sbjct  174  FKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAEAGLGTTN  231

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  232  VIGDISLQGKLVIYDNENQMIGWANADCNR  261



>ref|XP_002306645.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
 gb|EEE93641.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
Length=424

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A +   L  CWK  +P
Sbjct  274  KPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLAGKPLKDAPEK-ELAVCWKTAKP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K YFK   +SF N    +   +++PE YLII+  G+VCLG+LNG+E  L N+N
Sbjct  333  IKSILDIKSYFKPLTISFMNAKNVQ--LQLAPEDYLIITKDGNVCLGILNGSEQQLGNFN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  391  VIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  422



>ref|NP_001152116.1| aspartic proteinase Asp1 precursor [Zea mays]
 gb|ACG45850.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=432

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP CWKG+ P
Sbjct  274  RSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPLCWKGQEP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI++  G+ CLG+LNG+E GL + +
Sbjct  332  FKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSEIGLKDLS  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  390  IIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  421



>ref|NP_001131929.1| uncharacterized protein LOC100193320 precursor [Zea mays]
 gb|ACF80557.1| unknown [Zea mays]
Length=424

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP CWKG+ P
Sbjct  266  RSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPLCWKGQEP  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI++  G+ CLG+LNG+E GL + +
Sbjct  324  FKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSEIGLKDLS  381

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  382  IIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  413



>gb|ACR34528.1| unknown [Zea mays]
 gb|AFW56222.1| aspartic proteinase Asp1 [Zea mays]
Length=433

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP CWKG+ P
Sbjct  275  RSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPLCWKGQEP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI++  G+ CLG+LNG+E GL + +
Sbjct  333  FKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSEIGLKDLS  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  391  IIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>ref|XP_002441914.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
 gb|EES15752.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
Length=429

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S  VK   VVFDSGSS++Y  +QPY+A L + +K    + L+E   DP+LP CWKG++P
Sbjct  274  QSLRVKLTEVVFDSGSSFTYFAAQPYQA-LVTALKGDLSRTLKEV-SDPSLPLCWKGKKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  L+F NG  ++   EI P++YLI++  G+ CLG+LNG+E GL + +
Sbjct  332  FKSVLDVKKEFKSLVLNFGNG--NKAFMEIPPQNYLIVTKYGNACLGILNGSEVGLKDLS  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            ++GD++MQD+MVIYDNEK  IGW RA CDR P
Sbjct  390  ILGDITMQDQMVIYDNEKGQIGWIRAPCDRIP  421



>ref|XP_007019119.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16344.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=408

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TGVK + V+FDSG++Y+Y++S+ Y+  L  + K+L GK LR+  D+  LP CWKG +P
Sbjct  259  KPTGVKGLNVIFDSGATYTYLSSKVYQTVLNLIRKDLTGKQLRDVKDN-ALPICWKGAKP  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+ YF +  LSFA    ++ +  + PE+YLI++ +G+VCLG+L+GTEAGL   N
Sbjct  318  FKSVRDVRNYFNTLVLSFAGANNNKLV--LPPEAYLIVTERGNVCLGILSGTEAGLGITN  375

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+QD++VIYDNE   IGW  A+C R P
Sbjct  376  VIGDISLQDKLVIYDNENQRIGWASADCTRKP  407



>ref|XP_008661408.1| PREDICTED: uncharacterized protein LOC100193320 isoform X1 [Zea 
mays]
Length=471

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GV+   VVFDSGSS++Y  ++PY+A L + +K+   + L E   D +LP CWKG+ P
Sbjct  275  RSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDGLSRTLEEE-PDTSLPLCWKGQEP  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI++  G+ CLG+LNG+E GL + +
Sbjct  333  FKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLIVTENGNACLGILNGSEIGLKDLS  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  391  IIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>gb|KJB29192.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
 gb|KJB29194.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=332

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +   D  LP CWKG +P
Sbjct  181  KPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-KDKALPICWKGTKP  239

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCLG+LNG EAGL   N
Sbjct  240  FKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAEAGLGTTN  297

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  298  VIGDISLQGKLVIYDNENQMIGWANADCNR  327



>ref|XP_010025733.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62452.1| hypothetical protein EUGRSUZ_H05087 [Eucalyptus grandis]
Length=434

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG KN+ ++FDSGS+Y+Y +S+ YEA    V  EL GKP  E   DP LP CWK R+ 
Sbjct  277  KPTGQKNLKLLFDSGSTYTYFSSKAYEALSSRVKNELIGKPFTEI-RDPDLPLCWKCRKS  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+ I DV KYFK FAL+F  G  + + FE+ PESYLI S  G+VC+GVLNGT+AGL + N
Sbjct  336  FKDIRDVTKYFKPFALTFNRGESTESQFEVPPESYLIRSVMGNVCMGVLNGTQAGLKDRN  395

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD SM D+MVIYDN  + +GW   +C + P
Sbjct  396  LIGDTSMLDKMVIYDNANHFLGWASEDCSQLP  427



>ref|XP_009596730.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana tomentosiformis]
Length=455

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TGVK   ++FDSGS++SY+NS+ Y+  + S+ K +  K L +A DD +LP CW G + 
Sbjct  269  QATGVKGFPLIFDSGSTFSYLNSEAYDILVSSIKKNINAKQLTDAVDDTSLPVCWNGSKS  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++++D   YFK   LSF          ++ PE+YLI++  G+VCLG+LNGTE GL NYN
Sbjct  329  FKTVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCLGILNGTEVGLGNYN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  387  VIGDISLLDKMVIYDNEKQRVGWLPANCNRLP  418



>gb|AES87275.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=424

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR    DP+LP CWKG +P
Sbjct  274  KPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRETKDPSLPICWKGVKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+S+++V  YFK   LSF    +S+ L F++ P +YLII+  G+VCLG+LNG EAGL N 
Sbjct  334  FKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKFGNVCLGILNGNEAGLGNR  390

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  391  NVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>ref|XP_009802241.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802242.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802243.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802244.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=417

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K + ++FDSGS+YSY NS+ Y+  + S+ K++  K L +A DD +LP CWKG + 
Sbjct  268  QATGIKGIPIIFDSGSTYSYFNSEAYKILVSSIKKDVNTKQLTDAVDDKSLPVCWKGSKS  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D K +FK   LSF          ++ PE+YL+ +  G++CLG+L+GT+ G+ NYN
Sbjct  328  FKSIHDAKSFFKPLTLSFTKA--KNVQLQLPPEAYLVRTEHGNICLGILDGTDVGIGNYN  385

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGDVSM D+MVIYDNEK  IGW  ANC++ P
Sbjct  386  IIGDVSMVDKMVIYDNEKQQIGWVPANCNKLP  417



>ref|XP_009758779.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana sylvestris]
Length=455

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TGVK   V+FDSGS++SY +S+ Y+  + S+ K +  K L +A DD +LP CW G + 
Sbjct  269  QATGVKGFPVIFDSGSTFSYFSSEAYDILVSSIKKNINAKQLTDAVDDKSLPVCWNGSKS  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S++D   YFK   LSF          ++ PE+YLI++  G+VCLG+LNGTE GL NYN
Sbjct  329  FKSVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCLGILNGTEVGLGNYN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  387  VIGDISLLDKMVIYDNEKQQVGWLPANCNRLP  418



>gb|KJB29183.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
 gb|KJB29185.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=294

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP CWKG +P
Sbjct  102  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPICWKGTKP  160

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YF +  L F +        E+ PE+YLI++  G+ C G+LNGTEAGL + N
Sbjct  161  FKSVHDVKNYFSTLTLKFKD--TQNIQLELQPEAYLIVTEDGNACFGILNGTEAGLGDLN  218

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  219  VIGDISLIGKMVVYDNEKQRIGWISADCNRLP  250



>emb|CBI18999.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+ +LP CW+G +P
Sbjct  241  QNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE-SLPVCWRGAKP  298

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+LNG+E GL + N
Sbjct  299  FKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSEVGLGDSN  356

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  357  VIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  388



>ref|XP_006365534.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=441

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TGVK + +VFDSGS+++Y +S+ Y+  L S+ K +  K L +A +D +LP CW G +P
Sbjct  256  QATGVKGLPIVFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDATNDKSLPVCWSGSKP  315

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S +D   YFK F LSF         F++ PE+YLI++  G+VCLG+LNGTE GL N+N
Sbjct  316  FKSANDATIYFKPFTLSFMKA--KNVEFQLLPEAYLILTEHGNVCLGILNGTEVGLGNHN  373

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+ D+MV+YDNEK  IGW  ANC + P
Sbjct  374  LIGDISLLDKMVVYDNEKKQIGWLPANCKKLP  405



>ref|XP_010664194.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Vitis vinifera]
Length=423

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+ +LP CW+G +P
Sbjct  274  QNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE-SLPVCWRGAKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+LNG+E GL + N
Sbjct  332  FKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSEVGLGDSN  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  390  VIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  421



>ref|XP_004240544.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=418

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A +D +LP CWKG +P
Sbjct  266  QATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAVNDKSLPVCWKGSKP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D  +YFK   LSF          +++PE+YLI ++KG+VCLG+LNG+E GL   N
Sbjct  326  FKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCLGILNGSEVGLGAVN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  173
            +IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  384  IIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>gb|KJB29184.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=305

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP CWKG +P
Sbjct  113  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPICWKGTKP  171

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YF +  L F +        E+ PE+YLI++  G+ C G+LNGTEAGL + N
Sbjct  172  FKSVHDVKNYFSTLTLKFKD--TQNIQLELQPEAYLIVTEDGNACFGILNGTEAGLGDLN  229

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  230  VIGDISLIGKMVVYDNEKQRIGWISADCNRLP  261



>ref|XP_004240543.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A +D +LP CWKG +P
Sbjct  266  QATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAVNDKSLPVCWKGSKP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D  +YFK   LSF          +++PE+YLI ++KG+VCLG+LNG+E GL   N
Sbjct  326  FKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCLGILNGSEVGLGAVN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  173
            +IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  384  IIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>ref|XP_004142630.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161165.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54552.1| hypothetical protein Csa_4G361860 [Cucumis sativus]
Length=413

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++ G+  + + FDSGSSY+Y NSQ Y A    +  +L+G PL+ A DD TL  CWKG +P
Sbjct  258  RAVGIGGLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLKGNPLKLASDDKTLELCWKGPKP  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ DV+ +FK  A+SF N       F+I PE+YLIIS  G+VCLG+L+G++ G+ N N
Sbjct  318  FESVVDVRNFFKPLAMSFKN--SKNVQFQIPPEAYLIISEFGNVCLGILDGSKEGMGNVN  375

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM +++V+YDNE+  IGW  +NC+R P
Sbjct  376  IIGDISMLNKIVVYDNERERIGWASSNCNRSP  407



>gb|KJB29189.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=407

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  D   LP CWKG +P
Sbjct  256  KPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDVKDK-ALPICWKGTKP  314

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCLG+LNG EAGL   N
Sbjct  315  FKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAEAGLGTTN  372

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  373  VIGDISLQGKLVIYDNENQMIGWANADCNR  402



>ref|XP_004502513.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -3

Query  625  TGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFR  446
            T VKN+ ++FDSGSSY+Y N + Y A +  V  +++GK L +A DDP+LP CWKG  PF+
Sbjct  269  TSVKNIQLIFDSGSSYTYFNPEVYNAVVTLVNNDVKGK-LSDAFDDPSLPLCWKGAEPFK  327

Query  445  SISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVI  266
            S+SDV+ YFK   LSF+N   S   F + P +YLII+  G+VCLG+L G++  L + NVI
Sbjct  328  SLSDVETYFKPLDLSFSNSMDSP--FHLPPSAYLIITEHGNVCLGILEGSQVDLGDLNVI  385

Query  265  GDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  170
            GD+S+QD++VIYDNE   IGW   +C+  P P
Sbjct  386  GDISLQDKVVIYDNENKQIGWASTDCNTHPHP  417



>ref|XP_002285867.2| PREDICTED: aspartic proteinase Asp1 isoform X1 [Vitis vinifera]
Length=453

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+ +LP CW+G +P
Sbjct  274  QNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE-SLPVCWRGAKP  331

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+LNG+E GL + N
Sbjct  332  FKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGILNGSEVGLGDSN  389

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  390  VIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  421



>gb|KJB29190.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=428

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  D   LP CWKG +P
Sbjct  277  KPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDVKDK-ALPICWKGTKP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCLG+LNG EAGL   N
Sbjct  336  FKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAEAGLGTTN  393

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  394  VIGDISLQGKLVIYDNENQMIGWANADCNR  423



>ref|XP_006355805.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006355806.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Solanum 
tuberosum]
Length=363

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A +D +LP CWKG +P
Sbjct  211  QATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAVNDKSLPVCWKGSKP  270

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D   YFK   LSF      +   +++PE+YLI + KG+VCLG+LNG+  GL + N
Sbjct  271  FKSLKDATMYFKPLTLSFTKAKNIQ--LQLTPEAYLIYTDKGNVCLGILNGSVVGLGDVN  328

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  329  IIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  360



>gb|KHG10363.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10554.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10792.1| Asparticase Asp1 [Gossypium arboreum]
Length=426

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + V+FD+GS+Y+Y+N + YE  L  + K L GK L +  D   LP CWKG +P
Sbjct  277  KPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKNLSGKQLHDVKDK-ALPICWKGTKP  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCLG+LNG EAGL   N
Sbjct  336  FKSVRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCLGILNGAEAGLGTTN  393

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            VIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  394  VIGDISLQGKLVIYDNENQMIGWANADCNR  423



>ref|XP_011027496.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
 ref|XP_011014192.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
Length=425

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++  L  CWK  +P
Sbjct  274  KPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEEKALAVCWKTAKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+LNG E GL N N
Sbjct  334  IKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGILNGGEQGLGNLN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  392  VIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>ref|XP_011468246.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL GKPL+E  DD TLP CWKGR+P
Sbjct  269  KTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELNGKPLKETSDDRTLPLCWKGRKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F++I +VKKYFK  AL FA G +    FE+SPE+YLIISSKG+VCLG+L+GTE GL N N
Sbjct  329  FKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLIISSKGNVCLGILDGTEVGLQNSN  388

Query  271  VIGD  260
            +IGD
Sbjct  389  IIGD  392



>gb|AAM76716.1| nucellin-like aspartic protease [Zea mays]
Length=357

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 11/153 (7%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG---KPLREAGDDPTLPFCWKG  461
            +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP CWKG
Sbjct  203  RSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLCWKG  257

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            ++ F+S+ DVK  FKS  LSFA+        EI PE+YLI++  G+VCLG+L+GT A L 
Sbjct  258  QKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAAKL-  314

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  315  SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  347



>ref|XP_011027495.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
 ref|XP_011014191.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
Length=463

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++  L  CWK  +P
Sbjct  274  KPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEEKALAVCWKTAKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+LNG E GL N N
Sbjct  334  IKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGILNGGEQGLGNLN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  392  VIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>ref|XP_006355850.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=400

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K + ++ DSG++++Y NS+ Y+  L  + K +  K L +A DD +LP CWKG +P
Sbjct  218  QATGIKGIPIILDSGTTFTYFNSEAYKTLLSLIKKNIDTKQLTDAVDDKSLPVCWKGSKP  277

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D   YFK   LSF      +   ++ PE+YLI++ KG VCLG+LNG+EAG+ + N
Sbjct  278  FKSLKDATMYFKPLTLSFTKAKNIQ--LQLLPEAYLILTDKGHVCLGILNGSEAGIGDVN  335

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  173
            +IGD+SM D++VIYDNEK  IGW  ANC++ P+
Sbjct  336  LIGDISMLDKLVIYDNEKQQIGWAPANCNKLPS  368



>ref|XP_002302227.1| nucellin family protein [Populus trichocarpa]
 gb|EEE81500.1| nucellin family protein [Populus trichocarpa]
Length=422

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A ++  L  CWK  +P
Sbjct  271  KPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEEKALAVCWKTAKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+LNG E GL N N
Sbjct  331  IKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGILNGGEQGLGNLN  388

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  389  VIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|AAY23266.1| Similar to nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 gb|ABA91763.1| Aspartic proteinase Asp1 precursor, putative [Oryza sativa Japonica 
Group]
Length=307

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
             S G+  M VVFDSGS+Y+Y  +QPY+A +Y++   L    L +   DP+LP CWKG++ 
Sbjct  155  HSLGMNPMDVVFDSGSTYTYFTAQPYQATVYAIKGGLSSTSLEQV-SDPSLPLCWKGQKA  213

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ DVKK FKS  L+F N      + EI PE+YLI++  G+VCLG+L+G      N+N
Sbjct  214  FESVFDVKKEFKSLQLNFGN----NAVMEIPPENYLIVTEYGNVCLGILHGCRL---NFN  266

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            +IGD++MQD+MVIYDNE+  +GW R +C R P  +V+
Sbjct  267  IIGDITMQDQMVIYDNEREQLGWIRGSCGRSPTKSVM  303



>ref|XP_004502512.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = -3

Query  625  TGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFR  446
            T VKN+ ++FDSGSSY+Y NS+ Y A +  V  +++GK L +A DDP+LP CWKG  PF+
Sbjct  269  TSVKNIQLIFDSGSSYTYFNSEAYNAVVALVKNDVKGK-LSDASDDPSLPICWKGAEPFK  327

Query  445  SISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNYNV  269
            S+SDV  YFK   LSF+   +S  L F + P +YLII+  G+VCLG+L+G++  L + NV
Sbjct  328  SLSDVDTYFKPLDLSFS---KSNDLYFHLPPSAYLIITEHGNVCLGILDGSQVDLGDLNV  384

Query  268  IGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  170
            IGD+ +QD++VIYDNE   +GW  A+C+  P P
Sbjct  385  IGDIFLQDKVVIYDNENKRVGWASADCNTHPHP  417



>ref|XP_008669793.1| PREDICTED: aspartic proteinase Asp1 [Zea mays]
 gb|ACL53484.1| unknown [Zea mays]
 gb|ACL54629.1| unknown [Zea mays]
 tpg|DAA38945.1| TPA: nucellin-like aspartic protease [Zea mays]
Length=415

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 11/153 (7%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG---KPLREAGDDPTLPFCWKG  461
            +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP CWKG
Sbjct  261  RSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLCWKG  315

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            ++ F+S+ DVK  FKS  LSFA+        EI PE+YLI++  G+VCLG+L+GT A L 
Sbjct  316  QKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAAKL-  372

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  373  SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>ref|XP_006355804.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Solanum 
tuberosum]
Length=418

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A +D +LP CWKG +P
Sbjct  266  QATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAVNDKSLPVCWKGSKP  325

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ D   YFK   LSF          +++PE+YLI + KG+VCLG+LNG+  GL + N
Sbjct  326  FKSLKDATMYFKPLTLSFTKA--KNIQLQLTPEAYLIYTDKGNVCLGILNGSVVGLGDVN  383

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  384  IIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  415



>ref|XP_006386369.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
 gb|ERP64166.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
Length=460

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A ++  L  CWK  +P
Sbjct  271  KPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEEKALAVCWKTAKP  330

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
             +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+LNG E GL N N
Sbjct  331  IKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGILNGGEQGLGNLN  388

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  389  VIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|KJB29187.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=418

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP CWKG +P
Sbjct  270  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPICWKGTKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YF +  L F +        E+ PE+YLI++  G+ C G+LNGTEAGL + N
Sbjct  329  FKSVHDVKNYFSTLTLKFKD--TQNIQLELQPEAYLIVTEDGNACFGILNGTEAGLGDLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  387  VIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>ref|XP_003605080.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AES87277.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=425

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 5/153 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T  K + ++FDSGSSY+Y +S  Y      V  +L+GKPL     DP+LP CWKG +P
Sbjct  275  KPTPAKGLQIIFDSGSSYTYFSSPVYTIVANMVNNDLKGKPLSRV-KDPSLPICWKGVKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+S+++V  YFK   LSF    +S+ L F++ P +YLII+  G+VCLG+LNG EAGL N 
Sbjct  334  FKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKYGNVCLGILNGNEAGLGNR  390

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  391  NVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>ref|XP_011074834.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=403

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++  +K + +VFDSGS+YSY +SQ Y   +  +   L G  L++A +D +LP CWKG  P
Sbjct  254  QAANIKGLQIVFDSGSTYSYFSSQAYNYLVSLMRDNLNGNQLKDAVEDRSLPICWKGAEP  313

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+SI D   YFK   LSF N       F++ PE+YLI++  G+VCLG+L+G E GL N N
Sbjct  314  FKSIRDAVGYFKPLVLSFKN-----VEFQVQPEAYLIVTVHGNVCLGILDGGEVGLGNLN  368

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+SMQD+MVIYDNE+  IGW  +NC+  P
Sbjct  369  VIGDISMQDKMVIYDNERQQIGWAPSNCNSHP  400



>ref|XP_008444184.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=414

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++ G+ ++ + FDSGSSY+Y NSQ Y A    +  +L+G+PL+ A DD TL  CWKG + 
Sbjct  259  RAVGIGSLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLKGQPLKLASDDKTLELCWKGPKA  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ DV+ +FK  A+SF N       F+I PE+YLIIS  G+ CLG+L+GT+ GL N N
Sbjct  319  FESVIDVRNFFKPLAMSFKN--SKNVQFQIPPEAYLIISKFGNACLGILDGTKEGLGNIN  376

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+SM +++V+YDNE+  IGW   NC+R P
Sbjct  377  LIGDISMLNKIVVYDNERKQIGWASENCNRLP  408



>gb|KJB29182.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=460

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP CWKG +P
Sbjct  270  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPICWKGTKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C G+LNGTEAGL + N
Sbjct  329  FKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTEAGLGDLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  387  VIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|KJB29181.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=462

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL +   D  LP CWKG +P
Sbjct  270  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DTVQDKALPICWKGTKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C G+LNGTEAGL + N
Sbjct  329  FKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNACFGILNGTEAGLGDLN  386

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  387  VIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|ACG42043.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=415

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 11/153 (7%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG---KPLREAGDDPTLPFCWKG  461
            +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   DPTLP CWKG
Sbjct  261  RSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQV-SDPTLPLCWKG  315

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            ++ F+S+ DVK  FKS  LSF++        EI PE+YLI++  G+VCLG+L+GT A L 
Sbjct  316  QKAFKSVFDVKNEFKSMFLSFSSA--KNAAMEIPPENYLIVTKNGNVCLGILDGTAAKL-  372

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  373  SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>gb|EPS72688.1| hypothetical protein M569_02067 [Genlisea aurea]
Length=404

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+T ++ + +VFDSGS+Y+Y +S+ Y + +  +   +  K L++A +D TLP CWKG +P
Sbjct  253  KATTIRGLPIVFDSGSTYTYFSSRAYGSLVSLMKANIDSKQLKDAPEDRTLPVCWKGGKP  312

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S++DV   FK   LSF         F++ P+SYLI++  G+VCLG+LNG E GL N N
Sbjct  313  FKSVNDVATLFKPLTLSFTK--VKNVQFQLPPQSYLIVTEHGNVCLGILNGGEVGLGNIN  370

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD+S+ D++V+YDNEK+ IGW  ANCDR P
Sbjct  371  LIGDISLVDKLVVYDNEKHRIGWAAANCDRLP  402



>ref|XP_010680865.1| PREDICTED: aspartic proteinase Asp1-like [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -3

Query  610  MXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDV  431
            +  V D+GS+Y+Y +SQ YEA L  + K +  K L+   +D TLP CWKG +PF+S++DV
Sbjct  269  LSFVLDTGSTYTYFSSQVYEAALSMINKNIDSKQLKTVPEDKTLPVCWKGSKPFKSMNDV  328

Query  430  KKYFKSFALSFA---NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGD  260
            KK FK  AL F+   +  R  T+ E+ PE+YLII+  G+VCLG+L+G EAGL N N++GD
Sbjct  329  KKLFKPLALRFSVKSSFLRKNTVMEMGPETYLIINKSGNVCLGILDGAEAGLENLNILGD  388

Query  259  VSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +S+ ++++ YDN K+ IGW  ANCDR P
Sbjct  389  ISLLNKVITYDNVKDQIGWATANCDRLP  416



>gb|KDO80581.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=254

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A DD TLP CW+G  P
Sbjct  100  KSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPICWRG--P  157

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCLG+LNG+EA +   N
Sbjct  158  FKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCLGILNGSEAEVGENN  216

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  217  IIGEIFMQDKMVIYDNEKQRIGWKPEDCN  245



>gb|KDO52229.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=380

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  253  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  312

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  313  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  371

Query  271  VIGDV  257
            VIG +
Sbjct  372  VIGGI  376



>gb|KDO52225.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=397

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            ++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+EA +D TLP CWKGRRP
Sbjct  270  ETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLKEAPEDETLPLCWKGRRP  329

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+VCLG+LNG E GL + N
Sbjct  330  FKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGNVCLGILNGAEVGLQDLN  388

Query  271  VIGDV  257
            VIG +
Sbjct  389  VIGGI  393



>ref|XP_006472803.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=429

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A DD TLP CW+G  P
Sbjct  275  KSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPICWRG--P  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++  V +YFK  ALSF N  R+    ++ PE+YL+IS + +VCLG+LNG+EA +   N
Sbjct  333  FKALGQVTEYFKPLALSFTN-RRNSVRLDVPPEAYLVISGRKNVCLGILNGSEAEVGENN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  392  IIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>gb|EEC67807.1| hypothetical protein OsI_35373 [Oryza sativa Indica Group]
Length=418

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 107/152 (70%), Gaps = 7/152 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP CWKG++ 
Sbjct  266  RSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQV-SDPSLPLCWKGQKA  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+SDVKK FKS    F        + EI PE+YLI++  G+VCLG+L+G+ A L +++
Sbjct  324  FKSVSDVKKDFKSLQFIFGK----NAVMEIPPENYLIVTKNGNVCLGILDGSAAKL-SFS  378

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  379  IIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>ref|XP_003577760.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=413

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 107/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L++   DP+LP CWKG++ 
Sbjct  261  RSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLQQV-SDPSLPLCWKGQKV  318

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+SDVK  FKS  LSF       ++ EI PE+YLI++  G+ CLG+L+G+ A L  +N
Sbjct  319  FKSVSDVKNDFKSLFLSFVK----NSVLEIPPENYLIVTKNGNACLGILDGSAAKL-TFN  373

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD++MQD+++IYDNE+  +GW R +C R
Sbjct  374  IIGDITMQDQLIIYDNERGQLGWIRGSCSR  403



>ref|NP_001065913.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|AAY23257.1| nucellin-like aspartic protease [Oryza sativa Japonica Group]
 gb|ABA91814.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27758.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|EEE51770.1| hypothetical protein OsJ_33210 [Oryza sativa Japonica Group]
Length=418

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 107/152 (70%), Gaps = 7/152 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP CWKG++ 
Sbjct  266  RSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQV-SDPSLPLCWKGQKA  323

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+SDVKK FKS    F        + +I PE+YLII+  G+VCLG+L+G+ A L +++
Sbjct  324  FKSVSDVKKDFKSLQFIFGK----NAVMDIPPENYLIITKNGNVCLGILDGSAAKL-SFS  378

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  379  IIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>ref|XP_006472802.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=431

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A DD TLP CW+G  P
Sbjct  277  KSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPICWRG--P  334

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++  V +YFK  ALSF N  R+    ++ PE+YL+IS + +VCLG+LNG+EA +   N
Sbjct  335  FKALGQVTEYFKPLALSFTN-RRNSVRLDVPPEAYLVISGRKNVCLGILNGSEAEVGENN  393

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  394  IIGEIFMQDKMVIYDNEKQRIGWKPEDCN  422



>gb|EEE51772.1| hypothetical protein OsJ_33215 [Oryza sativa Japonica Group]
Length=775

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
             S G+  M VVFDSGS+Y+Y  +QPY+A +Y++   L    L +   DP+LP CWKG++ 
Sbjct  150  HSLGMNPMDVVFDSGSTYTYFTAQPYQATVYAIKGGLSSTSLEQV-SDPSLPLCWKGQKA  208

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F S+ DVKK FKS  L+F N      + EI PE+YLI++  G+VCLG+L+G      N+N
Sbjct  209  FESVFDVKKEFKSLQLNFGN----NAVMEIPPENYLIVTEYGNVCLGILHGCRL---NFN  261

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IGD++MQD+MVIYDNE+  +GW R +CD
Sbjct  262  IIGDITMQDQMVIYDNEREQLGWIRGSCD  290


 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 8/158 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKEL---RGKPLREAGD-DPTLPFCWK  464
            K+     M V+FDSG++Y+Y  +QPY+A L SVVK       K L E  + D  L  CWK
Sbjct  610  KAISAAPMAVIFDSGATYTYFAAQPYQATL-SVVKSTLNSECKFLTEVTEKDRALTVCWK  668

Query  463  GRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEA--  290
            G+    +I +VKK F+S +L FA+G +  TL EI PE YLIIS +G VCLG+L+G++   
Sbjct  669  GKDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPPEHYLIISQEGHVCLGILDGSKEHL  727

Query  289  GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             L   N+IG ++M D+MVIYD+E++ +GW    CDR P
Sbjct  728  SLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRIP  765



>gb|EMS62785.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=412

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E   D +LP CWKG++ 
Sbjct  260  RSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKEV-SDVSLPLCWKGQKV  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+S+VK  FKS  LSF       ++ EI PE+YLI++  G+VCLG+L+GT A    +N
Sbjct  318  FKSVSEVKNDFKSLFLSFGK----NSVMEIPPENYLIVTKYGNVCLGILDGTAAK-QTFN  372

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  373  IIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>gb|KDO80580.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=378

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A DD TLP CW+G  P
Sbjct  224  KSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPICWRG--P  281

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCLG+LNG+EA +   N
Sbjct  282  FKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCLGILNGSEAEVGENN  340

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  341  IIGEIFMQDKMVIYDNEKQRIGWKPEDCN  369



>gb|KEH20924.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=410

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++ A DD TLP CW G+RP
Sbjct  277  RKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIKAAPDDQTLPMCWHGKRP  336

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            FRSI++VKKYFK   LSF NG R +  FEI PE+YLIIS+ G+VCLG+LNG E GL   N
Sbjct  337  FRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGNVCLGILNGPEVGLGELN  396

Query  271  VIG  263
            +IG
Sbjct  397  LIG  399



>ref|XP_003605078.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=418

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 102/153 (67%), Gaps = 10/153 (7%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR    DP+LP CWKG +P
Sbjct  274  KPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRETKDPSLPICWKGVKP  333

Query  451  FRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            F+S+++V  YFK   LSF    +S+ L F++ P  +      G+VCLG+LNG EAGL N 
Sbjct  334  FKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVKF------GNVCLGILNGNEAGLGNR  384

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  385  NVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  417



>gb|KDO80579.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=429

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            KS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A DD TLP CW+G  P
Sbjct  275  KSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAPDDKTLPICWRG--P  332

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCLG+LNG+EA +   N
Sbjct  333  FKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCLGILNGSEAEVGENN  391

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCD  185
            +IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  392  IIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>gb|EMT29613.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=412

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E   D +LP CWKG++ 
Sbjct  260  RSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKEV-SDVSLPLCWKGQKV  317

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+S+VK  FKS  L+F       ++ EI PE+YLI++  G+VCLG+L+GT A    +N
Sbjct  318  FKSVSEVKNDFKSLFLNFGK----NSVMEIPPENYLIVTKYGNVCLGILDGTAAK-QTFN  372

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            +IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  373  IIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>ref|XP_006662787.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=422

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 7/152 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G+  M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   DP+LP CWKG++ 
Sbjct  270  RSLGITPMEVVFDSGSTYTYFSAQPYQA-IVSAIKGGLSKSLKQV-TDPSLPLCWKGQKA  327

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DVKK FKS  L            EI PE+YL+++  G+VCLG+L+G+ A L  +N
Sbjct  328  FKSVFDVKKDFKSLQLIIGK----NAAMEIPPENYLVVTKNGNVCLGILDGSAAKLK-FN  382

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            +IGD++MQD+MVIYDNE+  +GW R +C R P
Sbjct  383  IIGDITMQDQMVIYDNERAQLGWIRGSCSRSP  414



>ref|XP_004978884.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=419

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 11/153 (7%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRG---KPLREAGDDPTLPFCWKG  461
            +S G+K M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++   D  LP CWKG
Sbjct  265  RSLGLKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQVPGD-ELPLCWKG  319

Query  460  RRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH  281
            ++ F+S+ DVKK FKS  LSFA G     + EI PE+YLI++  G+VCLG+L+ T A L 
Sbjct  320  QKAFKSVFDVKKEFKSLHLSFATG--KNAVMEIPPENYLIVTKIGNVCLGILDATVAKL-  376

Query  280  NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            ++++IGD++M D+MVIYDNEK  +GW R  C R
Sbjct  377  SFSIIGDITMLDQMVIYDNEKAQLGWVRGPCSR  409



>gb|EMT12274.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=430

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 108/151 (72%), Gaps = 14/151 (9%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSV--------VKELRGKPLREAGDDPTLP  476
            +S GVK M VVFDSGS+Y+Y  +QPY+A + +V        ++    K L++  D P+LP
Sbjct  285  RSLGVKPMEVVFDSGSTYTYFAAQPYQATVSAVYLNHTTFQLQAGLSKSLKQVSD-PSLP  343

Query  475  FCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGT  296
             CWKG++ F+S+SDVKK F S  LSFA      T+ EI+PE+YLI++  G+VCLG+L+G+
Sbjct  344  LCWKGQKVFKSVSDVKKDFMSLFLSFAK----NTVMEIAPENYLIVTKNGNVCLGILDGS  399

Query  295  EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGW  203
             A L N+N+IGD++MQD++V+YDNEK  IGW
Sbjct  400  AAKL-NFNIIGDITMQDQLVVYDNEKGRIGW  429



>ref|XP_007019121.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY16346.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=470

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            + TG K + V+FD+G++Y+Y++S+ Y+  L  + K+L GK LR+   D  LP CWKG +P
Sbjct  321  EPTGAKGLYVIFDTGATYTYLSSEVYQTLLNLIRKDLAGKQLRDV-KDYALPICWKGAKP  379

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+ DV+ YF +  LSF     ++ +  + PE+Y+I++ +G+VCLG+LNGTE GL   N
Sbjct  380  FKSVRDVRNYFNTLVLSFTGANNNKLV--LPPEAYIIVTERGNVCLGILNGTEVGLGITN  437

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            VIG +S+QD++VIYDNE   IGW  A+  R P
Sbjct  438  VIGAISLQDKLVIYDNENQRIGWASADGTRKP  469



>ref|XP_006856698.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
 gb|ERN18165.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
Length=406

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = -3

Query  604  VVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLRE--AGDDPTLPFCWKGRRPFRSISDV  431
            V+FDSG+S++Y  S  Y+A +  + K+L    L+E   G   TLP CW+G + F+S+S++
Sbjct  217  VIFDSGTSFTYFTSLAYQALISRLRKDLAKTSLKELPIGPHSTLPLCWRGTKAFKSLSEI  276

Query  430  KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  251
            K YFK   ++F NG R+R  FEISPE +LII+S+G+VCLG+LNG+E GL ++ +IGD+S+
Sbjct  277  KGYFKPLVMNFKNGKRAR--FEISPEGFLIITSQGNVCLGILNGSEVGLLDHILIGDISL  334

Query  250  QDRMVIYDNEKNAIGWTRANCDRPP  176
               +V+YDNE + IGW   NC+R P
Sbjct  335  HGYLVVYDNENHQIGWVPQNCNRLP  359



>dbj|BAJ99780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 106/148 (72%), Gaps = 7/148 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +S G+K M VVFDSGS+Y+Y  ++PY+A + S +K    K L+E  D  +LP CWKG++ 
Sbjct  278  RSLGMKPMEVVFDSGSTYAYFAAEPYQATV-SALKAGLSKSLKEVSDV-SLPLCWKGQKV  335

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN  272
            F+S+S+VK  FKS  LSF       ++ EI PE+YLI++  G+VCLG+L+GT A L  +N
Sbjct  336  FKSVSEVKNDFKSLFLSFGK----NSVMEIPPENYLIVTKYGNVCLGILDGTTAKL-KFN  390

Query  271  VIGDVSMQDRMVIYDNEKNAIGWTRANC  188
            +IGD++MQD+M+IYDNEK  +GW R +C
Sbjct  391  IIGDITMQDQMIIYDNEKGQLGWIRGSC  418



>ref|XP_008807681.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=420

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  613  NMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISD  434
            N+ V+ DSG++Y+Y   QPY   + ++   +  +PL  A DD  LP+CW+G RPF SI+D
Sbjct  269  NLMVLLDSGTTYTYFGLQPYNNFISTLNGHVSKQPLTRAYDDHWLPYCWRGPRPFSSIAD  328

Query  433  VKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH-NYNVIGDV  257
             + YFK   L FA+G  S    +I P +YLIIS   + CLG+LNGTE GL  N N+IGD+
Sbjct  329  AQGYFKQLELRFADGAAS---MKIPPANYLIISEHHNACLGILNGTEEGLQSNINLIGDI  385

Query  256  SMQDRMVIYDNEKNAIGWTRANCDR  182
            SM D +VIYDN+K  IGW  A+C R
Sbjct  386  SMLDLLVIYDNDKQRIGWASADCSR  410



>gb|EMT05967.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=306

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = -3

Query  601  VFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY  422
            VFDSGS+YSY++   YE  + +V   L+   L++  DDP L  CW+  +P +S+ DVK  
Sbjct  156  VFDSGSAYSYVHKDTYELLIQAVDVTLQDSTLQKVPDDPELTQCWRYNQPIQSVDDVKHE  215

Query  421  FKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDR  242
            F+   L+F +G  S+   +I PE+Y++++ +G+VCLG+ NG+E G+   N+IGD++MQ+ 
Sbjct  216  FEPLELTFTHG-ASQVTLDIPPENYIVVTERGNVCLGIHNGSEHGMGELNIIGDITMQNH  274

Query  241  MVIYDNEKNAIGWTRANCDRPPA  173
            +V+YDNE+  IGW RA+CD  P 
Sbjct  275  LVVYDNERARIGWVRASCDIMPG  297



>ref|XP_001783556.1| predicted protein [Physcomitrella patens]
 gb|EDQ51645.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 3/144 (2%)
 Frame = -3

Query  601  VFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY  422
            +FDSG+S++Y+    Y A L +VV++ +   L     D TLPFCW+G  PF S++DV  Y
Sbjct  255  MFDSGTSFTYLVPNAYTAVLSAVVRQAQRSGLERIKTDTTLPFCWRGPSPFESVADVSAY  314

Query  421  FKSFALSFANG--WRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ  248
            FK+  L F     W S  L E+SPE YLI+S++G+VCLGVL+ + A L   N++GD+SM+
Sbjct  315  FKTVTLDFGGSTWWSSGKLLELSPEGYLIVSTQGNVCLGVLDASVASLEVTNILGDISMR  374

Query  247  DRMVIYDNEKNAIGWTRANC-DRP  179
              +V+YDN +  IGW R NC +RP
Sbjct  375  GYLVVYDNMREQIGWVRRNCYNRP  398



>ref|XP_002511959.1| protein with unknown function [Ricinus communis]
 gb|EEF50628.1| protein with unknown function [Ricinus communis]
Length=583

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -3

Query  604  VVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK  425
            +VFDSGSSY+Y   + Y + L + +K++ G+ L +   DPTLPFCW+ + P RS+ DVK+
Sbjct  431  IVFDSGSSYTYFTKEAY-SELVASLKQVSGEALIQDTSDPTLPFCWRAKFPIRSVIDVKQ  489

Query  424  YFKSFALSFANGW-RSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ  248
            YFK+  L F + W    T F I PE YLIIS+KG+VCLG+L+G++    +  ++GD+S++
Sbjct  490  YFKTLTLQFGSKWWIISTKFRIPPEGYLIISNKGNVCLGILDGSDVHDGSSIILGDISLR  549

Query  247  DRMVIYDNEKNAIGWTRANCDRP  179
             +++IYDN  N IGWT+++C +P
Sbjct  550  GQLIIYDNVNNKIGWTQSDCIKP  572



>ref|XP_001766321.1| predicted protein [Physcomitrella patens]
 gb|EDQ68953.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 97/145 (67%), Gaps = 2/145 (1%)
 Frame = -3

Query  604  VVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK  425
            V+FDSG+S++Y+  + Y A L ++  ++    L     D TLPFCW+G  PF S++DV++
Sbjct  237  VMFDSGTSFTYLVPEAYNAVLSAMEMQVEKSGLVRIKTDNTLPFCWRGPSPFESVADVQR  296

Query  424  YFKSFALSFA--NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  251
            YFK+  L F   N + +  + E+SPE YLI+S++G+VCLG+L+ + A L   N+IGDVSM
Sbjct  297  YFKTVTLDFGKRNWYSASRVLELSPEGYLIVSTQGNVCLGILDASGASLEVTNIIGDVSM  356

Query  250  QDRMVIYDNEKNAIGWTRANCDRPP  176
            +  +V+YDN +N IGW R NC   P
Sbjct  357  RGYLVVYDNARNQIGWVRRNCHNRP  381



>gb|KHG10362.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10553.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10791.1| Asparticase Asp1 [Gossypium arboreum]
Length=490

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 101/180 (56%), Gaps = 31/180 (17%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K TG+K++ VVFDSGSSY+Y   Q YE  L  V + L  K L +   D  LP CWKG +P
Sbjct  270  KPTGIKDLKVVFDSGSSYTYFGFQVYEGVLNLVRESLTEKTL-DTVQDKALPICWKGTKP  328

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS---------------------  335
            F+S+ DVK YF +  L F +    +   E+ PE+YLI++                     
Sbjct  329  FKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTVSRSLVLQQNDINGHGYNNIS  386

Query  334  -------SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
                     G+ C G+LNGTEAGL + NVIGD+S+  +MV+YDNE+  IGW  A+C+R P
Sbjct  387  NMLFRSQEDGNACFGILNGTEAGLGDLNVIGDISLIGKMVVYDNEEQRIGWISADCNRLP  446



>ref|XP_010912572.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=411

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            +  G + + V  DSG++++Y    PY + + ++   +  +PL+ A DDP+LP+CW+G + 
Sbjct  263  QPLGSQLITVWLDSGTTFTYFGLHPYNSLISTLNGYVSTQPLKRAYDDPSLPYCWRGPQK  322

Query  451  FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLH-NY  275
            FR+I+D ++YFK   L FANG       ++ P +YLIISSKG+ CLG+LNGT+ GL  + 
Sbjct  323  FRTIADAQRYFKILELRFANG---AAPMKLPPVNYLIISSKGNACLGILNGTQVGLKPDE  379

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  182
            NVIGD+S+ D M+IYDN+K  IGW   N  R
Sbjct  380  NVIGDISLLDLMLIYDNDKKRIGWASTNFCR  410



>ref|XP_001782061.1| predicted protein [Physcomitrella patens]
 gb|EDQ53125.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = -3

Query  604  VVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK  425
            V+FDSG+S++Y+  Q Y + L +V K+     L     D TLP+CW+G  PF+SI+DV +
Sbjct  266  VMFDSGTSFTYLVPQAYASVLSAVTKQ---SGLLRVKSDTTLPYCWRGPSPFQSITDVHQ  322

Query  424  YFKSFALSFA--NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  251
            YFK+  L F   N + + +  ++SP+ YLI+S++G+VCLG+L+ + A L   N+IGDVSM
Sbjct  323  YFKTLTLDFGGRNWFATDSTLDLSPQGYLIVSTQGNVCLGILDASGASLEVTNIIGDVSM  382

Query  250  QDRMVIYDNEKNAIGWTRANC-DRPPAPNVVFI  155
            +  +V+YDN ++ IGW R NC  RP   +  F+
Sbjct  383  RGYLVVYDNVRDRIGWIRRNCHSRPTKTSSQFV  415



>gb|ABR18371.1| unknown [Picea sitchensis]
Length=446

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 93/147 (63%), Gaps = 2/147 (1%)
 Frame = -3

Query  622  GVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRS  443
            G K   ++FDSGS+Y+Y  +Q Y A L  V + L GK L +   D  L  CW+ +  FRS
Sbjct  298  GKKLGGIIFDSGSTYTYFTNQAYGAFLSVVKENLSGKQLEQDSSDSFLSLCWRRKEGFRS  357

Query  442  ISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIG  263
            +++   YFK   L F +    +   EI PE YL+++ KG+VCLG+LNGT  G+ + NV+G
Sbjct  358  VAEAAAYFKPLTLKFRSTKTKQ--MEIFPEGYLVVNKKGNVCLGILNGTAIGIVDTNVLG  415

Query  262  DVSMQDRMVIYDNEKNAIGWTRANCDR  182
            D+S Q ++V+YDNEKN IGW R++C  
Sbjct  416  DISFQGQLVVYDNEKNQIGWARSDCQE  442



>gb|KHG06665.1| Asparticase Asp1 [Gossypium arboreum]
Length=383

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 89/153 (58%), Gaps = 44/153 (29%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            K+TG+KN+ V+FDSGSSY+Y+NSQ Y+A    + KEL G+ L+EA +D TLP CWKGR+P
Sbjct  266  KATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELSGRSLKEAPEDQTLPLCWKGRKP  325

Query  451  FRSISDVKKYFK-SFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
            FRS+ D KKYFK S AL+FAN                                       
Sbjct  326  FRSVHDAKKYFKTSLALAFAN---------------------------------------  346

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
                ++SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  347  ----NISMQDRMVVYDNEKQVIGWSPANCDHLP  375



>ref|XP_006485774.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=577

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 5/152 (3%)
 Frame = -3

Query  622  GVKNMXV---VFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            G +N  V   +FD+GSSY+Y   Q Y + L + +KE+    L     DPTLP CW+ + P
Sbjct  416  GARNSRVGWALFDTGSSYTYFTKQAY-SELIASLKEVSSNGLVLDASDPTLPVCWRAKFP  474

Query  451  FRSISDVKKYFKSFALSFANGWR-SRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
             RSI DVK+YFK+  L F + W+   T F ISPE YL+IS KG++CLG+L+G+E    + 
Sbjct  475  IRSIVDVKQYFKTLTLHFGSKWQIVSTKFHISPEGYLVISKKGNICLGILDGSEVHNGST  534

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  179
             ++GD+S++ ++V+YDN    IGW +++C  P
Sbjct  535  IILGDISLRGQLVVYDNVNKRIGWAKSHCMNP  566



>gb|EMS52520.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=431

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = -3

Query  616  KNMXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSIS  437
            K   V+FDSGSSY+Y   + Y + + S+  E           D TLPFC K   P RS+ 
Sbjct  268  KLTQVIFDSGSSYTYFPHEIYTSLIASL--EAVSPGFVHDKSDQTLPFCMKPNFPVRSVD  325

Query  436  DVKKYFKSFALSFANGWR--SRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIG  263
            DVK+ FK   L F+  W    RT F ISPE+YLIIS KG+VCLGVL+GTE G  +  VIG
Sbjct  326  DVKQLFKPLLLHFSKAWLVIPRT-FAISPENYLIISDKGNVCLGVLDGTEIGHSSTIVIG  384

Query  262  DVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  161
            DVS++ ++V YDN++N IGW +++C RP   ++V
Sbjct  385  DVSLRGKLVAYDNDENQIGWAQSDCSRPQKASMV  418



>ref|NP_001065918.1| Os11g0184800 [Oryza sativa Japonica Group]
 sp|Q0IU52.1|ASP1_ORYSJ RecName: Full=Aspartic proteinase Asp1; Short=OSAP1; Short=OsAsp1; 
AltName: Full=Nucellin-like protein; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAQ14543.1|AF308691_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAQ14544.1|AF308692_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAY23267.1| nucellin-like protein [Oryza sativa Japonica Group]
 gb|ABA91764.1| Aspartic proteinase Asp1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27763.1| Os11g0184800 [Oryza sativa Japonica Group]
 dbj|BAG99045.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71282.1| aspartic proteinase [Oryza sativa Japonica Group]
Length=410

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 8/158 (5%)
 Frame = -3

Query  631  KSTGVKNMXVVFDSGSSYSYMNSQPYEAXLYSVVKEL---RGKPLREAGD-DPTLPFCWK  464
            K+     M V+FDSG++Y+Y  +QPY+A L SVVK       K L E  + D  L  CWK
Sbjct  245  KAISAAPMAVIFDSGATYTYFAAQPYQATL-SVVKSTLNSECKFLTEVTEKDRALTVCWK  303

Query  463  GRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEA--  290
            G+    +I +VKK F+S +L FA+G +  TL EI PE YLIIS +G VCLG+L+G++   
Sbjct  304  GKDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPPEHYLIISQEGHVCLGILDGSKEHL  362

Query  289  GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
             L   N+IG ++M D+MVIYD+E++ +GW    CDR P
Sbjct  363  SLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRIP  400



>gb|AAK81698.1| aspartyl proteinase [Oryza sativa]
Length=410

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 98/151 (65%), Gaps = 8/151 (5%)
 Frame = -3

Query  610  MXVVFDSGSSYSYMNSQPYEAXLYSVVKELRGKP---LREAGD-DPTLPFCWKGRRPFRS  443
            M V+FDSG++Y+Y   QPY A L SVVK    K    L E  + D  L  CWKG+   R+
Sbjct  252  MEVIFDSGATYTYFALQPYHATL-SVVKSTLSKECKFLTEVKEKDRALTVCWKGKDKIRT  310

Query  442  ISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEA--GLHNYNV  269
            I +VKK F+S +L FA+G +  TL EI PE YLIIS +G VCLG+L+G++    L   N+
Sbjct  311  IDEVKKCFRSLSLKFADGDKKATL-EIPPEHYLIISQEGHVCLGILDGSKEHPSLAGTNL  369

Query  268  IGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  176
            IG ++M D+MVIYD+E++ +GW    CDR P
Sbjct  370  IGGITMLDQMVIYDSERSLLGWVNYQCDRIP  400



>gb|KDO41977.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=577

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 98/152 (64%), Gaps = 5/152 (3%)
 Frame = -3

Query  622  GVKNMXV---VFDSGSSYSYMNSQPYEAXLYSVVKELRGKPLREAGDDPTLPFCWKGRRP  452
            G +N  V   +FD+GSSY+Y   Q Y + L + +KE+    L     DPTLP CW+ + P
Sbjct  416  GARNSQVGWALFDTGSSYTYFTKQAY-SELIASLKEVSSDGLVLDASDPTLPVCWRAKFP  474

Query  451  FRSISDVKKYFKSFALSFANGWR-SRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY  275
             RSI DVK++FK+  L F + W+   T F ISPE YL+IS KG++CLG+L+G+E    + 
Sbjct  475  IRSIVDVKQFFKTLTLHFGSKWQIVSTKFHISPEGYLVISKKGNICLGILDGSEVHNGST  534

Query  274  NVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  179
             ++GD+S++ ++V+YDN    IGW +++C  P
Sbjct  535  IILGDISLRGQLVVYDNVNKRIGWAKSHCMNP  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500