BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042P14

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        220   5e-65   Ipomoea nil [qian niu]
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               183   5e-51   Nicotiana tomentosiformis
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               177   6e-49   Nicotiana sylvestris
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               177   7e-49   Solanum tuberosum [potatoes]
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               176   1e-48   Sesamum indicum [beniseed]
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               174   1e-47   Nicotiana tomentosiformis
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               174   1e-47   Nicotiana tomentosiformis
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               171   1e-46   
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                170   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               170   5e-46   Solanum tuberosum [potatoes]
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               169   1e-45   Solanum lycopersicum
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               168   1e-45   
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               168   2e-45   
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               167   2e-45   Solanum tuberosum [potatoes]
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                166   9e-45   Erythranthe guttata [common monkey flower]
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               166   1e-44   Solanum lycopersicum
gb|AJD25225.1|  cytochrome P450 CYP96A85                                166   1e-44   Salvia miltiorrhiza [Chinese salvia]
emb|CDP18605.1|  unnamed protein product                                164   2e-44   Coffea canephora [robusta coffee]
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                165   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    163   1e-43   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               162   2e-43   Nicotiana sylvestris
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               161   6e-43   Nicotiana tomentosiformis
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               161   6e-43   Nicotiana sylvestris
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               160   1e-42   Solanum lycopersicum
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                157   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               157   1e-41   Nicotiana tomentosiformis
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                156   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               157   2e-41   
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               154   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               154   2e-40   Eucalyptus grandis [rose gum]
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         153   6e-40   Jatropha curcas
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         152   1e-39   Jatropha curcas
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       152   1e-39   Cucumis sativus [cucumbers]
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               152   1e-39   
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               152   1e-39   Eucalyptus grandis [rose gum]
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               152   1e-39   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       152   2e-39   Cucumis sativus [cucumbers]
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               152   2e-39   Nicotiana tomentosiformis
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               151   2e-39   Eucalyptus grandis [rose gum]
gb|AEI59774.1|  cytochrome P450                                         151   2e-39   Helianthus annuus
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               151   2e-39   
gb|EPS60789.1|  hypothetical protein M569_14012                         151   2e-39   Genlisea aurea
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    151   3e-39   
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    150   6e-39   Solanum lycopersicum
gb|AES86633.2|  cytochrome P450 family protein                          144   9e-39   Medicago truncatula
ref|XP_004157876.1|  PREDICTED: cytochrome P450 86B1-like               147   9e-39   
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               149   1e-38   Solanum tuberosum [potatoes]
ref|XP_006374652.1|  cytochrome P450 family protein                     149   1e-38   
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               149   2e-38   
ref|XP_010681243.1|  PREDICTED: cytochrome P450 86B1-like               144   2e-38   
gb|KDO37383.1|  hypothetical protein CISIN_1g042798mg                   144   2e-38   Citrus sinensis [apfelsine]
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               148   2e-38   Sesamum indicum [beniseed]
gb|KEH22137.1|  cytochrome P450 family protein                          148   2e-38   Medicago truncatula
gb|KGN48429.1|  hypothetical protein Csa_6G487010                       147   3e-38   Cucumis sativus [cucumbers]
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               148   3e-38   Eucalyptus grandis [rose gum]
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               147   3e-38   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               148   3e-38   
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               148   3e-38   Cucumis melo [Oriental melon]
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               148   4e-38   Sesamum indicum [beniseed]
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               148   4e-38   
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               148   4e-38   Cucumis sativus [cucumbers]
emb|CDP12890.1|  unnamed protein product                                147   4e-38   Coffea canephora [robusta coffee]
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               147   4e-38   Nicotiana sylvestris
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    147   4e-38   Cucumis melo [Oriental melon]
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    147   4e-38   
gb|KEH40828.1|  cytochrome P450 family protein                          147   4e-38   Medicago truncatula
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               147   4e-38   Nicotiana tomentosiformis
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                147   5e-38   Erythranthe guttata [common monkey flower]
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               147   5e-38   Populus euphratica
ref|XP_008441105.1|  PREDICTED: cytochrome P450 86B1-like               146   5e-38   Cucumis melo [Oriental melon]
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               147   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    147   5e-38   
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       147   6e-38   Cucumis sativus [cucumbers]
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     147   7e-38   Eucalyptus grandis [rose gum]
gb|KEH24777.1|  cytochrome P450 family protein                          147   8e-38   Medicago truncatula
gb|KEH40819.1|  cytochrome P450 family protein                          147   8e-38   Medicago truncatula
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     147   8e-38   Eucalyptus grandis [rose gum]
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               146   1e-37   Populus euphratica
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               146   1e-37   Nicotiana sylvestris
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             146   1e-37   Phaseolus vulgaris [French bean]
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               146   2e-37   Eucalyptus grandis [rose gum]
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               146   2e-37   Sesamum indicum [beniseed]
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    145   2e-37   
gb|KEH40811.1|  cytochrome P450 family protein                          145   3e-37   Medicago truncatula
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               145   3e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    145   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40835.1|  cytochrome P450 family protein                          145   3e-37   Medicago truncatula
ref|XP_010681238.1|  PREDICTED: cytochrome P450 86A1-like               138   3e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40823.1|  cytochrome P450 family protein                          145   3e-37   Medicago truncatula
gb|KEH40805.1|  cytochrome P450 family protein                          145   3e-37   Medicago truncatula
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               145   3e-37   
emb|CDM81752.1|  unnamed protein product                                145   4e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004492144.1|  PREDICTED: cytochrome P450 86B1-like               145   4e-37   
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               145   5e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               144   5e-37   Cicer arietinum [garbanzo]
emb|CDP12888.1|  unnamed protein product                                144   5e-37   Coffea canephora [robusta coffee]
ref|XP_002521474.1|  cytochrome P450, putative                          144   5e-37   Ricinus communis
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               144   5e-37   Eucalyptus grandis [rose gum]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               144   6e-37   Nicotiana tomentosiformis
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               144   6e-37   
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             144   6e-37   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                144   6e-37   Erythranthe guttata [common monkey flower]
gb|KEH40839.1|  cytochrome P450 family protein                          144   7e-37   Medicago truncatula
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                144   7e-37   Erythranthe guttata [common monkey flower]
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               144   8e-37   Camelina sativa [gold-of-pleasure]
gb|KEH22136.1|  cytochrome P450 family protein                          144   8e-37   Medicago truncatula
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             144   9e-37   
ref|XP_003604436.1|  Cytochrome P450                                    144   1e-36   
emb|CDY39928.1|  BnaA09g15100D                                          144   1e-36   Brassica napus [oilseed rape]
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               144   1e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         143   1e-36   Jatropha curcas
ref|XP_010431920.1|  PREDICTED: cytochrome P450 86B1-like               142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               143   1e-36   Camelina sativa [gold-of-pleasure]
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                    142   2e-36   Arabis alpina [alpine rockcress]
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           143   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35255.1|  hypothetical protein JCGZ_09414                         139   2e-36   Jatropha curcas
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             143   2e-36   Capsella rubella
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               143   2e-36   Populus euphratica
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               143   2e-36   Brassica rapa
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             143   2e-36   
gb|KEH40821.1|  cytochrome P450 family protein                          143   2e-36   Medicago truncatula
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               142   3e-36   Glycine max [soybeans]
emb|CDY39927.1|  BnaA09g15090D                                          142   3e-36   Brassica napus [oilseed rape]
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               142   3e-36   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             142   4e-36   Phaseolus vulgaris [French bean]
ref|XP_002866852.1|  CYP96A9                                            142   4e-36   Arabidopsis lyrata subsp. lyrata
emb|CDM81753.1|  unnamed protein product                                142   4e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002869292.1|  CYP96A2                                            142   4e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               142   4e-36   Solanum lycopersicum
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         142   4e-36   
gb|EEC70068.1|  hypothetical protein OsI_00672                          135   4e-36   Oryza sativa Indica Group [Indian rice]
gb|EPS65366.1|  hypothetical protein M569_09411                         142   4e-36   Genlisea aurea
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               142   5e-36   Nicotiana sylvestris
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               142   5e-36   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         142   5e-36   Jatropha curcas
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    142   5e-36   
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               142   6e-36   Brassica rapa
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    141   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001042227.2|  Os01g0183500                                       135   6e-36   
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             142   6e-36   Populus trichocarpa [western balsam poplar]
gb|KEH40830.1|  cytochrome P450 family protein                          141   7e-36   Medicago truncatula
gb|EYU43136.1|  hypothetical protein MIMGU_mgv1a007195mg                140   7e-36   Erythranthe guttata [common monkey flower]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               141   7e-36   Populus euphratica
emb|CAB44684.1|  cytochrome P450-like protein                           141   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             141   8e-36   Phaseolus vulgaris [French bean]
emb|CDP12889.1|  unnamed protein product                                141   8e-36   Coffea canephora [robusta coffee]
ref|XP_002866853.1|  CYP96A10                                           141   9e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_002529227.1|  cytochrome P450, putative                          141   9e-36   Ricinus communis
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                141   9e-36   Erythranthe guttata [common monkey flower]
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             141   1e-35   
emb|CDY70657.1|  BnaAnng34520D                                          133   1e-35   Brassica napus [oilseed rape]
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    140   1e-35   Vitis vinifera
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               140   1e-35   
gb|AJD25224.1|  cytochrome P450 CYP96A84                                140   1e-35   Salvia miltiorrhiza [Chinese salvia]
gb|KHM99046.1|  Cytochrome P450 86B1                                    140   1e-35   Glycine soja [wild soybean]
ref|XP_002888363.1|  hypothetical protein ARALYDRAFT_338681             136   1e-35   
gb|KHM99045.1|  Cytochrome P450 86B1                                    134   1e-35   Glycine soja [wild soybean]
ref|NP_001140984.1|  putative cytochrome P450 superfamily protein       138   2e-35   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             140   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               140   2e-35   
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    140   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             140   2e-35   Eutrema salsugineum [saltwater cress]
gb|KEH40818.1|  cytochrome P450 family protein                          140   2e-35   Medicago truncatula
emb|CDY53179.1|  BnaA06g40580D                                          140   2e-35   Brassica napus [oilseed rape]
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               140   2e-35   Glycine max [soybeans]
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    140   2e-35   Brassica rapa
ref|XP_008440137.1|  PREDICTED: cytochrome P450 86B1-like               139   2e-35   
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               140   2e-35   Sesamum indicum [beniseed]
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    140   2e-35   Arabis alpina [alpine rockcress]
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             140   3e-35   Phaseolus vulgaris [French bean]
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               140   3e-35   Tarenaya hassleriana [spider flower]
gb|KJB44293.1|  hypothetical protein B456_007G244800                    139   3e-35   Gossypium raimondii
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               139   3e-35   
emb|CAN80536.1|  hypothetical protein VITISV_035975                     139   3e-35   Vitis vinifera
ref|XP_002888362.1|  hypothetical protein ARALYDRAFT_894004             134   3e-35   
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               139   3e-35   Cucumis sativus [cucumbers]
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                139   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_004513611.1|  PREDICTED: cytochrome P450 86B1-like               139   4e-35   
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   139   4e-35   Citrus sinensis [apfelsine]
ref|XP_010681240.1|  PREDICTED: cytochrome P450 86A7-like               138   4e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40842.1|  cytochrome P450 family protein                          139   4e-35   Medicago truncatula
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    139   4e-35   Vitis vinifera
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             139   5e-35   Capsella rubella
ref|NP_001048917.1|  Os03g0140100                                       139   5e-35   
gb|KHN27470.1|  Cytochrome P450 86B1                                    138   5e-35   Glycine soja [wild soybean]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               139   5e-35   Setaria italica
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             139   5e-35   Eutrema salsugineum [saltwater cress]
gb|KEH40822.1|  cytochrome P450 family protein                          139   5e-35   Medicago truncatula
gb|EPS67771.1|  hypothetical protein M569_06997                         139   6e-35   Genlisea aurea
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             139   6e-35   Phaseolus vulgaris [French bean]
ref|XP_007048137.1|  Cytochrome P450                                    139   6e-35   
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       139   6e-35   Cucumis sativus [cucumbers]
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             139   7e-35   Citrus clementina [clementine]
gb|KEH24772.1|  cytochrome P450 family protein                          139   8e-35   Medicago truncatula
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               138   8e-35   Nicotiana tomentosiformis
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                138   9e-35   Erythranthe guttata [common monkey flower]
gb|EAY88476.1|  hypothetical protein OsI_09947                          138   9e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               138   9e-35   
gb|ACR38435.1|  unknown                                                 138   1e-34   Zea mays [maize]
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               138   1e-34   Populus euphratica
ref|XP_002521476.1|  cytochrome P450, putative                          138   1e-34   
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    137   1e-34   Arabis alpina [alpine rockcress]
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               137   2e-34   Nicotiana sylvestris
gb|KJB44331.1|  hypothetical protein B456_007G246400                    137   2e-34   Gossypium raimondii
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    137   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN45347.1|  Cytochrome P450 86B1                                    137   2e-34   Glycine soja [wild soybean]
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               137   2e-34   Glycine max [soybeans]
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             137   2e-34   Capsella rubella
ref|XP_003629932.1|  Cytochrome P450                                    137   2e-34   Medicago truncatula
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    137   2e-34   Glycine max [soybeans]
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                137   2e-34   Erythranthe guttata [common monkey flower]
gb|KHN19669.1|  Cytochrome P450 86B1                                    137   2e-34   Glycine soja [wild soybean]
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          137   2e-34   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             137   2e-34   Phaseolus vulgaris [French bean]
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               137   2e-34   Arabis alpina [alpine rockcress]
gb|EMT22280.1|  Cytochrome P450 86A2                                    131   2e-34   
gb|KHN19678.1|  Cytochrome P450 86B1                                    136   3e-34   Glycine soja [wild soybean]
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    137   3e-34   
emb|CDY39934.1|  BnaA09g15160D                                          137   3e-34   Brassica napus [oilseed rape]
gb|EPS72790.1|  hypothetical protein M569_01963                         137   3e-34   Genlisea aurea
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               137   3e-34   Phoenix dactylifera
ref|XP_002888361.1|  predicted protein                                  135   3e-34   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         137   3e-34   Jatropha curcas
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    137   3e-34   Arabis alpina [alpine rockcress]
emb|CDY46088.1|  BnaA09g42120D                                          136   4e-34   Brassica napus [oilseed rape]
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               136   4e-34   
gb|KEH24773.1|  cytochrome P450 family protein                          136   4e-34   Medicago truncatula
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                136   4e-34   Erythranthe guttata [common monkey flower]
emb|CDY39926.1|  BnaA09g15080D                                          136   4e-34   Brassica napus [oilseed rape]
gb|EMT05588.1|  Cytochrome P450 86A2                                    136   5e-34   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               136   5e-34   
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               136   6e-34   Glycine max [soybeans]
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             136   6e-34   Capsella rubella
ref|NP_001048918.1|  Os03g0140200                                       131   6e-34   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               136   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               136   7e-34   Cicer arietinum [garbanzo]
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    135   7e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94304.1|  cytochrome p450 - like protein                         135   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    135   7e-34   Vitis vinifera
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             135   7e-34   
dbj|BAA99522.1|  putative cytochrome P450                               135   8e-34   Oryza sativa Japonica Group [Japonica rice]
gb|KEH24775.1|  cytochrome P450 family protein                          135   8e-34   Medicago truncatula
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             135   9e-34   Phaseolus vulgaris [French bean]
gb|KHN27468.1|  Cytochrome P450 86B1                                    135   9e-34   Glycine soja [wild soybean]
gb|EPS59359.1|  hypothetical protein M569_15450                         134   1e-33   Genlisea aurea
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   Brassica rapa
ref|XP_002878665.1|  CYP96A1                                            135   1e-33   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             135   1e-33   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   Nicotiana sylvestris
emb|CDY53181.1|  BnaA06g40600D                                          135   1e-33   Brassica napus [oilseed rape]
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein      135   1e-33   
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    135   1e-33   Brassica rapa
gb|EMT10523.1|  Cytochrome P450 86A1                                    127   1e-33   
gb|KHN19680.1|  Cytochrome P450 86B1                                    135   1e-33   Glycine soja [wild soybean]
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   
ref|XP_010472324.1|  PREDICTED: cytochrome P450 86B1-like               130   1e-33   
gb|AGV40485.1|  hypothetical protein                                    135   1e-33   Phaseolus vulgaris [French bean]
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   Glycine max [soybeans]
emb|CDY68678.1|  BnaCnng60030D                                          134   2e-33   Brassica napus [oilseed rape]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    135   2e-33   Brassica rapa
gb|EMT10522.1|  Cytochrome P450 86A1                                    134   2e-33   
gb|KEH41380.1|  cytochrome P450 family protein                          134   2e-33   Medicago truncatula
ref|XP_006396175.1|  hypothetical protein EUTSA_v10002359mg             130   2e-33   
gb|KEH24774.1|  cytochrome P450 family protein                          134   2e-33   Medicago truncatula
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    134   2e-33   Arabis alpina [alpine rockcress]
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               134   2e-33   Tarenaya hassleriana [spider flower]
emb|CDX72695.1|  BnaC07g47170D                                          134   2e-33   
emb|CDY58383.1|  BnaC09g51620D                                          134   2e-33   Brassica napus [oilseed rape]
emb|CDY12435.1|  BnaC08g09240D                                          134   2e-33   Brassica napus [oilseed rape]
dbj|BAJ85246.1|  predicted protein                                      134   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY38914.1|  BnaA03g12650D                                          129   3e-33   Brassica napus [oilseed rape]
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    134   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               134   3e-33   Camelina sativa [gold-of-pleasure]
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          134   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               134   3e-33   Oryza brachyantha
ref|XP_010473758.1|  PREDICTED: cytochrome P450 86B1-like               133   4e-33   
gb|EMT01870.1|  Cytochrome P450 86A2                                    132   4e-33   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               134   4e-33   
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    134   4e-33   
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    133   5e-33   
dbj|BAJ89570.1|  predicted protein                                      133   5e-33   
gb|EMT01671.1|  Cytochrome P450 86A2                                    134   5e-33   
gb|EMS48808.1|  Cytochrome P450 86B1                                    133   5e-33   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             133   6e-33   
ref|NP_001141467.1|  uncharacterized protein LOC100273577               133   6e-33   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               133   6e-33   
gb|KJB33823.1|  hypothetical protein B456_006G032600                    133   6e-33   
gb|KEH42495.1|  cytochrome P450 family protein                          134   7e-33   
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               133   7e-33   
gb|KDO45858.1|  hypothetical protein CISIN_1g047974mg                   133   7e-33   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             133   8e-33   
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610          132   8e-33   
ref|XP_002534255.1|  conserved hypothetical protein                     127   8e-33   
ref|XP_010666954.1|  PREDICTED: cytochrome P450 86B1-like               131   9e-33   
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               132   9e-33   
gb|EEC74485.1|  hypothetical protein OsI_09945                          132   1e-32   
gb|EMT14219.1|  Cytochrome P450 86A2                                    132   1e-32   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          132   1e-32   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             132   1e-32   
dbj|BAK06179.1|  predicted protein                                      132   1e-32   
emb|CDY39931.1|  BnaA09g15130D                                          132   1e-32   
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    132   1e-32   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               132   1e-32   
gb|EAY88477.1|  hypothetical protein OsI_09948                          132   2e-32   
gb|KJB33822.1|  hypothetical protein B456_006G032500                    132   2e-32   
gb|EMT22279.1|  Cytochrome P450 86A1                                    132   2e-32   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               132   2e-32   
emb|CDY29175.1|  BnaC09g15720D                                          131   2e-32   
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             131   2e-32   
ref|XP_010463248.1|  PREDICTED: cytochrome P450 86A8-like               127   2e-32   
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    131   2e-32   
gb|EMS45869.1|  Cytochrome P450 86B1                                    131   2e-32   
gb|ABF93891.1|  Cytochrome P450 family protein                          132   2e-32   
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             131   2e-32   
emb|CDY27160.1|  BnaA08g07980D                                          131   2e-32   
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               131   2e-32   
ref|XP_010513495.1|  PREDICTED: cytochrome P450 86B1-like               128   3e-32   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   131   3e-32   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             134   3e-32   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    131   3e-32   
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               131   3e-32   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               131   3e-32   
emb|CDP04331.1|  unnamed protein product                                131   3e-32   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    130   3e-32   
ref|XP_006392373.1|  hypothetical protein EUTSA_v10023421mg             130   3e-32   
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             130   4e-32   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             131   4e-32   
gb|EYU33750.1|  hypothetical protein MIMGU_mgv1a020734mg                128   4e-32   
gb|EMT16734.1|  Cytochrome P450 704C1                                   129   4e-32   
gb|EPS60696.1|  hypothetical protein M569_14105                         130   4e-32   
emb|CDY71054.1|  BnaAnng35910D                                          128   4e-32   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     132   4e-32   
ref|XP_002894061.1|  CYP96A8                                            131   4e-32   
emb|CDX76867.1|  BnaC08g34530D                                          130   4e-32   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               130   5e-32   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               130   5e-32   
ref|XP_006464845.1|  PREDICTED: cytochrome P450 86B1-like               130   6e-32   
ref|XP_007031595.1|  Cytochrome P450, putative                          130   6e-32   
gb|EPS57870.1|  hypothetical protein M569_16947                         130   6e-32   
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             130   6e-32   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    130   7e-32
ref|XP_006427985.1|  hypothetical protein CICLE_v10025385mg             130   8e-32   
dbj|BAK07250.1|  predicted protein                                      130   8e-32   
gb|KHN27469.1|  Cytochrome P450 86B1                                    129   9e-32   
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               130   1e-31   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            130   1e-31   
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             129   1e-31   
emb|CDY37891.1|  BnaC04g31150D                                          128   1e-31   
emb|CDX72690.1|  BnaC07g47120D                                          129   1e-31   
emb|CDX90338.1|  BnaA08g16460D                                          129   1e-31   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             129   1e-31   
emb|CDX90336.1|  BnaA08g16480D                                          129   1e-31   
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               129   1e-31   
gb|EMS52666.1|  Cytochrome P450 86B1                                    129   2e-31   
ref|XP_002865881.1|  hypothetical protein ARALYDRAFT_331566             129   2e-31   
gb|EMS50674.1|  Cytochrome P450 86B1                                    129   2e-31   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_006651022.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             129   2e-31   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
gb|AAS58486.1|  phytochrome P450-like protein                           129   2e-31   
ref|XP_002894062.1|  CYP96A8                                            129   2e-31   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_002307182.1|  cytochrome P450 family protein                     128   3e-31   
ref|XP_010474120.1|  PREDICTED: cytochrome P450 86B1-like               129   3e-31   
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg             128   3e-31   
emb|CDY39035.1|  BnaA02g17240D                                          128   3e-31   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               128   3e-31   
gb|EAY88475.1|  hypothetical protein OsI_09946                          128   3e-31   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               128   3e-31   
emb|CDY53177.1|  BnaA06g40560D                                          128   3e-31   
emb|CDY32582.1|  BnaC03g15500D                                          127   3e-31   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         128   4e-31   
gb|EMT27434.1|  Cytochrome P450 86A2                                    128   4e-31   
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             128   4e-31   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    128   4e-31   
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             128   4e-31   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    128   4e-31   
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         127   5e-31   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               128   5e-31   
gb|AIE57505.1|  MAH1                                                    127   5e-31   
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               127   6e-31   
emb|CDM86413.1|  unnamed protein product                                127   6e-31   
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    127   6e-31   
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             127   6e-31   
emb|CBH32604.1|  cytochrome P450, putative, expressed                   127   6e-31   
ref|XP_004960856.1|  PREDICTED: cytochrome P450 86B1-like               127   7e-31   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               127   7e-31   
ref|XP_006282428.1|  hypothetical protein CARUB_v100285721mg            125   7e-31   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               127   9e-31   
ref|XP_002439386.1|  hypothetical protein SORBIDRAFT_09g005590          127   9e-31   
gb|AAW57813.1|  putative cytochrome P450                                127   9e-31   
ref|XP_011022068.1|  PREDICTED: cytochrome P450 86B1-like               127   1e-30   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               127   1e-30   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               127   1e-30   
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    127   1e-30   
emb|CDX79038.1|  BnaA01g11050D                                          126   1e-30   
emb|CDX74502.1|  BnaA04g08870D                                          125   1e-30   
gb|EEE62550.1|  hypothetical protein OsJ_17349                          126   1e-30   
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    126   1e-30   
gb|EMT17849.1|  Cytochrome P450 86A2                                    126   1e-30   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             126   1e-30   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               126   1e-30   
ref|NP_001054813.1|  Os05g0181200                                       126   2e-30   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    126   2e-30   
gb|ABF93892.1|  Cytochrome P450 family protein                          126   2e-30   
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
dbj|BAJ86572.1|  predicted protein                                      126   2e-30   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    126   2e-30   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    126   2e-30   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
dbj|BAC42841.1|  putative cytochrome P450                               126   2e-30   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
emb|CDY66735.1|  BnaC03g60620D                                          126   2e-30   
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
gb|EAY88479.1|  hypothetical protein OsI_09950                          126   2e-30   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
ref|XP_006649381.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               125   3e-30   
emb|CDX72693.1|  BnaC07g47150D                                          125   3e-30   
gb|EMS62655.1|  Cytochrome P450 86B1                                    126   3e-30   
emb|CDX90337.1|  BnaA08g16470D                                          125   3e-30   
gb|ABF93896.1|  Cytochrome P450 family protein, expressed               125   3e-30   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               125   3e-30   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               125   3e-30   
gb|EMS50899.1|  Cytochrome P450 86B1                                    125   3e-30   
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               125   3e-30   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    125   3e-30   
gb|EEE58297.1|  hypothetical protein OsJ_09348                          125   3e-30   
emb|CDY42628.1|  BnaC01g00400D                                          125   4e-30   
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               125   4e-30   
gb|ACG36565.1|  cytochrome P450 CYP96D3                                 125   4e-30   
ref|NP_001141058.1|  putative cytochrome P450 superfamily protein       125   4e-30   
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    125   4e-30   
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    125   4e-30   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               125   4e-30   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               125   4e-30   
gb|EMT01909.1|  Cytochrome P450 86A1                                    124   4e-30   
ref|XP_002878579.1|  CYP96A5                                            125   4e-30   
gb|EMS49628.1|  Cytochrome P450 86B1                                    125   4e-30   
emb|CDY53178.1|  BnaA06g40570D                                          125   5e-30   
ref|XP_006281509.1|  hypothetical protein CARUB_v10027607mg             120   5e-30   
gb|EEC78633.1|  hypothetical protein OsI_18702                          125   6e-30   
gb|EMS50900.1|  Cytochrome P450 86B1                                    124   6e-30   
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               124   6e-30   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             125   7e-30   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               124   7e-30   
ref|XP_002865907.1|  CYP96A4                                            124   7e-30   
ref|XP_007019555.1|  Cytochrome P450                                    124   8e-30   
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like               124   8e-30   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               124   9e-30   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               124   9e-30   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               124   9e-30   
gb|KHG15665.1|  Cytochrome P450 protein                                 117   1e-29   
ref|XP_009614109.1|  PREDICTED: cytochrome P450 86B1-like               123   1e-29   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             124   1e-29   
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             124   1e-29   
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             124   1e-29   
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             124   1e-29   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               124   1e-29   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    124   1e-29   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               124   1e-29   
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         123   1e-29   
ref|XP_002868909.1|  CYP96A12                                           123   2e-29   
ref|XP_002457225.1|  hypothetical protein SORBIDRAFT_03g003600          123   2e-29   
emb|CDX76962.1|  BnaC08g35480D                                          123   2e-29   
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               123   2e-29   
gb|EMT17850.1|  Cytochrome P450 86A1                                    123   2e-29   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like               124   2e-29   
ref|XP_009400990.1|  PREDICTED: cytochrome P450 86B1-like               120   2e-29   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    123   3e-29   
ref|XP_010474420.1|  PREDICTED: cytochrome P450 86A4-like               122   3e-29   
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               122   3e-29   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like               124   3e-29   
ref|XP_010417232.1|  PREDICTED: cytochrome P450 86A8-like               117   4e-29   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               122   4e-29   
ref|XP_008389311.1|  PREDICTED: cytochrome P450 86B1-like               122   4e-29   
emb|CDX82804.1|  BnaC01g12540D                                          122   4e-29   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               122   5e-29   
gb|KJB47429.1|  hypothetical protein B456_008G026100                    122   5e-29   
ref|XP_007019556.1|  Cytochrome P450                                    122   5e-29   
ref|XP_010513569.1|  PREDICTED: cytochrome P450 86A2-like               120   6e-29   
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    122   6e-29   
emb|CDY44658.1|  BnaA08g06820D                                          122   7e-29   
ref|NP_001137105.1|  uncharacterized protein LOC100217282               116   7e-29   
ref|XP_007042368.1|  Cytochrome P450-like protein                       121   8e-29   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like               122   8e-29   
ref|XP_009354420.1|  PREDICTED: cytochrome P450 86B1-like               121   1e-28   
ref|XP_010444890.1|  PREDICTED: cytochrome P450 86A8-like               119   1e-28   
ref|XP_007041219.1|  Cytochrome P450, putative                          121   1e-28   
ref|XP_010242505.1|  PREDICTED: cytochrome P450 86B1-like               121   1e-28   
ref|XP_008389072.1|  PREDICTED: cytochrome P450 86B1-like               122   1e-28   
ref|XP_010269253.1|  PREDICTED: cytochrome P450 86B1-like               121   1e-28   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like               121   2e-28   
ref|XP_002464461.1|  hypothetical protein SORBIDRAFT_01g018855          120   2e-28   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AI+HKVS  MDVLPSGHLVKPNTR+IL FYSSGRMDSIWGEDCMEFKPERWIS  GRIKH
Sbjct  396  AIQHKVSTAMDVLPSGHLVKPNTRIILLFYSSGRMDSIWGEDCMEFKPERWISGNGRIKH  455

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTCLGKEM  VQMKMIAAIILHHYEFQVVDSHSVSPSDSIIIQAKHG
Sbjct  456  EPSYKFPAFNAGPRTCLGKEMSFVQMKMIAAIILHHYEFQVVDSHSVSPSDSIIIQAKHG  515

Query  241  LKVKFTKRN  215
            LKVKFTKR+
Sbjct  516  LKVKFTKRS  524



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKVS   D+LPSGH V PNTR++LSFY+ GRM++IWG+DC+EFKPERWIS +G+IKH
Sbjct  382  SLEHKVSLEFDILPSGHRVNPNTRIVLSFYTMGRMENIWGKDCLEFKPERWISEQGKIKH  441

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTCLGKEM L+QMKMIAA I++ Y  Q++++ ++SPS SII+Q KHG
Sbjct  442  EPSFKFPAFNAGPRTCLGKEMALIQMKMIAATIIYSYHIQLMEAQTISPSASIIVQMKHG  501

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  502  LKVRIVKR  509



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V PNTR++LSFY+ GRM++IWG+DC+EFKPERWIS KG+IKH
Sbjct  382  SLEHKVPLESDILPSGHRVNPNTRIVLSFYTMGRMETIWGKDCLEFKPERWISEKGKIKH  441

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTCLGKEM  +QMKM+ A I+H Y  Q+V+  ++SPS SII+Q KHG
Sbjct  442  EPSFKFPAFNAGPRTCLGKEMAFIQMKMMVATIIHSYHIQLVEGQTISPSASIIVQMKHG  501

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  502  LKVRLFKR  509



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AIEHK+    D+LPSGH V PNTR++LSFY+ GRM+SIWG+DC+EFKPERWIS +G IKH
Sbjct  383  AIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISERGGIKH  442

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTC+GKEM  +QMK++AA I+++Y  Q+ +   + P+ S+IIQ KHG
Sbjct  443  EPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIQLGEDQIILPNSSVIIQMKHG  502

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  503  LKVRLVKR  510



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D LPSG+ ++PNT++I+SFYS+GRM+S+WG+DC+EFKPERWIS  G  KH
Sbjct  374  ALEHKAPIAPDTLPSGNYLEPNTKIIVSFYSTGRMESVWGKDCLEFKPERWISKGGGTKH  433

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTCLGKEM  VQMKM+AA I++HY  Q+V+ H V+PSDS+I+QAKHG
Sbjct  434  EPSYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIIYHYNLQLVEDHPVTPSDSVILQAKHG  493

Query  241  LKVKFTKRNT  212
            LKV+  +RN 
Sbjct  494  LKVRLFRRNV  503



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V P TRMI+ FYS GRM++IWG+DC+EFKPERWIS +G IKH
Sbjct  382  SLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIWGKDCLEFKPERWISERGGIKH  441

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTC+GKEM  VQMK++AAIIL++Y+ Q+V++ + SP+ SII+Q KHG
Sbjct  442  EPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYDIQLVEAQNSSPTTSIIMQMKHG  501

Query  241  LKVKFTKR  218
            L V+  KR
Sbjct  502  LMVRVVKR  509



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V P TRMI+ FYS GRM++IWG+DC+EFKPERWIS +G IKH
Sbjct  382  SLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIWGKDCLEFKPERWISERGGIKH  441

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTC+GKEM  VQMK++AAIIL++Y+ Q+V++ + SP+ SII+Q KHG
Sbjct  442  EPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYDIQLVEAQNSSPTTSIIMQMKHG  501

Query  241  LKVKFTKR  218
            L V+  KR
Sbjct  502  LMVRVVKR  509



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AIEHK+    D+LPSGH V PNTR++LSFY+ GRM+SIWG+DC+EFKPERWIS +G IKH
Sbjct  369  AIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISERGGIKH  428

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTC+GKEM  +QMK++AA I+++Y  + ++   + P+ S+IIQ KHG
Sbjct  429  EPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIK-LEDQIILPNSSVIIQMKHG  487

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  488  LKVRLVKR  495



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D+LPSG+ +KPNT++I+SFYS+GRM+S+WG+DC+EFKPERWIS  GR KH
Sbjct  344  ALEHKAPIEPDILPSGNQLKPNTKVIVSFYSTGRMESVWGKDCLEFKPERWISDSGRTKH  403

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvd---shsvspsdsiiIQA  251
            EPSYKFPAFNAGPRTCLGKEM   QMKM+AA I++ Y+ ++++      VSP DSII+QA
Sbjct  404  EPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYRYKIELLEGRGYPVVSPRDSIILQA  463

Query  250  KHGLKVKFTKRN  215
            KHGLKV+ + RN
Sbjct  464  KHGLKVRLSTRN  475



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AIEHK+    D+LPSGH V PN R++LS Y+ GRM+SIWGEDC+EFKPERWIS +G IKH
Sbjct  383  AIEHKLPHDFDILPSGHHVSPNMRIVLSLYTMGRMESIWGEDCLEFKPERWISKRGGIKH  442

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KF AFNAGPRTC+GKEM  +QMK++AA I+++Y  Q+ +   +SPS SIIIQ KHG
Sbjct  443  EPSFKFSAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIQLGEDQIISPSASIIIQMKHG  502

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  503  LKVRLVKR  510



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LP+GH V P TRMIL FY  GRM+++WG+DC+EFKPERWIS +G IKH
Sbjct  380  SLEHKVPLDHDILPTGHRVSPKTRMILPFYVMGRMETLWGKDCLEFKPERWISERGGIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTCLGKEM  +QMK++AA I+H+Y  QVV+  +V P+ SII+Q K+G
Sbjct  440  EPSFKFPAFNAGPRTCLGKEMAFIQMKIVAATIIHNYNIQVVEPQNVYPTTSIIMQVKNG  499

Query  241  LKVKFTKR  218
            L VK  KR
Sbjct  500  LMVKVVKR  507



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D+LPSGH +  N ++I SFYS GRM+++WG+DC+EF+P+RWI+  GRIKH
Sbjct  363  ALEHKAPTKPDILPSGHYLPANAKLIFSFYSVGRMETVWGKDCLEFRPDRWIAPGGRIKH  422

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++HY  ++V+ + VSP  SII+QAK G
Sbjct  423  EPSYKFPAFNVGPRTCLGKEMAFIQMKMVAAAIIYHYRIELVEGNQVSPRVSIILQAKPG  482

Query  241  LKVKFTKRN  215
            LKV+ TKR+
Sbjct  483  LKVRLTKRD  491



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AIEHK+    D+LPSGH V PNTR++LSFY+ GRM+S+WG+DC+EFKPERWIS +G IKH
Sbjct  369  AIEHKLPLEFDILPSGHRVSPNTRVMLSFYTMGRMESLWGKDCLEFKPERWISKRGEIKH  428

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KF AFNAGPR C+GKEM   QMK++AA I+H+Y  Q V+   +SPS S+IIQ KHG
Sbjct  429  EPSFKFTAFNAGPRACIGKEMAFTQMKIVAATIIHNYHIQ-VEDQIISPSSSVIIQVKHG  487

Query  241  LKVKFTKRNT  212
            LKV+  KR T
Sbjct  488  LKVRLIKRVT  497



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V P TRMIL FY  GRM+++WG+DC+EFKPERWIS +G IKH
Sbjct  380  SLEHKVPLDHDILPSGHRVSPKTRMILPFYVMGRMETLWGKDCLEFKPERWISERGGIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTCLGKEM  VQMK+++AII+H+Y  QVV+  +V P+ SII+Q K+G
Sbjct  440  EPSFKFPAFNAGPRTCLGKEMAFVQMKIVSAIIIHNYNIQVVEPENVYPTTSIIMQVKNG  499

Query  241  LKVKFTKR  218
            L V   K+
Sbjct  500  LMVNVVKK  507



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D LPSG  VK N ++I+ FYS+GRM+S+WG+DC+EFKPERWIS+ G IKH
Sbjct  379  ALEHKAPIQPDNLPSGDYVKSNAKVIVCFYSTGRMESVWGKDCLEFKPERWISASGGIKH  438

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTCLGK+M  VQMKM+AA I++HY+ ++V+ H V+P DS+I+ AK+G
Sbjct  439  EPSYKFPAFNAGPRTCLGKQMAFVQMKMLAATIVYHYKIELVEGHVVAPRDSVILHAKNG  498

Query  241  LKVKFTKRNT  212
            LKV  +KRN 
Sbjct  499  LKVTLSKRNV  508



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AIEHK+    D+LPSGH V PNTR++LSFY+ GRM+SIWG+DC+EFKPERWIS +G IKH
Sbjct  383  AIEHKLPLEFDLLPSGHRVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISERGGIKH  442

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTC+GKEM  +QMK++AA I+++Y +  ++   + P+ S+IIQ K+G
Sbjct  443  EPSFKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNY-YIKLEDQIILPNSSVIIQMKNG  501

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  502  LKVRVFKR  509



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D LPSGH +  + ++I+SFYS GRM+S+WG+DC+EFKPERWIS  G+IKH
Sbjct  365  ALEHKAPVRADNLPSGHHLPRDAKLIISFYSVGRMESVWGKDCLEFKPERWISGSGKIKH  424

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            E SYKFPAFNAGPRTCLGKEM  VQMKM+AA I+  Y+ Q+V+ H VSP DS+I+QAKHG
Sbjct  425  EASYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIICDYQVQLVEGHPVSPRDSVILQAKHG  484

Query  241  LKVKFTKRN  215
            LKVK ++RN
Sbjct  485  LKVKLSRRN  493



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK      +LPSG  V+PNT++IL FYS GRM+S+WGEDC+EFKPERWIS +GR++H
Sbjct  303  ALEHKAPVQAVILPSGVRVEPNTKLILFFYSMGRMESLWGEDCLEFKPERWISERGRVRH  362

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTCLGKEM  VQMKM+AA I+++Y  +VVD H +SPSDSIIIQ K G
Sbjct  363  EPSFKFPAFNAGPRTCLGKEMAFVQMKMVAASIIYNYHVRVVDGHPISPSDSIIIQMKQG  422

Query  241  LKVKFTKRN  215
            L V+  +RN
Sbjct  423  LMVRLFQRN  431



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 106/132 (80%), Gaps = 3/132 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D LPSG  VK N ++I+SFYS+GRM+S+WG+DC+EFKPERWIS+ G IKH
Sbjct  380  ALEHKAPIQPDNLPSGDYVKSNAKVIVSFYSTGRMESVWGKDCLEFKPERWISASGGIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvd---shsvspsdsiiIQA  251
            EPSYKFPAFNAGPRTCLGKEM   QMKM+AA I++ Y+ ++++      VSP DSII+QA
Sbjct  440  EPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYRYKIELLEGGGYPVVSPRDSIILQA  499

Query  250  KHGLKVKFTKRN  215
            KHGLKV+ ++RN
Sbjct  500  KHGLKVRLSRRN  511



>ref|XP_008441106.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
melo]
Length=513

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKH  422
             +HKV +  D+LPSGH V PNT+++ S Y+ GRM  +WGEDCMEFKPERWI+SK G+IKH
Sbjct  384  FQHKVPSKPDILPSGHRVDPNTKILFSLYALGRMSDVWGEDCMEFKPERWINSKNGKIKH  443

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF AFNAGPRTCLGKE+  ++MK++AA ILH++       H V  + SII+Q KHG
Sbjct  444  EPSYKFLAFNAGPRTCLGKEVAFIEMKLLAAAILHNFNITRQTEHEVVSNASIILQMKHG  503

Query  241  LKVKFTKRNT  212
             KVK TKR T
Sbjct  504  FKVKVTKRWT  513



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V P T+MI+ FY+ GRM++IWG+D +EFKPERWIS +G+IKH
Sbjct  380  SLEHKVPLAHDILPSGHHVTPKTKMIIPFYTMGRMETIWGKDYLEFKPERWISEQGKIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTC+GK M   Q+K++AA I+H+Y  Q+V++ ++SP+ SII+  KHG
Sbjct  440  EPSFKFPAFNAGPRTCIGKNMAFTQLKIVAATIIHNYHIQLVEAQNISPTTSIIMLVKHG  499

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  500  LKVRVVKR  507



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHKV    D+LPSGH V P TR+I+ FYS+GRM++IWG+D +EFKPERWIS +G IKH
Sbjct  380  SLEHKVPLAHDILPSGHHVTPKTRLIIPFYSTGRMETIWGKDYLEFKPERWISERGGIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KFPAFNAGPRTC+GK M    +K++AA I+H+Y  Q+V++ ++SP+ SII+  KHG
Sbjct  440  EPSFKFPAFNAGPRTCIGKNMAFTHLKIVAATIIHNYHIQLVEAQNISPTTSIIMLVKHG  499

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  500  LKVRVVKR  507



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            +IEHK    +DVLPSGH V P+ ++++SFY+ GRM ++WG+DC+EFKPERWIS +G IKH
Sbjct  379  SIEHKAPLELDVLPSGHRVTPDMKILISFYTMGRMQTLWGKDCLEFKPERWISERGGIKH  438

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSY+FPAFNAGPRTC+GK+MG +QMKM+AA I+++Y  Q+V+  ++SP+ +++I+  +G
Sbjct  439  VPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIVYNYHIQLVEGQAISPTATVVIRMTNG  498

Query  241  LKVKFTKR  218
            LKV+  KR
Sbjct  499  LKVRVVKR  506



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            +IEHK    +DVLPSGH V PNT++++SFY+ GRM+S+WG+DC+EF+PERWI+ +G +KH
Sbjct  383  SIEHKSPLQLDVLPSGHRVSPNTKILISFYTMGRMESLWGKDCLEFRPERWITERGGLKH  442

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAF AGPRTC+GKEM  +QMKM+AA ++H+Y  Q+V++ ++SP+ +++I+  +G
Sbjct  443  EPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIHNYNIQLVEAQTISPTATVVIRMTNG  502

Query  241  LKVKFTKR  218
            L VK  K+
Sbjct  503  LMVKVGKK  510



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+E+K     D LPSGH V  N+++++SFY+ GR +S+WG+DC+EFKPERWI+ +G IKH
Sbjct  325  ALEYKSPIESDTLPSGHFVSRNSKVVISFYTVGRSESVWGKDCLEFKPERWITPRGGIKH  384

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++ Y  ++VD H V P DS+++ AK+G
Sbjct  385  EPSYKFPAFNVGPRTCLGKEMSFIQMKMVAATIVYRYRVRLVDGHLVVPRDSLMLHAKNG  444

Query  241  LKVKFTKRNT  212
            LKV+  +RN 
Sbjct  445  LKVRLFERNV  454



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            ++EHK    +DVLPSGH V P+ ++++SFY+ GR+ +IWG+DC+EFKPERWIS +  IKH
Sbjct  380  SLEHKSPLELDVLPSGHRVTPDMKILISFYTMGRLQTIWGKDCLEFKPERWISERRGIKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSY+FPAFNAGPRTC+GK+MG +QMKM+AA I+++Y  Q+V+  ++SP+ +++I+  +G
Sbjct  440  VPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIIYNYHIQLVEGQTISPTATVVIRMTNG  499

Query  241  LKVKFTKRNT  212
            LKV+  KR+ 
Sbjct  500  LKVRVVKRDV  509



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+E+K     D+LPSGH V+ N+++++SFY+ GR +S+WG DC+EFKPERWI+ +G IKH
Sbjct  329  ALEYKSPIESDILPSGHFVRRNSKVVISFYTVGRTESVWGGDCLEFKPERWITPRGGIKH  388

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++ Y  ++VD HSV P DS+++ AK+G
Sbjct  389  EPSYKFPAFNVGPRTCLGKEMSFIQMKMVAATIVYRYRVRLVDGHSVIPRDSLMLHAKNG  448

Query  241  LKVKFTKRNT  212
            L V+ + RN 
Sbjct  449  LMVRLSYRNV  458



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            +IEHK    +DVLPSGH V PN ++++SFY+ GRM+S+WG+DC+EF+PERWI+ +G +KH
Sbjct  380  SIEHKSPLKLDVLPSGHRVSPNMKILISFYTMGRMESLWGKDCLEFRPERWITERGGLKH  439

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAF AGPRTC+GKEM  +QMKM+AA ++++Y  Q++++ ++SP+ +++I+  +G
Sbjct  440  EPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIYNYNIQLLEAQTISPTATVVIRMTNG  499

Query  241  LKVKFTKR  218
            L  K  KR
Sbjct  500  LMAKVVKR  507



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     DVLPSGH V P+T++++  Y+ GRM S+WGEDC EF+PERWIS +G I+HE
Sbjct  379  FEHKCPVKPDVLPSGHKVNPSTKILILLYAMGRMKSVWGEDCFEFRPERWISERGGIRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   QMKMIAA ++++YE  +V+SH V PS+SII+  KHGL
Sbjct  439  PSYKFLAFNAGPRTCLGKEVAFTQMKMIAAAMIYNYEVHLVESHPVRPSNSIILHIKHGL  498

Query  238  KVKFTKR  218
            +VKF +R
Sbjct  499  RVKFARR  505



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     DVLPSGH V P+T++++  Y+ GRM S+WGEDC EF+PERWIS +G I+HE
Sbjct  379  FEHKCPVKPDVLPSGHKVNPSTKILILLYAMGRMKSVWGEDCFEFRPERWISERGGIRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   QMKMIAA ++++YE  +V+SH V PS+SII+  KHGL
Sbjct  439  PSYKFLAFNAGPRTCLGKEVAFTQMKMIAAAMIYNYEVHLVESHPVRPSNSIILHIKHGL  498

Query  238  KVKFTKR  218
            +VKF +R
Sbjct  499  RVKFARR  505



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V P  +++   YS GRM SIWGEDC+EFKPERWIS  G+IKHEP
Sbjct  379  QHKSPLQNDVLPSGHEVSPEMKIVFCLYSMGRMASIWGEDCLEFKPERWISGGGKIKHEP  438

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK++AA ILH+Y  +VV+ H V+PS SII+  KHGLK
Sbjct  439  SYKFLAFNAGPRTCLGKEVAFTQMKIVAASILHNYNVKVVEDHPVTPSASIILHMKHGLK  498

Query  235  VKFTKR  218
            V  ++R
Sbjct  499  VNVSRR  504



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V P  ++++  Y+ GRM SIWGEDC+EFKPERWI+  G+IKHEP
Sbjct  375  QHKSPLQKDVLPSGHEVNPEMKIVICSYAMGRMASIWGEDCLEFKPERWITEGGKIKHEP  434

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK++AA I+H+Y  +VV+ H VSP+ SII+  KHGLK
Sbjct  435  SYKFLAFNAGPRTCLGKEVAFTQMKIVAASIIHNYHVKVVEDHPVSPNVSIILHMKHGLK  494

Query  235  VKFTKR  218
            VK T+R
Sbjct  495  VKVTRR  500



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            + HKV+   D+LPSGH +KP T+++LS Y+ GRM  +WG+DC+EFKPERWIS  G+IKH 
Sbjct  381  VNHKVAVQPDILPSGHHIKPKTKILLSIYALGRMSDVWGKDCLEFKPERWISENGKIKHF  440

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FNAGPRTCLGK++   ++K++AA I+H+Y       H V P  S+++  KHG 
Sbjct  441  PSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGF  500

Query  238  KVKFTKRNT  212
            KVK TKR T
Sbjct  501  KVKVTKRWT  509



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            + HKV+   D+LPSGH +KP T+++LS Y+ GRM  +WG+DC+EFKPERWIS  G+IKH 
Sbjct  381  VNHKVAVQPDILPSGHHIKPKTKILLSIYALGRMSDVWGKDCLEFKPERWISENGKIKHF  440

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FNAGPRTCLGK++   ++K++AA I+H+Y       H V P  S+++  KHG 
Sbjct  441  PSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGF  500

Query  238  KVKFTKRNT  212
            KVK TKR T
Sbjct  501  KVKVTKRWT  509



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK  A  DVLPSGH V P+T++I+  Y+ GRM SIWGEDC+EF+PERWIS +G I+HEP
Sbjct  378  QHKCPANPDVLPSGHEVDPSTKIIVVMYAMGRMKSIWGEDCLEFRPERWISERGGIRHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++   Q+K  AA ++H+YE  VV+ H V PS+SI++  KHGLK
Sbjct  438  SYKFIAFNAGPRTCLGKDVAFTQIKTAAATVIHNYEVYVVEDHPVRPSNSIVLHMKHGLK  497

Query  235  VKFTKR  218
            VK  +R
Sbjct  498  VKLARR  503



>ref|XP_004166589.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=507

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HKV+   D LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWIS KG IKH 
Sbjct  379  FQHKVAMQHDTLPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWISEKGSIKHV  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   +MK++AA ++H+Y       H V P+ SII+  KHG 
Sbjct  439  PSYKFLAFNAGPRTCLGKEVAFTEMKLVAAAMIHNYNITQQIGHKVVPNPSIILHMKHGF  498

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  499  KVKVTKR  505



>gb|KGN48435.1| hypothetical protein Csa_6G487560 [Cucumis sativus]
Length=507

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HKV+   D LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWIS KG IKH 
Sbjct  379  FQHKVAMQHDTLPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWISEKGSIKHV  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   +MK++AA ++H+Y       H V P+ SII+  KHG 
Sbjct  439  PSYKFLAFNAGPRTCLGKEVAFTEMKLVAAAMIHNYNITQQIGHKVVPNPSIILHMKHGF  498

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  499  KVKVTKR  505



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 101/133 (76%), Gaps = 4/133 (3%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWIS-SKGRIKH  422
            +EHK++   D+LPSGH + P  R+ILSFY+ GRM+++WG DC++FKPERWIS  +G+IKH
Sbjct  401  LEHKIATETDILPSGHHLCPGKRVILSFYTMGRMETLWGNDCLDFKPERWISGGRGKIKH  460

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvd---shsvspsdsiiIQA  251
            EPS+KFP FNAGPRTCLGK++   QMKM+AA I+ +Y+ Q+V+       S S  + ++ 
Sbjct  461  EPSFKFPVFNAGPRTCLGKDISFFQMKMVAATIIFNYQVQLVEGQHLDFPSASILLQLKM  520

Query  250  KHGLKVKFTKRNT  212
            KHGLKV+  +R++
Sbjct  521  KHGLKVRLIQRSS  533



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     DVLPSGH V P  ++++  Y+ GRM S+WGEDC EF+PERWIS  G ++HE
Sbjct  379  FEHKCPVKPDVLPSGHKVNPGKKILIHLYAMGRMKSVWGEDCFEFRPERWISKSGGVRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGK++   QMKMIAA+++H+YE  VV+ H V PS+SII+  KHGL
Sbjct  439  PSYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGHLVRPSNSIILHMKHGL  498

Query  238  KVKFTKR  218
            +VK  +R
Sbjct  499  RVKLARR  505



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            D+LPSGH V  NT +IL FYS GRM SIWGEDCMEFKPERWISS G IKH PSYKFP FN
Sbjct  386  DILPSGHQVDQNTNIILCFYSMGRMRSIWGEDCMEFKPERWISSSGGIKHVPSYKFPTFN  445

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  215
            AGPR CLGK M   ++K++A  I++HY  Q+V+ H V P+DS+++  K+GLKVK  +R+
Sbjct  446  AGPRACLGKNMAFSELKIVATTIIYHYHIQLVEGHLVLPADSMVLHMKYGLKVKLNRRS  504



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            + HKV+   D+LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWIS  G+IKH 
Sbjct  381  VNHKVAVQPDILPSGHHIKPKTKIVFSLYALGRMSDVWGKDCLEFKPERWISENGKIKHF  440

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FNAGPRTCLGK++   ++K++AA I+H+Y       H V P  S+++  KHG 
Sbjct  441  PSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGF  500

Query  238  KVKFTKRNT  212
            KVK TKR T
Sbjct  501  KVKVTKRWT  509



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISS-KGRIK  425
            A+EHK  A  D LP+G+ ++ NT++I SFYS GRM+SIWG+DC++FKPERWIS   G + 
Sbjct  361  ALEHKAPADGDTLPTGNRIEKNTKIIFSFYSMGRMESIWGKDCLKFKPERWISDVTGGVV  420

Query  424  HEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKH  245
            H PSY FPAFN GPRTCLGK+M  +QMKM+AA I+ HY+ ++VD     P DSII+Q K+
Sbjct  421  HAPSYYFPAFNVGPRTCLGKDMAFIQMKMVAAAIVFHYQVEIVDGAVALPRDSIILQTKN  480

Query  244  GLKVKFTKR  218
            GL+V+ +KR
Sbjct  481  GLRVRLSKR  489



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM SIWG DC+EFKPERWIS +GRIKHEP
Sbjct  395  QHKAPLQPDMLPSGHRVDPKMKILFSLYAMGRMTSIWGTDCLEFKPERWISERGRIKHEP  454

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y  QVV+ H V+P+ SII+  KHGL 
Sbjct  455  SYKFFAFNAGPRTCLGKEVAFTQMKAVAATIIHNYHVQVVEGHHVAPNVSIILYMKHGLM  514

Query  235  VKFTKR  218
            V+ +KR
Sbjct  515  VRVSKR  520



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  379  QHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISERGTIKHEP  438

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ ++V  H V P+ SII+  +HG K
Sbjct  439  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHIVEPNASIILYMRHGFK  498

Query  235  VKFTKRNT  212
            VK  KR T
Sbjct  499  VKINKRWT  506



>gb|AES86633.2| cytochrome P450 family protein [Medicago truncatula]
Length=225

 Score =   144 bits (362),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK S   DVLPSGH +K NT ++ S YS GR++ IWGEDC+EFKPERWIS KG I H P
Sbjct  98   EHKSSLKPDVLPSGHKIKSNTMIVYSLYSIGRVEEIWGEDCLEFKPERWISKKGEIIHVP  157

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGKEM  ++MKMI   IL +Y   VV+   V PS S+I+  KHGLK
Sbjct  158  SYKFIAFNAGPRSCLGKEMSFIEMKMIIVAILLNYHIHVVEGQVVKPSISLILHMKHGLK  217

Query  235  VKFTK  221
            V   K
Sbjct  218  VMVKK  222



>ref|XP_004157876.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=379

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK S   D LPSGHLVK  TR++LS Y+ GR+ S+WGEDC EFKPERWIS KGRIK 
Sbjct  248  AFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKSVWGEDCEEFKPERWISEKGRIKR  307

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsv--spsdsiiIQAK  248
            EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y+ + V   +   +P  SII+  K
Sbjct  308  EPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNYDIEAVVEDNNGIAPVASIILHMK  367

Query  247  HGLKVKFTKRN  215
             G KV+ +KR+
Sbjct  368  TGFKVRVSKRS  378



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  378  QHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISERGTIKHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ ++V  H V P+ SII+  +HG K
Sbjct  438  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHIVEPNASIILYMRHGFK  497

Query  235  VKFTKRNT  212
            V+  KR T
Sbjct  498  VRINKRWT  505



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K     D+LPSGH V P T+++ S Y+ GRM S+WG+DC EFKPERWI+ +G +KHEP
Sbjct  379  EFKSPVRQDILPSGHRVNPKTKIVFSLYAMGRMSSVWGDDCFEFKPERWITDRGGMKHEP  438

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++   QMK + A I+++Y+ QVVD H+V+PS S+I+  KHG+K
Sbjct  439  SYKFFSFNAGPRTCLGKDVAFTQMKAVVAAIIYNYQVQVVDEHTVTPSQSVILHMKHGMK  498

Query  235  VKFTKR  218
            VK TKR
Sbjct  499  VKLTKR  504



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKHE  419
            +HKV+   D+LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWI+S+ G+IKH 
Sbjct  383  QHKVATQHDILPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKHV  442

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGK +  +++K++AA I+H+Y       H V P+ SII+  KHG 
Sbjct  443  PSYKFLAFNAGPRTCLGKHVAFIELKIVAAAIIHNYNIIQQTGHQVVPNASIILHMKHGF  502

Query  238  KVKFTKRNT  212
            KVK TKR T
Sbjct  503  KVKVTKRWT  511



>ref|XP_010681243.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=272

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     +VLPSGH V PN + +   Y  GRM +IWGE+C +F+PERWIS +G+IKHEP
Sbjct  145  QHKSPIKPNVLPSGHHVHPNMKTVFPLYEMGRMKAIWGENCSKFQPERWISKQGKIKHEP  204

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAG RTCLGKE+   QMKMIAA ++H++ FQVV+  ++ P  S++   KHG K
Sbjct  205  SYKFLAFNAGRRTCLGKEIAFTQMKMIAATLIHNFHFQVVEDDNIYPDVSVMFHIKHGFK  264

Query  235  VKFTKR  218
            VK  KR
Sbjct  265  VKIYKR  270



>gb|KDO37383.1| hypothetical protein CISIN_1g042798mg, partial [Citrus sinensis]
Length=271

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK++A  DVLPSGH +  N  +++S+Y+ GRM+ IWG+DC+EFKP+RWIS +G I H P
Sbjct  143  NHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVP  202

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AF+AGPR CLGK+   +QMKM+AA+IL +Y+ ++V  H VSP +S+++  K+GLK
Sbjct  203  SYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLK  262

Query  235  VKFTKRN  215
            V+ +KR 
Sbjct  263  VQLSKRT  269



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            AI+HK     D+LP+GH +KPNT  +LSFYS GRM+SIWG+DC++FKP RWIS  G IK 
Sbjct  379  AIQHKAPVEHDILPTGHHIKPNTITLLSFYSMGRMESIWGKDCLQFKPGRWISETGSIKI  438

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF AFNAGPR+CLGKEM   QMK++AA I+  ++ QV   H V P+ SII+  K G
Sbjct  439  EPSYKFTAFNAGPRSCLGKEMSFTQMKIVAAAIISRFKVQVAAGHPVCPNASIILHMKRG  498

Query  241  LKVKFTK  221
            LKVK +K
Sbjct  499  LKVKVSK  505



>gb|KEH22137.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK +   DVLPSGH VKPNT ++ S YS GR++ IWGEDC++FKPERWIS KG I H 
Sbjct  368  LEHKSALKSDVLPSGHRVKPNTMIVYSLYSVGRVEEIWGEDCLKFKPERWISKKGGIIHV  427

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++  ++MKM+A  IL +Y  QVV+ H + PS S+++  KHGL
Sbjct  428  PSYKFIAFNAGPRSCLGKDISFIEMKMVAIAILLNYHIQVVEDHPIIPSLSVVLHMKHGL  487

Query  238  KVKFTKRN  215
            KV   KR+
Sbjct  488  KVNVKKRS  495



>gb|KGN48429.1| hypothetical protein Csa_6G487010 [Cucumis sativus]
Length=458

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK S   D LPSGHLVK  TR++LS Y+ GR+ S+WGEDC EFKPERWIS KGRIK 
Sbjct  327  AFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKSVWGEDCEEFKPERWISEKGRIKR  386

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsv--spsdsiiIQAK  248
            EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y+ + V   +   +P  SII+  K
Sbjct  387  EPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNYDIEAVVEDNNGIAPVASIILHMK  446

Query  247  HGLKVKFTKRN  215
             G KV+ +KR+
Sbjct  447  TGFKVRVSKRS  457



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            + K  A  DVLPSGH V P T++I+  Y+ GRM SIWGEDC+EFKPERWIS +G I+HEP
Sbjct  380  QRKSPAKPDVLPSGHEVDPGTKIIVVMYAMGRMKSIWGEDCLEFKPERWISERGGIRHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++   Q+K +AA ++H+YE  VV+ H V PS+SI++  K+GLK
Sbjct  440  SYKFVAFNAGPRTCLGKDVAFTQIKTVAATVIHNYEVHVVEDHPVRPSNSIVLHMKYGLK  499

Query  235  VKFTKR  218
            VK  +R
Sbjct  500  VKLARR  505



>ref|XP_004142039.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=467

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK S   D LPSGHLVK  TR++LS Y+ GR+ S+WGEDC EFKPERWIS KGRIK 
Sbjct  336  AFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKSVWGEDCEEFKPERWISEKGRIKR  395

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsv--spsdsiiIQAK  248
            EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y+ + V   +   +P  SII+  K
Sbjct  396  EPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNYDIEAVVEDNNGIAPVASIILHMK  455

Query  247  HGLKVKFTKRN  215
             G KV+ +KR+
Sbjct  456  TGFKVRVSKRS  466



>ref|XP_004489210.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH+V PNT ++ S YS GR + IWG+DC+EFKPERWIS +GRI HEP
Sbjct  378  ESKKAIKGDILPSGHIVDPNTMILFSLYSMGRFEDIWGKDCLEFKPERWISERGRIVHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF  FNAGPRTCLGK++  +Q+KMIA  IL  Y  QV + H    S SI++  K+GL+
Sbjct  438  SYKFFTFNAGPRTCLGKDLSFIQIKMIATSILCKYRVQVGEDHIPILSHSIVLLMKNGLR  497

Query  235  VKFTKRNT  212
            VK TKR  
Sbjct  498  VKLTKRQN  505



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKH  422
            ++HKVS   D+LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWI+S+ G+IKH
Sbjct  381  LQHKVSTQHDILPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKH  440

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSYKF AFNAGPRTCLGK +   ++K++AA I+H+Y       H V PS SII+  KHG
Sbjct  441  VPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIHNYNIIQQTGHEVVPSASIILHMKHG  500

Query  241  LKVKFTKR  218
             KVK TKR
Sbjct  501  FKVKVTKR  508



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++   Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  385  QHKEPMKPDILPSGHYVHPKMKVMFFLYAMGRMESIWGKDCLEFKPERWISERGTIKHEP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLG+E+   QMKM+AA ++H+Y+ +VV+ H V+P+ S+I+  +HGLK
Sbjct  445  SYKFLAFNAGPRTCLGREVAFTQMKMVAATVIHNYQVRVVEGHRVAPNCSVILYMRHGLK  504

Query  235  VKFTKR  218
            V+  KR
Sbjct  505  VRVAKR  510



>ref|XP_004160507.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=521

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HKVS   DVLPSGH +KP T+++ S Y+ GRM  +WG+DC EFKPERWIS  G+IKH P
Sbjct  393  QHKVSVHHDVLPSGHHIKPKTKILFSLYALGRMSEVWGKDCFEFKPERWISENGKIKHVP  452

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++ L+ +K++AA I+++Y       H V PS SII+  K GLK
Sbjct  453  SYKFLAFNAGPRTCLGKQVALIGVKIVAAAIIYNYNVIQQSGHEVVPSSSIILHMKRGLK  512

Query  235  VKFTKR  218
            V+ TKR
Sbjct  513  VRVTKR  518



>ref|XP_004151610.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48431.1| hypothetical protein Csa_6G487520 [Cucumis sativus]
Length=521

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HKVS   DVLPSGH +KP T+++ S Y+ GRM  +WG+DC EFKPERWIS  G+IKH P
Sbjct  393  QHKVSVHHDVLPSGHHIKPKTKILFSLYALGRMSEVWGKDCFEFKPERWISENGKIKHVP  452

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++ L+ +K++AA I+++Y       H V PS SII+  K GLK
Sbjct  453  SYKFLAFNAGPRTCLGKQVALIGVKIVAAAIIYNYNVIQQSGHEVVPSSSIILHMKRGLK  512

Query  235  VKFTKR  218
            V+ TKR
Sbjct  513  VRVTKR  518



>emb|CDP12890.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSG  V P  +++   Y+ GRM+SIWG+DC EFKPERWIS +GR+KHEP
Sbjct  310  QHKTPLKPDILPSGLHVTPKMKVMFPLYAMGRMESIWGKDCKEFKPERWISERGRVKHEP  369

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y  Q+V+ H V P+ S+I+  K+GLK
Sbjct  370  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYNIQLVEGHPVIPNVSVILYIKNGLK  429

Query  235  VKFTKR  218
            V+ TKR
Sbjct  430  VRVTKR  435



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  380  QHKEPLQEDMLPSGHKVHPKLKILFSLYAMGRMESIWGKDCLEFKPERWISERGTIKHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ QVV+ H + P+ SII+  +HG K
Sbjct  440  SYKFLAFNAGPRTCLGKEVAFNQMKAVAATIIHNYQVQVVEGHPIKPNTSIILYMRHGFK  499

Query  235  VKFTKR  218
            V+ ++R
Sbjct  500  VRISRR  505



>ref|XP_008440140.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Cucumis melo]
Length=507

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HKV+   D LPSGH +KP T+++ S Y+ GR   +WG+DC+EFKPERWIS KG IKH P
Sbjct  381  QHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTSEVWGKDCLEFKPERWISEKGSIKHVP  440

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   +MK++AA I+H+Y       H V P+ SII+  KHG K
Sbjct  441  SYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHNYNIIQQIGHKVVPNPSIILHMKHGFK  500

Query  235  VKFTKR  218
            V  TKR
Sbjct  501  VNVTKR  506



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HKV+   D LPSGH +KP T+++ S Y+ GR   +WG+DC+EFKPERWIS KG IKH P
Sbjct  384  QHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTSEVWGKDCLEFKPERWISEKGSIKHVP  443

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   +MK++AA I+H+Y       H V P+ SII+  KHG K
Sbjct  444  SYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHNYNIIQQIGHKVVPNPSIILHMKHGFK  503

Query  235  VKFTKR  218
            V  TKR
Sbjct  504  VNVTKR  509



>gb|KEH40828.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EH  S   D+LPSG+ V PNT +I S YS GRM+ IWGEDCMEFKPERWIS +G I H P
Sbjct  382  EHICSIKSDILPSGYHVSPNTTLIYSLYSMGRMEQIWGEDCMEFKPERWISERGDIIHVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN GPR C+GK++  +QMKM+AA +L  +  QVV+ H V+P  S++++ KHGLK
Sbjct  442  SYKFVAFNTGPRICIGKDLSFIQMKMVAAALLQKFHIQVVEGHPVTPRLSVLLRMKHGLK  501

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  502  VEVSKRS  508



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  380  QHKEPLKEDILPSGHKVHPKLKILFSLYAMGRMESIWGKDCLEFKPERWISERGTIKHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ QVV+ H + P+ SII+  ++G K
Sbjct  440  SYKFLAFNAGPRTCLGKEVAFTQMKAVAATIIHNYQVQVVEGHPIKPNTSIILYMRYGFK  499

Query  235  VKFTKR  218
            V+ ++R
Sbjct  500  VRISRR  505



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWI---SSKGRI  428
            +EHK     D LPSGH +K + ++ILSFYS GRM+S+WG+DC+EFKPERWI   SS   I
Sbjct  386  LEHKSPMKSDNLPSGHYIKEDAKVILSFYSIGRMESVWGKDCLEFKPERWISTTSSTAII  445

Query  427  KHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvd-shsvspsdsiiIQA  251
            KH PSYKFP FN GPRTCLGKEM   +MKM+AA I++HY   +V+    +   D II++ 
Sbjct  446  KHVPSYKFPVFNIGPRTCLGKEMAFFEMKMVAATIIYHYNIHLVEGHPVIPRHDCIILEM  505

Query  250  KHGLKVKFTKRN  215
            KHGL+VK +KRN
Sbjct  506  KHGLRVKLSKRN  517



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K     D+LPSGH V P T+++ S Y+ GRM S+WG+DC EFKPERWI+ +G +KHEP
Sbjct  380  EFKSPLRRDILPSGHQVNPKTKIVFSLYAMGRMSSVWGDDCFEFKPERWITDRGGMKHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++   QMK + A I+++Y+ QVVD H+V PS S+I+  KHG+K
Sbjct  440  SYKFFSFNAGPRTCLGKDVAFTQMKAVVAAIIYNYQVQVVDEHTVPPSQSVILHMKHGMK  499

Query  235  VKFTKR  218
            VK TKR
Sbjct  500  VKLTKR  505



>ref|XP_008441105.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=424

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK S   D LPSGHLVKP TR++LS Y+ GRM S+WGED  EFKPERWI+ KGRIK 
Sbjct  292  AFEHKSSVEADTLPSGHLVKPGTRIVLSTYALGRMKSVWGEDYEEFKPERWITEKGRIKR  351

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsv--spsdsiiIQAK  248
            EPSYKF  FN GPR+CLGKE+   Q+K+I+A I+H+Y+ + V   +   +P  SII+  K
Sbjct  352  EPSYKFFTFNTGPRSCLGKEVTFAQLKIISAAIIHNYDIESVVEDNNGIAPVASIILHMK  411

Query  247  HGLKVKFTKR  218
             G KV+ +KR
Sbjct  412  TGFKVRVSKR  421



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     DVLPSGH V   T+++ S Y  GRM+ +WG+DC+EFKPERWI+ +GRI+HE
Sbjct  384  FEHKSPVCPDVLPSGHRVDERTKILFSLYGMGRMEGLWGKDCLEFKPERWITERGRIRHE  443

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   QMK++AA  +H+Y  +V++ H VSP+ SII+  KHGL
Sbjct  444  PSYKFLAFNAGPRTCLGKEVAFTQMKVVAAAFIHNYHVEVIEGHPVSPNLSIILHMKHGL  503

Query  238  KVKFTKR  218
             V+ TKR
Sbjct  504  MVRVTKR  510



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKH  422
            ++HKVS   D+LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWI+S+ G+IKH
Sbjct  381  LQHKVSIQHDILPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKH  440

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSYKF AFNAGPRTCLGK +   ++K++AA I+H+Y       H V PS SII+  KHG
Sbjct  441  VPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIHNYNIIQQAGHEVVPSASIILHMKHG  500

Query  241  LKVKFTKR  218
             KVK TKR
Sbjct  501  FKVKVTKR  508



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKH  422
            ++HKVS   D+LPSGH +KP T+++ S Y+ GRM  +WG+DC+EFKPERWI+S+ G+IKH
Sbjct  381  LQHKVSIQHDILPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKH  440

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSYKF AFNAGPRTCLGK +   ++K++AA I+H+Y       H V PS SII+  KHG
Sbjct  441  VPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIHNYNIIQQAGHEVVPSASIILHMKHG  500

Query  241  LKVKFTKR  218
             KVK TKR
Sbjct  501  FKVKVTKR  508



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     DVLPSGH V P  ++++  Y+ GRM S+WGE C EF+PERWIS  G ++HE
Sbjct  374  FEHKCPVKPDVLPSGHKVDPGKKILIHLYAMGRMKSVWGEYCFEFRPERWISKSGGVRHE  433

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGK++   QMKMIAA+++H+YE  VV+ H V PS+SII+  KHGL
Sbjct  434  PSYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGHPVRPSNSIILHMKHGL  493

Query  238  KVKFTKR  218
            +VK  +R
Sbjct  494  RVKLARR  500



>gb|KEH24777.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLPSGH++ PNT ++ S YS GR + IWGEDC+EFKPERWIS +G I HEP
Sbjct  380  ERKKAIKGDVLPSGHIINPNTIILFSLYSMGRFEEIWGEDCLEFKPERWISERGSIVHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++  +Q+KMIA  IL  Y  QVVD H    S SI++  K+GLK
Sbjct  440  SYKFFSFNAGPRTCLGKDLSFIQVKMIAIAILSKYCVQVVDGHVPILSHSIVLLMKNGLK  499

Query  235  VKFTKR  218
            V+ TKR
Sbjct  500  VRITKR  505



>gb|KEH40819.1| cytochrome P450 family protein [Medicago truncatula]
Length=481

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EH  +   D+LPSG  V PNTR++ S Y+ GRM+ IWGEDCMEFKPERW+S  G I H 
Sbjct  353  FEHICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSETGHIIHV  412

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPR+CLGK++  +QMKM+AA +L  +  QVV+ H V+P  S ++  KHG 
Sbjct  413  PSYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQKFHIQVVEGHPVTPKLSFVLHMKHGF  472

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  473  KVKVTKR  479



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K     D+LPSGH V P+ R++ + Y+ GRM SIWGEDC EF+PERWIS  G ++HEP
Sbjct  369  ELKCPVKPDILPSGHKVDPSKRILFNLYAMGRMKSIWGEDCFEFRPERWISEGGGVRHEP  428

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++   QMKMIAA+++H+YE  VV+ H + PS+SI++  K GL+
Sbjct  429  SYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGHPMRPSNSIVLHMKQGLR  488

Query  235  VKFTKR  218
            VK  +R
Sbjct  489  VKLARR  494



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V PNT ++ S Y  GRM SIWG DC+EFKPERWIS  G+IKHEP
Sbjct  386  QHKEPLKSDVLPSGHRVGPNTMVLFSVYVMGRMASIWGPDCIEFKPERWISDSGKIKHEP  445

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLG+ +   QMK +AA I+H+Y+  VV+ H V+PS SII+  KHGLK
Sbjct  446  SYKFLAFNAGPRTCLGRGVAFTQMKAVAAAIIHNYQVHVVEGHPVAPSSSIILHMKHGLK  505

Query  235  VKFTKR  218
            V  +K+
Sbjct  506  VSLSKK  511



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS  G IKHEP
Sbjct  378  QHKEPLENDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISDGGTIKHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ ++V  H + P+ SII+  +HG K
Sbjct  438  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHPIEPNASIILYMRHGFK  497

Query  235  VKFTKR  218
            V+ ++R
Sbjct  498  VRISRR  503



>ref|XP_007134109.1| hypothetical protein PHAVU_010G019600g [Phaseolus vulgaris]
 gb|ESW06103.1| hypothetical protein PHAVU_010G019600g [Phaseolus vulgaris]
Length=486

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK +   D+LPSGHL+K N R++ S YS GR + IWGEDC++F+PERWIS +G I H 
Sbjct  358  LEHKCALKSDILPSGHLIKSNARIVYSLYSMGRAEEIWGEDCLKFRPERWISKRGGIIHI  417

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++   ++KMIAA IL +Y   +V+  ++SP  S+I+  KHGL
Sbjct  418  PSYKFIAFNAGPRSCLGKDISYTEIKMIAAAILWNYRIHLVEGRAISPRVSVILHMKHGL  477

Query  238  KVKFTKRN  215
            KV  TKR+
Sbjct  478  KVTLTKRS  485



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  589  KVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSY  410
            K     DVLPSGH V P  ++++  Y+ GRM SIWGEDC+EF+PERWI  +G I+H+PSY
Sbjct  382  KCPTNPDVLPSGHKVDPGAKIVVHMYAMGRMKSIWGEDCLEFRPERWILERGGIRHQPSY  441

Query  409  KFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVK  230
            KF AFNAGPRTCLGK++   Q+KM+AA ++H+YE  VV+ H V PS+SII+  KHGLKVK
Sbjct  442  KFVAFNAGPRTCLGKDVAFTQIKMVAATVIHNYEVHVVEDHPVRPSNSIILHMKHGLKVK  501

Query  229  FTKR  218
             T+R
Sbjct  502  VTRR  505



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V+P  +++ S Y+ GRM+S+WGEDC+EFKPERWIS +G IKHEP
Sbjct  384  QHKEPVEPDILPSGHFVEPTMKVMFSLYAMGRMESVWGEDCLEFKPERWISDRGSIKHEP  443

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++   Q+K +AA ++H+Y+  V D H V P+ SII+  ++GLK
Sbjct  444  SYKFLAFNAGPRTCLGKDVAFAQVKAVAATLIHNYQVHVADGHRVLPNCSIILYMRNGLK  503

Query  235  VKFTKRNTA  209
            V+   R +A
Sbjct  504  VRVANRWSA  512



>ref|XP_010510801.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=500

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+ N+++I+S Y+ GRM S+WGED  +FKPERWIS KGR++ EP
Sbjct  374  NHKSPAKSDVLPSGHKVEANSKIIISVYALGRMRSVWGEDASDFKPERWISDKGRLRQEP  433

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN+GPRTCLGK + L QMK++A  I+ +YEF++V+   +    S+I+  KHGLK
Sbjct  434  SYKFLAFNSGPRTCLGKNLALSQMKIVAVNIIRNYEFKIVEGQKIEQGASMILSMKHGLK  493

Query  235  VKFTK  221
            V  +K
Sbjct  494  VTVSK  498



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  GR  HEP
Sbjct  390  QHKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSLHEP  449

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ + QMK +A  I+ +YEFQVV+ H + P+ S+I+  KHGLK
Sbjct  450  SYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEFQVVEGHKIEPAPSVILHMKHGLK  509

Query  235  VKFTKRNTA  209
            V  +KR  A
Sbjct  510  VTVSKRCCA  518



>gb|KEH40811.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EH  +   D+LPSG  V PNTR++ S Y+ GRM+ IWGEDCMEFKPERW+S +G I H 
Sbjct  376  FEHICAINSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSERGHIIHV  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPR+C+GK++  +QMKM+AA +L  +  +VV  H ++P  S ++  KHGL
Sbjct  436  PSYKFIAFNTGPRSCMGKDISFIQMKMVAAALLPKFHIKVVAGHPITPKLSFVLHMKHGL  495

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  496  KVKVTKR  502



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            D LPSGH V PN ++I S Y+  RM SIWG DC EFKPERWIS  G+I+HEPSYK+  FN
Sbjct  369  DTLPSGHEVNPNMQIIFSMYAMARMKSIWGNDCYEFKPERWISESGKIRHEPSYKYLVFN  428

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTK  221
            AGPRTCLGK+M   QMK++AA I+ +YEFQ ++ H V P  SI+++ K+GLKV+ +K
Sbjct  429  AGPRTCLGKDMAFTQMKVVAATIVKNYEFQALEGHLVVPDISIMLRVKYGLKVQVSK  485



>ref|NP_195658.3| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB44683.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80611.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87077.1| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=516

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH VK N+R++   YS GRM S+WGED MEFKPERWIS  GR  HEP
Sbjct  388  NHKSPAKPDVLPSGHKVKANSRILFCLYSLGRMKSVWGEDAMEFKPERWISESGRSVHEP  447

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ + QMK +A  I+ +Y+  VV+ H + P+ S+I+  KHGLK
Sbjct  448  SYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYDINVVEGHKIKPAPSVILHMKHGLK  507

Query  235  VKFTKR  218
            V  +KR
Sbjct  508  VTVSKR  513



>gb|KEH40835.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EH  +   D+LPSG  V PNTR++ S Y+ GRM+ IWGEDCMEFKPERW+S  G I H 
Sbjct  380  FEHICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSETGHIIHV  439

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPR+CLGK++  +QMKM+AA +L ++  ++V+ H V+P  S ++  K+GL
Sbjct  440  PSYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQNFHIKIVEGHPVTPKISFVLHMKYGL  499

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  500  KVKVTKR  506



>ref|XP_010681238.1| PREDICTED: cytochrome P450 86A1-like [Beta vulgaris subsp. vulgaris]
Length=160

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            D+LPSGH V  N ++I + Y+ GRM S+WGEDC EFKPERWIS +G+I+HEPSYKF AFN
Sbjct  42   DMLPSGHHVDRNRQIIFNLYAMGRMKSLWGEDCYEFKPERWISEQGKIRHEPSYKFLAFN  101

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTK  221
            AGPRTCLGK+M   QMK++AA I+ +Y  + V+ H V PS SII+  K+G KV+  +
Sbjct  102  AGPRTCLGKDMAFTQMKLVAATIIQNYVIEAVEEHHVVPSISIILHMKYGFKVRVLR  158



>gb|KEH40823.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EH  +   D+LPSG+ V PNT +I S YS GRM+ IWGEDCMEFKPERWIS +G I H P
Sbjct  382  EHICAIKSDILPSGYHVTPNTTLIYSLYSMGRMEQIWGEDCMEFKPERWISERGDIIHVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN GPR C+GK++  +QMKM+AA +L  +  QVV+ H V+P  S+ ++ KHGLK
Sbjct  442  SYKFIAFNTGPRICIGKDISFIQMKMVAAALLRKFHIQVVEGHPVTPRLSVFLRMKHGLK  501

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  502  VEVSKRS  508



>gb|KEH40805.1| cytochrome P450 family protein [Medicago truncatula]
Length=498

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK +   D+LPSG  V PNT++I S Y+ GRM+ IWGEDC+EFKPERWIS++G I   P
Sbjct  371  EHKCAIKSDILPSGDHVSPNTKLIYSLYAMGRMEQIWGEDCLEFKPERWISNRGEIIQVP  430

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+C+GK++  VQMKM+AA +L  +  +VV+ H V+P  +++++ KHGLK
Sbjct  431  SYKFIAFNAGPRSCIGKDISFVQMKMVAANVLWKFHIEVVEGHFVTPRVAMVLRMKHGLK  490

Query  235  VKFTKR  218
            VK ++R
Sbjct  491  VKVSQR  496



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK+SA  DVLPSGH +  N  +++S+Y+ GRM+ IWG+DC+EFKPERWIS +G I H P
Sbjct  390  NHKISAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPERWISERGSIVHVP  449

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AF+AGPR CLGK+   +QMKM+AA+IL  Y+ ++V  H VSP +S+++  K+GLK
Sbjct  450  SYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGKYQVKIVQGHPVSPCNSMVLHMKYGLK  509

Query  235  VKFTKRN  215
            V+ +KR 
Sbjct  510  VQLSKRT  516



>emb|CDM81752.1| unnamed protein product [Triticum aestivum]
Length=514

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK  A  D LPSG  V+P  R+I+SFYS GRM+S+WG+DC+EF+PERW++++GR++HE
Sbjct  383  FEHKAGARPDTLPSGPAVRPTRRVIVSFYSMGRMESVWGKDCLEFRPERWLTAEGRLRHE  442

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLGK++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  443  PSYKFVAFNVGPRTCLGKDLAFTQMKAVVAAVLPRFRVEVAAGAVVRPKLSIILHMKDGL  502

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  503  KVRVYKRQ  510



>ref|XP_004492144.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=500

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK +   DVLPSGH +K NT ++ S YS GR++ IWGEDC+EFKPERWIS+KG I H P
Sbjct  373  EHKCAMKFDVLPSGHKIKSNTMIVYSLYSMGRVEEIWGEDCLEFKPERWISNKGGIIHVP  432

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK++   +MKM+   IL +Y  Q+V+ H + PS S+I+  KHGLK
Sbjct  433  SYKFIAFNAGPRSCLGKDISFTEMKMVVVAILLNYHIQLVEEHPIVPSLSVILHMKHGLK  492

Query  235  VKFTKR  218
            +   KR
Sbjct  493  IMVKKR  498



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A E K S   D+LPSG  V PN ++I + Y+ GRM SIWG+DC EFKPERWIS +G IKH
Sbjct  373  AFEQKASMESDILPSGQHVYPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWISERGNIKH  432

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF  FNAGPR+CLGK M   QMK + A I+ +Y+FQ +    V P  S++++ K+G
Sbjct  433  EPSYKFLTFNAGPRSCLGKNMAFTQMKAVVATIVQNYKFQAIQGQLVVPDISLMLRMKNG  492

Query  241  LKVKFTK  221
             KVK  K
Sbjct  493  FKVKVCK  499



>ref|XP_004489209.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=511

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K S   DVLPSGH V PNT ++ S Y+ GR ++IWGEDC+EFKPERWIS +G I + P
Sbjct  384  ERKESVEKDVLPSGHHVHPNTMILFSLYAMGRSENIWGEDCLEFKPERWISERGGIVYAP  443

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++  +Q+KM+AA IL +Y   VV+ + V+PS SI++  KHGLK
Sbjct  444  SYKFFSFNAGPRTCLGKDLAFIQIKMVAASILWNYGIHVVEGNCVTPSLSIVLLMKHGLK  503

Query  235  VKFTKR  218
            VK TKR
Sbjct  504  VKITKR  509



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LP+GH V P  +++ S Y+ GRM SIWG+DCME KPERWIS +G IKHEP
Sbjct  345  QHKEPLEPDILPTGHQVYPKMKIMFSLYAMGRMASIWGKDCMEMKPERWISDRGTIKHEP  404

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   Q+K +AA I+H+Y  +VV    + P+ S+I+  K GLK
Sbjct  405  SYKFLAFNAGPRTCLGKEVAFTQLKAVAATIIHNYHVRVVKGQKIVPNISVILYIKQGLK  464

Query  235  VKFTKR  218
            VK +KR
Sbjct  465  VKVSKR  470



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            I HK+S   DVLPSGH V  NTR++   YS GRM+ IWG+DC EFKPERWI  KG+IKH 
Sbjct  380  INHKMSVEADVLPSGHRVPGNTRILYFLYSMGRMEEIWGKDCSEFKPERWICEKGQIKHI  439

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYK+ AFNAGPRTCLGK++  +QMK++A+ I+ +Y  QVVD+   +P +S+++  K GL
Sbjct  440  PSYKYIAFNAGPRTCLGKDLTFLQMKIVASAIIWNYSLQVVDNRPATPCNSVVLHMKGGL  499

Query  238  KVKFTKR  218
            KV+ +KR
Sbjct  500  KVRVSKR  506



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK  A  DVLPSGH V P+ ++++  Y+ GRM SIWGEDC+EF+PERWIS +G I+H+PS
Sbjct  381  HKCPANPDVLPSGHKVDPSAKIVVHTYAMGRMKSIWGEDCLEFRPERWISERGGIRHQPS  440

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AF  GPRTCLGK++   Q+KM+ A ++H+YE  VV+ H V PS+S+I+  KHGLKV
Sbjct  441  YKFIAFGDGPRTCLGKDVAFTQIKMVTATVIHNYEVHVVEHHPVRPSNSVILNMKHGLKV  500

Query  232  KFTKR  218
            K  +R
Sbjct  501  KLARR  505



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPS H V P  +++ S Y+ GRM+SIWG+DC+EFKPERWIS +G IKHEP
Sbjct  378  QHKEPLEKDILPSVHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISDRGTIKHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ ++V  H + P+ SII+  +HG K
Sbjct  438  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHPIEPNASIILYMRHGFK  497

Query  235  VKFTKR  218
            V+ ++R
Sbjct  498  VRISRR  503



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             + K  A  DVLPSGH V P T++I+  Y+ GR+ SIWGED +EFKPERWIS +G I+HE
Sbjct  379  FQRKCPAKPDVLPSGHEVDPGTKIIVVMYAMGRIKSIWGEDFLEFKPERWISERGGIRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGK++   Q+K +AA ++H+YE  VV+ H V PS+ I++  KHGL
Sbjct  439  PSYKFVAFNAGPRTCLGKDVAFTQIKTVAATVIHNYEVHVVEDHPVRPSNFIVLHMKHGL  498

Query  238  KVKFTKR  218
            KVK  +R
Sbjct  499  KVKLARR  505



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK++A  DVLPSGH +  N  +++S+Y+ GRM+ IWG+DC+EFKPERWI+ KG I H P
Sbjct  381  NHKIAAQADVLPSGHRINKNHSILISYYAMGRMEVIWGKDCLEFKPERWITEKGSIVHVP  440

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AF+AGPR CLGK+   +QMKM+AA+IL +Y+ ++V  H VSP +S+++  K+GLK
Sbjct  441  SYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLK  500

Query  235  VKFTKRN  215
            V+ +KR 
Sbjct  501  VQLSKRT  507



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++   Y+ GRM+S+WG+DC+EFKPERWI+ +G IKHEP
Sbjct  391  QHKEPNQPDILPSGHYVHPEMKVMFFLYAMGRMESVWGKDCLEFKPERWITERGSIKHEP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+  VQMKM+AA I+++Y  +VVD H V P+ S+I+  + GLK
Sbjct  451  SYKFLAFNAGPRTCLGKEVAFVQMKMVAATIIYNYRVRVVDGHRVEPNCSVILYMRDGLK  510

Query  235  VKFTKR  218
            V+ +KR
Sbjct  511  VRVSKR  516



>gb|KEH40839.1| cytochrome P450 family protein [Medicago truncatula]
Length=501

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A +HK +   D+LPSG  V PNT++I S Y+ GRM  IWG+DC+EFKPERWIS++G I +
Sbjct  372  AFQHKCAIKSDILPSGEHVGPNTKLIYSLYAMGRMQQIWGDDCLEFKPERWISARGGIIN  431

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSYKF AFNAGPR+C+GK++  VQMKM+AA +L  +  QVV+ H V+   SI+++ KHG
Sbjct  432  VPSYKFIAFNAGPRSCIGKDLSFVQMKMVAASLLWKFRIQVVEGHPVTLRTSIVVRMKHG  491

Query  241  LKVKFTKR  218
            LKV+ +KR
Sbjct  492  LKVEVSKR  499



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 90/129 (70%), Gaps = 14/129 (11%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A+EHK     D LPSG  +K N ++I+SFYS+GRM+S+WG DC EFKPERWIS  G IKH
Sbjct  321  ALEHKAPIEPDNLPSGEYIKSNAKVIVSFYSTGRMESVWGNDCSEFKPERWISDSGLIKH  380

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKFPAFNAGPRTC+GKEM  +Q+     +I              SP DSII+QAKHG
Sbjct  381  EPSYKFPAFNAGPRTCVGKEMAFIQLVEGNDVI--------------SPRDSIILQAKHG  426

Query  241  LKVKFTKRN  215
            LKV  +KRN
Sbjct  427  LKVTLSKRN  435



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED  EFKPERWIS  GR  HEP
Sbjct  391  QHKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDAFEFKPERWISESGRSLHEP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ + QMK +A  I+ +YEFQVV+ H + P+ S+I+  KHGLK
Sbjct  451  SYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEFQVVEGHKIEPAPSVILHMKHGLK  510

Query  235  VKFTKR  218
            V  +KR
Sbjct  511  VTVSKR  516



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK +   DVLPSGH V+ NT ++ S YS GR++ IWGEDC+EFKPERWIS KG I + P
Sbjct  369  EHKSAQKSDVLPSGHRVESNTMIVYSLYSVGRVEEIWGEDCLEFKPERWISQKGGIVYVP  428

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK++  ++MKM+A  IL +Y  QVV+ H + PS S+++  KHGLK
Sbjct  429  SYKFIAFNAGPRSCLGKDISFIEMKMVAIAILLNYHIQVVEDHPIIPSLSVVLHMKHGLK  488

Query  235  VKFTKRN  215
            V   KR+
Sbjct  489  VNLKKRS  495



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V PN  ++ S Y  GRM SIWG DC+EFKPERWIS  G+IKHEP
Sbjct  378  QHKEPLKSDVLPSGHRVGPNMMVLFSVYVMGRMTSIWGPDCLEFKPERWISDSGKIKHEP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLG+ +   QMK +AA I+H+Y+  VV+ H V+PS SII+  KHGLK
Sbjct  438  SYKFLAFNAGPRTCLGRGVAFTQMKAVAAAIIHNYQVHVVEGHPVAPSSSIILHMKHGLK  497

Query  235  VKFTKR  218
            V  +++
Sbjct  498  VSLSRK  503



>ref|XP_003604436.1| Cytochrome P450 [Medicago truncatula]
Length=481

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK S   DVLPSGH +K NT ++ S YS GR++ IWGEDC+EFKPERWIS KG I H P
Sbjct  354  EHKSSLKPDVLPSGHKIKSNTMIVYSLYSIGRVEEIWGEDCLEFKPERWISKKGEIIHVP  413

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGKEM  ++MKMI   IL +Y   VV+   V PS S+I+  KHGLK
Sbjct  414  SYKFIAFNAGPRSCLGKEMSFIEMKMIIVAILLNYHIHVVEGQVVKPSISLILHMKHGLK  473

Query  235  VKFTK  221
            V   K
Sbjct  474  VMVKK  478



>emb|CDY39928.1| BnaA09g15100D [Brassica napus]
Length=496

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+ N+++++  Y+ GRM SIWGED ++FKPERWIS  G ++HEP
Sbjct  370  NHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSIWGEDALDFKPERWISDSGNLRHEP  429

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK + L+QMK++A  I+  Y+F+V     + P  S+I++ KHGL 
Sbjct  430  SYKFMAFNAGPRACLGKNLALMQMKIVAVEIIQKYDFEVTKGDKIKPVPSVILRMKHGLS  489

Query  235  VKFTKR  218
            VK TK+
Sbjct  490  VKVTKK  495



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     + LPSGH V P T+++ S Y+ GRM  IWGEDC EFKPERWI+ +G+IK+EP
Sbjct  383  QHKSPIQPETLPSGHHVNPKTKVLFSLYAMGRMKGIWGEDCFEFKPERWITKEGKIKYEP  442

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
             YKF +FNAGPRTCLGKE+   Q+KM++A ++H+Y+F VV      P  SI++  KHGLK
Sbjct  443  PYKFLSFNAGPRTCLGKEVAFTQLKMVSATLIHNYKFHVVHGQHAEPDMSIVLHMKHGLK  502

Query  235  VKFTKR  218
            VK + R
Sbjct  503  VKVSNR  508



>gb|KDP46411.1| hypothetical protein JCGZ_10251 [Jatropha curcas]
Length=468

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK S   DVLPSGH V  N R++ S YS GRM  IWGEDC+EF+PERWIS KGRIKH P
Sbjct  338  EHKTSIKPDVLPSGHHVPENMRILYSLYSMGRMKDIWGEDCLEFRPERWISEKGRIKHFP  397

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN+GPRTCLGK++  +++K +A+ +L +Y  ++V+ H +SP  S+I+    GLK
Sbjct  398  SYKFIAFNSGPRTCLGKDLAFIKLKTVASAVLWNYSLRIVEDHHISPKISVILYMDKGLK  457

Query  235  VKFTKR  218
            VK +KR
Sbjct  458  VKVSKR  463



>ref|XP_010431920.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=424

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WG+D +EFKPERWIS  GR  HEP
Sbjct  296  QHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKSVWGDDALEFKPERWISESGRSVHEP  355

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +YE ++V+   + P+ S+I+  KHG+K
Sbjct  356  SYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQKIEPAPSVILHMKHGVK  415

Query  235  VKFTKR  218
            V  TKR
Sbjct  416  VTVTKR  421



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  GR  HEP
Sbjct  385  QHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSVHEP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +YE ++V+   + P+ S+I+  KHG+K
Sbjct  445  SYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQKIEPAPSVILHMKHGVK  504

Query  235  VKFTKR  218
            V  TKR
Sbjct  505  VTVTKR  510



>gb|KFK30508.1| hypothetical protein AALP_AA7G271100 [Arabis alpina]
Length=438

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  G+  HEP
Sbjct  310  QHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISETGKSVHEP  369

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  370  SYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEMKIVEGQKIEPAPSVILHTKHGLK  429

Query  235  VKFTKR  218
            V  TKR
Sbjct  430  VTVTKR  435



>ref|NP_176086.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 sp|Q9FVS9.1|C96AF_ARATH RecName: Full=Alkane hydroxylase MAH1; AltName: Full=Cytochrome 
P450 96A15; AltName: Full=Protein MID-CHAIN ALKANE HYDROXYLASE 
1 [Arabidopsis thaliana]
 gb|AAG50737.1|AC079733_5 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAL31942.1|AF419610_1 At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AAM13991.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64745.1| At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AEE33458.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=497

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V  N+++++  Y+ GRM S+WGED ++FKPERWIS  G ++HEP
Sbjct  371  NHKSPAKPDVLPSGHKVDANSKIVICIYALGRMRSVWGEDALDFKPERWISDNGGLRHEP  430

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN+GPRTCLGK + L+QMKM+A  I+ +Y+F+V++ H V P  SI+++ KHGLK
Sbjct  431  SYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNYDFKVIEGHKVEPIPSILLRMKHGLK  490

Query  235  VKFTKR  218
            V  TK+
Sbjct  491  VTVTKK  496



>gb|KDP35255.1| hypothetical protein JCGZ_09414 [Jatropha curcas]
Length=259

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK     DVLPSGHLV P  +++LS Y  GR+ SIWGEDCMEFKPERWIS +GR+  + 
Sbjct  133  EHKEPLKPDVLPSGHLVDPTMKILLSIYVMGRLKSIWGEDCMEFKPERWISEEGRLIQQS  192

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshs-vspsdsiiIQAKHGL  239
             YKF +FNAGPR CLGKE+ L QMK +AA I+H+Y+ +V++ H     + SII+  K+GL
Sbjct  193  PYKFLSFNAGPRVCLGKEIALTQMKAVAAFIIHNYQVKVIEEHVPEPNTASIILHIKNGL  252

Query  238  KVKFTKR  218
             V+ ++R
Sbjct  253  MVRISRR  259



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++L  YS GRM S+WGED +EFKPERWIS  GR  HEP
Sbjct  385  QHKSPTKPDVLPSGHKVDANSKILLCLYSLGRMKSVWGEDALEFKPERWISESGRSVHEP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +YE ++V+   + P+ S+I+  KHG+K
Sbjct  445  SYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNYELKIVEGQKIEPAPSVILHMKHGVK  504

Query  235  VKFTKR  218
            V  TK+
Sbjct  505  VTVTKK  510



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK +   D+LPSGH ++   ++++SFYS GRM++IWG+DC+EFKPERWIS KG I H P 
Sbjct  395  HKAAVEEDILPSGHRIRRKMQVLISFYSMGRMEAIWGKDCLEFKPERWISDKGGIIHVPP  454

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AFN GPRTCLGK++  +QMKM+A  +L +Y  QV++ H V PS ++++  K+GLKV
Sbjct  455  YKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYHVQVIEDHQVFPSVAVVLHMKNGLKV  514

Query  232  KFTKR  218
            + TKR
Sbjct  515  RITKR  519



>ref|XP_009113346.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+ N+++++  Y+ GRM SIWGED ++FKPERWIS  G ++HEP
Sbjct  370  NHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSIWGEDALDFKPERWISDSGNLRHEP  429

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            +YKF AFNAGPR CLGK + L+QMK++A  I+  Y+F+V     + P  S+I++ KHGL 
Sbjct  430  TYKFMAFNAGPRACLGKNLALMQMKIVAVEIIQKYDFEVTKGDKIKPVPSVILRMKHGLS  489

Query  235  VKFTKR  218
            VK TK+
Sbjct  490  VKVTKK  495



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HKV    D LPSGH   P T+++ S Y+ GRM SIWGEDC+EF+PERWIS  G IK EP
Sbjct  380  QHKVPLVPDTLPSGHRAVPRTKILFSLYAMGRMKSIWGEDCLEFRPERWISESGGIKWEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+   QMK +AA ++H+Y+ QVV+     P+ SII+  KHGLK
Sbjct  440  SYKFFSFNAGPRTCLGKEVAFTQMKAVAAGVIHNYDIQVVEGQRPGPNVSIILYMKHGLK  499

Query  235  VKFTKR  218
            V+   R
Sbjct  500  VRVHDR  505



>gb|KEH40821.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A +HK +   D LPSG  V PNT++I S Y+ GRM+ IWGEDC+EFKPERWIS +G+I  
Sbjct  375  AFQHKCAIKSDKLPSGDHVSPNTKLIYSLYAMGRMEQIWGEDCLEFKPERWISDRGQIIQ  434

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             PSYKF AFNAGPR+CLGK++  +QMKM+AA +L  +  QVV+ HS+ P  SI+++ +HG
Sbjct  435  VPSYKFIAFNAGPRSCLGKDISFLQMKMVAAAVLFKFHIQVVEGHSIIPRVSILLRMEHG  494

Query  241  LKVKFTKR  218
             KVK  KR
Sbjct  495  FKVKIRKR  502



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K++   D+LPSGH V P T +++S Y+ GR++  WG+DC+EFKPERWIS KG I + P
Sbjct  374  ERKLAIKADMLPSGHRVNPRTMILISLYAMGRLEETWGKDCLEFKPERWISEKGGIVYVP  433

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++  +QMKM+AA IL+ Y  QVV+ +  +PS SI++  K GLK
Sbjct  434  SYKFIAFNAGPRTCLGKDLSFIQMKMVAAAILYKYHVQVVEDYVATPSLSIVLLIKDGLK  493

Query  235  VKFTKR  218
            V  TKR
Sbjct  494  VMITKR  499



>emb|CDY39927.1| BnaA09g15090D [Brassica napus]
Length=496

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+ N+++++  Y+ GRM SIWGED ++FKPERWIS  G +KHEP
Sbjct  370  NHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSIWGEDALDFKPERWISKSGELKHEP  429

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK + L+QMK++A  I+ +Y+F+V + H +    SI+++ KHGL 
Sbjct  430  SYKFMAFNAGPRACLGKHLALLQMKIVAVEIIQNYDFKVTEGHKIEAVPSIVLRMKHGLN  489

Query  235  VKFTKR  218
            V  TK+
Sbjct  490  VTVTKQ  495



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A E K     D+LPSGH V PN ++I + Y+ GRM SIWG+DC EFKPERWIS++G I+H
Sbjct  378  AFEAKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWISAQGNIRH  437

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF  FNAGPRTCLGKEM   QMK++AA ++  Y  +VVD   V P+ SI ++ KHG
Sbjct  438  EPSYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKYVIEVVDERQVIPNMSIFLRMKHG  497

Query  241  LKV  233
             KV
Sbjct  498  FKV  500



>ref|XP_007134103.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
 gb|ESW06097.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
Length=504

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK     D+LPSGH +K NT ++ S YS GR + IWGEDC++F+PERWIS++G I H 
Sbjct  376  LEHKCPLKSDMLPSGHWIKSNTMILYSLYSMGRAEEIWGEDCLKFRPERWISNRGGIIHI  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK +   ++KMIAA IL +Y  Q+V+  ++SP  S+++  KHGL
Sbjct  436  PSYKFIAFNAGPRSCLGKAISYTEIKMIAAAILWNYRIQLVEGQAISPRVSVVLHMKHGL  495

Query  238  KVKFTKRN  215
            KV  TKR+
Sbjct  496  KVTLTKRS  503



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK     DVLPSGH VK N++++   YS GRM S+WGED +EFKPERWIS  GR  HEP
Sbjct  387  NHKSPTKPDVLPSGHKVKANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSVHEP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE  VV+ H + P+ S+I+  KHGLK
Sbjct  447  SYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEINVVEGHKIKPAPSVILHMKHGLK  506

Query  235  VKFTKR  218
            V  +KR
Sbjct  507  VTVSKR  512



>emb|CDM81753.1| unnamed protein product [Triticum aestivum]
Length=516

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK  A  D LPSG  V P  R+I+SFYS GRM+S+WG+DC+EF+PERW+++ GR++HE
Sbjct  385  FEHKAGARPDTLPSGPAVWPTRRVIVSFYSMGRMESVWGKDCLEFRPERWLTAAGRLRHE  444

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLGK++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  445  PSYKFVAFNVGPRTCLGKDLAFTQMKAVVAAVLPRFRVEVAPGAVVKPKLSIILHMKDGL  504

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  505  KVRVYKRQ  512



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V  N+++I+  Y+ GRM ++WGED  +FKPERWIS  G IKHEPSYKF AFN
Sbjct  386  DVLPSGHKVDANSKIIICLYALGRMRAVWGEDATQFKPERWISENGGIKHEPSYKFLAFN  445

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  212
            AGPRTCLGK + + QMK++A +IL +Y+ +V+    + P+   I+  KHGLK+  TKR +
Sbjct  446  AGPRTCLGKHLAMTQMKIMAVVILRNYDIKVLQGQKIVPALGFILSMKHGLKITVTKRCS  505

Query  211  A  209
            A
Sbjct  506  A  506



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D LPSGH V P T ++ S Y+  R +SIWG+DC+EFKPERWIS  G IKHEP
Sbjct  383  QHKEPLKEDTLPSGHKVHPKTMILFSLYAMARTESIWGKDCLEFKPERWISETGTIKHEP  442

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ +VV+  ++ P+ SII+  ++G K
Sbjct  443  SYKFMAFNAGPRTCLGKEVAFTQMKAVAATIIHNYKVEVVEGQTIEPNTSIILYMRYGFK  502

Query  235  VKFTKRNT  212
            V+ ++R T
Sbjct  503  VRISRRWT  510



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WG+D +EFKPERWIS  GR  HEP
Sbjct  385  QHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKSVWGDDALEFKPERWISESGRSVHEP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +YE ++V+   + P+ S+I+  KHG+K
Sbjct  445  SYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQKIEPAPSVILHMKHGVK  504

Query  235  VKFTKR  218
            V  TKR
Sbjct  505  VTVTKR  510



>gb|EEC70068.1| hypothetical protein OsI_00672 [Oryza sativa Indica Group]
Length=187

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLP+G  V  NTR+I S Y+ GR++ IWG+DCMEFKPERW+S  GR++HEP
Sbjct  59   EEKEALVDDVLPNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEP  118

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FN GPR+CLGKE+ L  MK+I A I+H+++ ++V+ H V P  S+I+  ++G+ 
Sbjct  119  SYKFLSFNTGPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSSVILHTQNGMM  178

Query  235  VKFTKRNTA  209
            V+  +R+ A
Sbjct  179  VRLKRRDAA  187



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIK  425
            A+EHK  A  D LP+G  VK + R+I SFY+ GRM+SIWG+D  EF+PERWIS K G + 
Sbjct  373  ALEHKAPAEDDTLPTGTRVKKDGRIIFSFYTMGRMESIWGKDWPEFRPERWISDKIGGVV  432

Query  424  HEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKH  245
            H PS+ FPAFNAGPRTCLGK+M  +QMKM AA IL  Y  ++V +   SP D++I+Q++H
Sbjct  433  HVPSFHFPAFNAGPRTCLGKDMAFIQMKMAAAAILFRYRVELVGNFETSPRDAVILQSRH  492

Query  244  GLKVKFTKRN  215
            GLKV  +KR+
Sbjct  493  GLKVTLSKRH  502



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HK      +LPSGH V PN R++ S Y+ GRM+SIWG+D  EFKPERWIS +G +KHE
Sbjct  380  FQHKTPREPGILPSGHHVHPNMRVMFSLYAMGRMESIWGKDASEFKPERWISDRGTVKHE  439

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ +V+  H V P+ SII+  +HG 
Sbjct  440  PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVEVIKGHKVYPNVSIILYMQHGF  499

Query  238  KVKFTKRNT  212
            K +  KR T
Sbjct  500  KARIKKRWT  508



>ref|XP_004489211.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K     D+LPSGH++ PNT ++ S Y  GR + IWG+DC+EFKPERWIS +G+I H+P
Sbjct  378  ERKQVVKGDILPSGHIIDPNTMVLFSLYLMGRFEDIWGKDCLEFKPERWISERGKIVHQP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF  FNAGPRTCLGK+   +Q+KMIA  IL +Y   VV  H  +PS SII+ +K+GLK
Sbjct  438  SYKFSIFNAGPRTCLGKDFSFIQLKMIATSILCNYRVHVVQGHIPTPSHSIILHSKNGLK  497

Query  235  VKFTKRNT  212
            V+ TKR  
Sbjct  498  VRITKRQN  505



>gb|KDP46408.1| hypothetical protein JCGZ_10248 [Jatropha curcas]
Length=510

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HKVS   D+LPSGH +  N R+I S YS GRM  IWGEDC+EFKPERWIS  G+IKH P+
Sbjct  383  HKVSIEPDILPSGHHIPKNMRIIYSLYSMGRMKEIWGEDCLEFKPERWISETGQIKHVPA  442

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AF  GPR+CLGK M L+++K+IA  ++ +Y  Q+ ++H +SP  S+I+  K+GLKV
Sbjct  443  YKFIAFGTGPRSCLGKHMALMELKVIACAVIWNYSLQIAENHPISPDISVILHIKNGLKV  502

Query  232  KFTKRNTA  209
            K ++R+T 
Sbjct  503  KVSERSTV  510



>ref|XP_007031599.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
 gb|EOY02525.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
Length=508

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            I HK +   D+LPSGH +  NTR++++FY+ GRM+ IWGEDC+EFKPERWIS +G + H 
Sbjct  380  INHKTAIQPDILPSGHHINRNTRVLINFYAMGRMEEIWGEDCLEFKPERWISERGDVVHV  439

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PS+KF AFNAGPR+C+G+ +  +QMK++A  +L +Y+ Q V  H VS  ++I++  K+GL
Sbjct  440  PSHKFIAFNAGPRSCIGRNISFIQMKLVAISVLWNYQIQAVQGHHVSLGNTIVLHMKNGL  499

Query  238  KVKFTKRNT  212
            KV+  KR+ 
Sbjct  500  KVRIKKRSA  508



>ref|XP_009113344.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+ N+++++  Y+ GRM SIWGED ++FKPERWIS  G +KHEP
Sbjct  370  NHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSIWGEDALDFKPERWISKGGELKHEP  429

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK + L+QMK++A  I+ +Y+F+V + H +    SI+++ KHGL 
Sbjct  430  SYKFMAFNAGPRACLGKHLALLQMKIVAVEIIQNYDFKVTEGHKIEAVPSIVLRMKHGLN  489

Query  235  VKFTKR  218
            V  TK+
Sbjct  490  VTVTKQ  495



>ref|NP_195660.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 emb|CAB44685.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80613.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87079.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=469

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V+ N+++I+  Y+ GRM ++WG+D +EFKPERW+S KG ++HEPS+KF +FN
Sbjct  349  DVLPSGHKVQANSKIIICLYALGRMRAVWGDDALEFKPERWVSDKGSLRHEPSFKFLSFN  408

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  218
            +GPRTCLGK + + QMKM+A  ILH+YE +V+    + P    I+  KHGL++  TKR
Sbjct  409  SGPRTCLGKHLAMTQMKMVAVEILHNYEIKVIKGQKIKPVLGFILSMKHGLRITITKR  466



>ref|NP_001042227.2| Os01g0183500 [Oryza sativa Japonica Group]
 dbj|BAF04141.2| Os01g0183500, partial [Oryza sativa Japonica Group]
Length=191

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLP+G  V  NTR+I S Y+ GR++ IWG+DCMEFKPERW+S  GR++HEP
Sbjct  63   EEKEALVDDVLPNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEP  122

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FN GPR+CLGKE+ L  MK+I A I+H+++ ++V+ H V P  S+I+  ++G+ 
Sbjct  123  SYKFLSFNTGPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSSVILHTQNGMM  182

Query  235  VKFTKRNTA  209
            V+  +R+ A
Sbjct  183  VRLKRRDAA  191



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK +   D LPSGH ++   ++++SFYS GRM++IWG+DC+EFKPERWIS KG I H P 
Sbjct  394  HKAAVEEDTLPSGHRIRRKMQVLISFYSMGRMEAIWGKDCLEFKPERWISDKGGIIHVPP  453

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AFN GPRTCLGK++  +QMKM+A  +L +Y  QVV+ H V PS ++++  K+GLKV
Sbjct  454  YKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYHVQVVEGHQVFPSVAVVLHMKNGLKV  513

Query  232  KFTKR  218
            + TKR
Sbjct  514  RITKR  518



>gb|KEH40830.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EH  +   D+LPSG  + PNT ++ S YS GRM+ +WGEDCMEFKPERWIS +G I H P
Sbjct  382  EHICAIKSDILPSGERISPNTSLMYSMYSMGRMEQLWGEDCMEFKPERWISERGDIIHVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FN GPR C+GK++  +QMKM+AA +L  +  QVV+ H V+P  S+ ++ KHGLK
Sbjct  442  SYKFISFNTGPRICIGKDLSFIQMKMVAAALLRKFHIQVVEGHLVTPRLSVFLRMKHGLK  501

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  502  VEVSKRS  508



>gb|EYU43136.1| hypothetical protein MIMGU_mgv1a007195mg [Erythranthe guttata]
Length=415

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKHE  419
            EHK     D+LPSGH + PNT+ +LSFYS GRM+SIWG+DC++FKP RWI ++ GR+  E
Sbjct  288  EHKAPVEHDILPSGHRIGPNTKTVLSFYSMGRMESIWGKDCLDFKPGRWIDAETGRVITE  347

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PS+KF AFNAGPR+CLGK++  +Q+K++AA I+  +  QV    SV+PS S+++  KHGL
Sbjct  348  PSFKFTAFNAGPRSCLGKDVSFIQLKIVAAAIVSRFNIQVARGFSVTPSISVVLHMKHGL  407

Query  238  KVKFT  224
            KVK +
Sbjct  408  KVKVS  412



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            ++VS   D LPSGHLVK NT+++ S YS G M+ IWG+DC+ FKPERWIS +G I H PS
Sbjct  392  YRVSVEADTLPSGHLVKANTKVMFSLYSMGSMEEIWGDDCLAFKPERWISERGGIIHVPS  451

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YK+ AFN GPR+CLGKE+  +QMK IA  IL ++  QVV+ H VSP  S+++  KHGLK+
Sbjct  452  YKYIAFNTGPRSCLGKEITFIQMKTIATAILMNFHLQVVEGHPVSPGLSVMLHMKHGLKL  511

Query  232  KFTKR  218
            + TKR
Sbjct  512  RVTKR  516



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  G   HEP
Sbjct  351  QHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSVHEP  410

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  411  SYKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLK  470

Query  235  VKFTKR  218
            V  TKR
Sbjct  471  VTVTKR  476



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLPSGH V P+T ++   YS GR + IWGEDCMEFKPERWIS KG   + P
Sbjct  381  ERKEALKSDVLPSGHGVNPSTVILFCLYSMGRFEEIWGEDCMEFKPERWISQKGGNVYVP  440

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++  +QMKM+A  ILH Y  QVV+ +   P+ SI++  K GLK
Sbjct  441  SYKFIAFNAGPRTCLGKDVSFIQMKMVATAILHKYRLQVVEGYVAKPNLSIVLLMKDGLK  500

Query  235  VKFTKR  218
            VK  KR
Sbjct  501  VKIKKR  506



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D LPSGH V P  ++I S Y+ GRM  IWG+D  EFKPERWIS +G IKHEP
Sbjct  362  QHKFPLQPDTLPSGHRVHPKIKVIFSLYAMGRMKFIWGKDSWEFKPERWISERGTIKHEP  421

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA ++H+Y  ++V+ H V P+ S+I+  KHGLK
Sbjct  422  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAMIHNYNVEMVEGHPVVPNLSVILYMKHGLK  481

Query  235  VKFTKR  218
            V+ +KR
Sbjct  482  VRVSKR  487



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  G   HEP
Sbjct  391  QHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSVHEP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  451  SYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLK  510

Query  235  VKFTKR  218
            V  TKR
Sbjct  511  VTVTKR  516



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V P+ ++I   YS GRM SIWGEDC+EFKPERWI+  G+IKHEP
Sbjct  378  QHKAPLREDVLPSGHKVSPDMKIIFCLYSMGRMASIWGEDCLEFKPERWITG-GKIKHEP  436

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvd-shsvspsdsiiIQAKHGL  239
            SYKF AFNAGPRTCLGKE+  +QMK +AA +L++Y   +V+  H    ++SII+  K+GL
Sbjct  437  SYKFLAFNAGPRTCLGKEIAFIQMKTVAAFVLNNYNVHLVEGQHVSPATNSIILHMKYGL  496

Query  238  KVKFTKR  218
            KV  ++R
Sbjct  497  KVSVSRR  503



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +E K S   D LP+   VK NT+++LSFYS+GRM+S+WG+D +EFKPERWIS +G +++E
Sbjct  378  LELKSSILPDTLPNNIEVKKNTKIVLSFYSTGRMESVWGKDALEFKPERWISDRGVLRNE  437

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PS+KFPAFN GPR+C GKEM LV+MK++   I+H Y  +VV+ H VSPSDS+ ++ KHGL
Sbjct  438  PSFKFPAFNVGPRSCPGKEMALVEMKIVVVAIMHRYRVRVVEGHRVSPSDSVFLKTKHGL  497

Query  238  KVKFTKRNTA  209
            KV+   R  A
Sbjct  498  KVRLLSRKDA  507



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            ++VS   D LPSGHLVK NT+++ S YS G M+ IWG+DC+ FKPERWIS +G I H PS
Sbjct  391  YRVSVEADTLPSGHLVKENTKVMFSLYSMGSMEEIWGDDCLAFKPERWISERGGIIHVPS  450

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YK+ AFN GPR+CLGKE+  +QMK IA  IL ++  QVV+ H VSP  S+++  KHGLK+
Sbjct  451  YKYIAFNTGPRSCLGKEITFIQMKTIATAILLNFHLQVVEGHPVSPGLSVMLHMKHGLKL  510

Query  232  KFTKR  218
            + TKR
Sbjct  511  RVTKR  515



>emb|CDY70657.1| BnaAnng34520D [Brassica napus]
Length=136

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK  +  +VLPSGH V+  +++++  Y+ GRM S+WGED  EFKPERWIS  G +KHEPS
Sbjct  11   HKSPSKSEVLPSGHKVEAESKIVICIYALGRMRSVWGEDASEFKPERWISENGGLKHEPS  70

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
             KF  FNAGPRTCLGK + L+QMKM+A  I+ +Y+F+VV+   + P+ +++++ KHGLKV
Sbjct  71   SKFLVFNAGPRTCLGKHIALLQMKMVALEIIQNYDFKVVEGQKIKPAPTVLLRIKHGLKV  130

Query  232  KFTK  221
              +K
Sbjct  131  TVSK  134



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V P  +++ S Y+ GRM +IWG+DC EFKPERWI+ +G IK+EP
Sbjct  376  QHKAPHQADVLPSGHRVHPKMKILFSLYAMGRMTTIWGKDCFEFKPERWITEQGGIKYEP  435

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK +   QMK +AA I+H+Y  Q+V  H V+P+ SII+  KH L 
Sbjct  436  SYKFFAFNAGPRTCLGKGVAFTQMKAVAAAIIHNYNVQLVQGHPVAPNVSIILHMKHELM  495

Query  235  VKFTKR  218
            V+ TKR
Sbjct  496  VRVTKR  501



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK++A  D+LPSGH +K N  +++S+Y+ GRM+ IWG DC+EFKPERWIS KG I H P
Sbjct  382  NHKIAAQADILPSGHHIKKNQTVLISYYAMGRMEEIWGNDCLEFKPERWISEKGCIVHVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            +YKF AF+AGPR CLGK+  L+QMKM+A+ ++ +Y  +V   H V P  SII+  K+GLK
Sbjct  442  TYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNYHVKVAKGHPVLPRKSIILNMKYGLK  501

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  502  VQLSKRS  508



>gb|AJD25224.1| cytochrome P450 CYP96A84 [Salvia miltiorrhiza]
Length=485

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKG-RIKHE  419
            +HK +   D+LPSGH V P+ +++ S Y+ GRM+SIWGEDC+EF+PERWIS  G  I+H 
Sbjct  355  QHKEALESDILPSGHTVGPDVKVMFSLYAMGRMESIWGEDCLEFRPERWISGAGASIRHT  414

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            P+YKF AFNAGPR+CLGKE+ L Q+K +AA ++++Y F+V + H V  + S+I+  +HGL
Sbjct  415  PAYKFLAFNAGPRSCLGKEVALAQIKAVAATLIYNYRFRVAEGHRVEHNCSVILYMRHGL  474

Query  238  KVKFTKR  218
            KVK   R
Sbjct  475  KVKVASR  481



>gb|KHM99046.1| Cytochrome P450 86B1 [Glycine soja]
Length=448

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HK +   D+LPSGH V PNT ++ S YS GRM+ IWG+D ++FKPERWIS +G I H 
Sbjct  320  FDHKCAIKSDILPSGHHVSPNTMILYSLYSMGRMEQIWGDDYLDFKPERWISERGNIIHI  379

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++ L++MKM+A  +L  +  QVV+ H ++P  S+I+  +HGL
Sbjct  380  PSYKFIAFNAGPRSCLGKDVTLIEMKMVAVALLWRFHMQVVEGHPITPRLSMILAMEHGL  439

Query  238  KVKFTKRNT  212
            KVK T+R T
Sbjct  440  KVKVTERCT  448



>ref|XP_002888363.1| hypothetical protein ARALYDRAFT_338681 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64622.1| hypothetical protein ARALYDRAFT_338681 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V  N ++++S Y+ GRM S+WG+D  +F+PERWIS  GR+KHEP
Sbjct  131  NHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSVWGDDAEDFRPERWISYSGRLKHEP  190

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK++  +QMK +AA I+ +Y+ +VV+ H   P  S++ + +HGLK
Sbjct  191  SYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDIKVVEGHKTEPVPSVLFRMQHGLK  250

Query  235  VKFTK  221
            V  TK
Sbjct  251  VNITK  255



>gb|KHM99045.1| Cytochrome P450 86B1 [Glycine soja]
Length=187

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK +   D+L SGH V PNT +  S YS GRM+ IWGEDCMEFKP+RWIS +G I H P
Sbjct  60   DHKCTIKSDILLSGHHVSPNTMIFYSLYSMGRMERIWGEDCMEFKPKRWISERGNIIHIP  119

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
             YKF  FNAGPR+CLGK++  ++MKM+A  +L  +  QVV+ H ++P  SI +  +HGLK
Sbjct  120  FYKFIPFNAGPRSCLGKDITFIEMKMVAVALLWRFHMQVVEGHPITPRLSITLGTEHGLK  179

Query  235  VKFTKR  218
            VK T+R
Sbjct  180  VKVTER  185



>ref|NP_001140984.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACF85104.1| unknown [Zea mays]
 gb|AFW80291.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=321

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK +A  D LPSG  V P+ R+I+SFYS GRM+++WG+DC EF+PERW+++ GR +HE
Sbjct  189  FEHKAAARTDTLPSGARVGPSRRVIVSFYSMGRMEAVWGKDCSEFRPERWLTAAGRFRHE  248

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLG+++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  249  PSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFRVEVDAGAVVRPKLSIILHMKDGL  308

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  309  KVRVHKRE  316



>ref|XP_002894690.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70949.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V+P +++++  Y+ GRM S+WGED  +FKPERWIS  G ++HEP
Sbjct  373  NHKAPAKPDVLPSGHKVEPESKIVICIYALGRMRSVWGEDASDFKPERWISDNGGLRHEP  432

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYK+ AFN+GPRTCLGK + L+QMK++A  I+ +Y+F+V++ H +    SI+++ KHGLK
Sbjct  433  SYKYVAFNSGPRTCLGKHLALLQMKIVALEIIKNYDFKVIEGHKIEAIPSILLRMKHGLK  492

Query  235  VKFTKR  218
            V  TK+
Sbjct  493  VTVTKK  498



>ref|XP_009400927.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK +   ++LPSGH V+  T++++S YS GRM+ IWG+DC+EF+PERWIS KGR++HE
Sbjct  408  FEHKAALRHEILPSGHRVEAGTKILVSLYSMGRMEGIWGKDCLEFRPERWISEKGRVRHE  467

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF  FN+GPRTCLGKE+   QMK + A ++++++ QV+  H V P  SII+  K+GL
Sbjct  468  PSYKFMPFNSGPRTCLGKEVAFTQMKAVVAAMVYNFQVQVLPGHVVEPKLSIILHLKNGL  527

Query  238  KVKFTKR  218
            +VK  +R
Sbjct  528  RVKIKRR  534



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  G   HEP
Sbjct  391  QHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSVHEP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  451  SYKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLK  510

Query  235  VKFTKR  218
            V  TKR
Sbjct  511  VTVTKR  516



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  N++++   YS GRM S+WGED +EFKPERWIS  G+  HEP
Sbjct  391  QHKSPTKTDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGKPVHEP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +YE ++V+  ++ P+ S+I+  KHG K
Sbjct  451  SYKFLSFNAGPRTCLGKEVALMQMKSVAVKIIQNYEMKIVEGQTIEPAPSVILHMKHGFK  510

Query  235  VKFTKR  218
            V  +KR
Sbjct  511  VTVSKR  516



>gb|KEH40818.1| cytochrome P450 family protein [Medicago truncatula]
Length=507

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IE K +   D+LPSG  V PNTR++   YS GRM+ IWGEDCMEFKPERWIS  G+I H 
Sbjct  379  IEQKFAIKADILPSGVHVSPNTRILYYLYSMGRMEKIWGEDCMEFKPERWISKSGQIIHV  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++  V+MKM AA IL  +   +VD H V+P  SI +  KHGL
Sbjct  439  PSYKFIAFNAGPRSCLGKDITFVEMKMAAAAILWKFCIHLVDGHPVTPRLSITLGMKHGL  498

Query  238  KVKFTKR  218
            KV  TKR
Sbjct  499  KVIVTKR  505



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V+ N++++   YS GRM ++WGED +EFKPERW+S  G+  HEP
Sbjct  387  QHKSPTKTDVLPSGHKVEANSKILFCLYSLGRMKTVWGEDALEFKPERWVSESGKSVHEP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  447  SYKFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNYEIKMVEGQKIEPAPSVILHTKHGLK  506

Query  235  VKFTK  221
            V  TK
Sbjct  507  VTVTK  511



>ref|XP_003556827.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=509

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK +   D+LPSGH V PNT ++ S YS GRM+ IWG+D ++FKPERWIS +G I H P
Sbjct  382  DHKCAIKSDILPSGHHVSPNTMILYSLYSMGRMEQIWGDDYLDFKPERWISERGNIIHIP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK++ L++MKM+A  +L  +  QVV+ H ++P  S+I+  +HGLK
Sbjct  442  SYKFIAFNAGPRSCLGKDVTLIEMKMVAVALLWRFHMQVVEGHPITPRLSMILAMEHGLK  501

Query  235  VKFTKRNT  212
            VK T+R T
Sbjct  502  VKVTERCT  509



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V+ N++++   YS GRM ++WGED +EFKPERW+S  G+  HEP
Sbjct  387  QHKSPTKTDVLPSGHKVEANSKILFCLYSLGRMKTVWGEDALEFKPERWVSESGKSVHEP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ L QMK +A  I+ +YE ++V+   + P+ S+I+  KHGLK
Sbjct  447  SYKFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNYEIKMVEGQKIEPAPSVILHTKHGLK  506

Query  235  VKFTK  221
            V  TK
Sbjct  507  VTVTK  511



>ref|XP_008440137.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=434

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK     + LPSGH V+P  R++ S Y+ GRM S+WGEDC EFKPERWIS KG IK 
Sbjct  304  AFEHKSPVEAETLPSGHHVRPGMRILFSLYALGRMRSVWGEDCEEFKPERWISDKGTIKR  363

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvsp---sdsiiIQA  251
            EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+Y+ + VD  S +    + S+I+  
Sbjct  364  EPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIIHNYDIEAVDEDSNNAVAPAASVILHM  423

Query  250  KHGLKVKFTKR  218
            K G +VK TKR
Sbjct  424  KSGFRVKVTKR  434



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK      +LPSGH V P  +++ S Y+ GRMD IWG+D  EFKPERWI+ +G IK+EP
Sbjct  380  QHKAPIQPVMLPSGHYVHPKMKILFSLYAMGRMDYIWGKDSKEFKPERWITDRGTIKYEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   Q+K +AA I+H+Y+ +VV  H V+P+ S+I+  KHGLK
Sbjct  440  SYKFLAFNAGPRTCLGKEVAFTQLKAVAAAIIHNYQVEVVKGHIVTPNVSVILYMKHGLK  499

Query  235  VKFTKRNT  212
            V+ +KR T
Sbjct  500  VRISKRWT  507



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK     +VLPSGH V  N++++L  YS GRM S+WGED  EFKPERWIS  G++ HEP
Sbjct  383  NHKSPTKSEVLPSGHKVDANSKIVLCLYSLGRMKSVWGEDAFEFKPERWISETGKLIHEP  442

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ ++Q+K +A  I+ +YE +VV+   + P+ S+I+  KHGLK
Sbjct  443  SYKFLSFNAGPRTCLGKELAMMQIKTVAVKIIQNYEIKVVEGQKIEPAPSVILHMKHGLK  502

Query  235  VKFTKR  218
            V  +KR
Sbjct  503  VTVSKR  508



>ref|XP_007134108.1| hypothetical protein PHAVU_010G019500g [Phaseolus vulgaris]
 gb|ESW06102.1| hypothetical protein PHAVU_010G019500g [Phaseolus vulgaris]
Length=504

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK +   D LPSGH +K N  ++ S YS GR + IWGEDC++F+PERWIS++  I H 
Sbjct  376  LEHKCALKSDFLPSGHFIKSNAMIVYSLYSMGRAEEIWGEDCLKFRPERWISNRRGIIHI  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++   ++KMIAA IL +Y  Q+V+  ++SP  S+++  KHGL
Sbjct  436  PSYKFIAFNAGPRSCLGKDISYTEIKMIAAAILWNYRIQLVEGQAISPGVSVVLHMKHGL  495

Query  238  KVKFTKRN  215
            KV  TKR+
Sbjct  496  KVTLTKRS  503



>ref|XP_010520636.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=511

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  D LPSGH V+ NT++I  FY+ GRM S+WG+D  EFKPERWIS KGR+KHEP
Sbjct  382  NHKSPAKADTLPSGHKVEANTKIIFPFYAMGRMRSVWGDDASEFKPERWISEKGRLKHEP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE-FQvvdshsvspsdsiiIQAKHGL  239
            S+KF +FNAGPRTC+GK++ L QM ++A  IL +Y+     +   +    SII++ KHG 
Sbjct  442  SFKFASFNAGPRTCIGKQVALTQMAIVAVEILQNYDVITATEGQQLELVPSIILRTKHGY  501

Query  238  KVKFTK  221
            KV  TK
Sbjct  502  KVSITK  507



>gb|KJB44293.1| hypothetical protein B456_007G244800 [Gossypium raimondii]
Length=499

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D LPSGH + P T+++ S YS GRM S+WGEDC EFKPERWI+ KG IKHEP
Sbjct  372  QHKEPLKPDTLPSGHPIHPTTKIVFSLYSMGRMKSVWGEDCFEFKPERWITEKGGIKHEP  431

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++  +QMK +A+ I+++Y   V+    V P+ SII++ K GL 
Sbjct  432  SYKFMSFNAGPRTCLGKDVAFLQMKAVASAIIYNYRIHVLGETPVVPTVSIILRTKDGLM  491

Query  235  VKFTKR  218
             K + R
Sbjct  492  TKISPR  497



>ref|XP_004157875.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK     + LPSGH V+P TR++ S Y+ GRM S+WGEDC EFKPERWIS KG IK 
Sbjct  345  AFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMRSVWGEDCEEFKPERWISDKGTIKR  404

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvsp---sdsiiIQA  251
            EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+Y+ + VD    +    + S+I+  
Sbjct  405  EPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYDIEAVDEDINNVVVPAASVILHM  464

Query  250  KHGLKVKFTKR  218
            K G +VK +KR
Sbjct  465  KSGFRVKVSKR  475



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HK     DVLPSGH V P  ++    Y+ GRM +IWG+DC+EFKPERWIS  G+IKHE
Sbjct  342  FQHKAPIQPDVLPSGHKVDPKMKIFFPVYAMGRMTAIWGKDCLEFKPERWISELGKIKHE  401

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FNAGPRTC+GKE+   QMK +AA I+H+Y  ++V  H V+P+ SII+  K G 
Sbjct  402  PSYKFFSFNAGPRTCIGKEVAFTQMKAVAATIIHNYHVEMVKGHHVAPNVSIILYMKRGF  461

Query  238  KVKFTKR  218
            KV+ +KR
Sbjct  462  KVRVSKR  468



>ref|XP_002888362.1| hypothetical protein ARALYDRAFT_894004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64621.1| hypothetical protein ARALYDRAFT_894004 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V  N ++++S Y+ GRM S+WG+D  +F+PERWIS  GR+K EP
Sbjct  84   NHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSVWGDDAEDFRPERWISYSGRLKQEP  143

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK++  +QMK +AA I+ +Y+ +VV+ H   P  S++ + +HGLK
Sbjct  144  SYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDIKVVEGHKTEPVPSVLFRMQHGLK  203

Query  235  VKFTK  221
            V  TK
Sbjct  204  VNITK  208



>ref|XP_004142038.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK     + LPSGH V+P TR++ S Y+ GRM S+WGEDC EFKPERWIS KG IK 
Sbjct  345  AFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMRSVWGEDCEEFKPERWISDKGTIKR  404

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvsp---sdsiiIQA  251
            EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+Y+ + VD    +    + S+I+  
Sbjct  405  EPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYDIEAVDEDINNVVVPAASVILHM  464

Query  250  KHGLKVKFTKR  218
            K G +VK +KR
Sbjct  465  KSGFRVKVSKR  475



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK  A   VLPSGH   P  +++ S Y+ GRM+ IWG+D  EFKPERWI+ +G +KHEP
Sbjct  382  QHKAPARPVVLPSGHYAGPEMKLLFSLYAMGRMEYIWGKDSGEFKPERWITERGTVKHEP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   Q+K +AA I+H+Y+ +VV+ H+VSP+ SII+  K+GLK
Sbjct  442  SYKFLAFNAGPRTCLGKEVAFTQLKCVAAAIIHNYQIEVVEGHNVSPNVSIILYMKYGLK  501

Query  235  VKFTKR  218
            V+ TKR
Sbjct  502  VRVTKR  507



>ref|XP_004513611.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=435

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK +   D+LPSG  V PNT+++ S Y+ GRM+ IWG+DCMEFKPERWIS KG I   P
Sbjct  308  EHKCAKKSDILPSGDHVSPNTKVMYSMYAMGRMEQIWGKDCMEFKPERWISDKGVIIQVP  367

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK+M  V MKMIA  +L  + F VV+ H V+P  S++++ +HG K
Sbjct  368  SYKFIAFNAGPRSCLGKDMTFVHMKMIATAMLWKFHFHVVEPHRVTPKLSMVLRMEHGFK  427

Query  235  VKFTKRN  215
            VK   R+
Sbjct  428  VKVNARS  434



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK++   D+LPSGH +K N  +++S+Y+ GRM+ IWG DC+EFKPERWIS KG I H P
Sbjct  337  NHKIAGQADILPSGHHIKKNQTVLISYYAMGRMEEIWGNDCLEFKPERWISEKGCIVHVP  396

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            +YKF AF+AGPR CLGK+  L+QMKM+A+ ++ +Y  +V   H V P  SII+  K+GLK
Sbjct  397  TYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNYHVKVAKGHPVLPRKSIILNMKYGLK  456

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  457  VQLSKRS  463



>ref|XP_010681240.1| PREDICTED: cytochrome P450 86A7-like [Beta vulgaris subsp. vulgaris]
Length=421

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A E K     D+LPSGH V PN ++I + Y+ GRM SIWG+DC EFKPERWIS++G I+H
Sbjct  305  AFEAKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWISAQGNIRH  364

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  311
            EPSYKF  FNAGPRTCLGKEM   QMK++AA ++  Y
Sbjct  365  EPSYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKY  401



>gb|KEH40842.1| cytochrome P450 family protein [Medicago truncatula]
Length=513

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK +   D+LPSGH V PNT++I S Y+ GRM+ +WG DC+EFKPERWIS KG+I H P
Sbjct  387  DHKCAVNSDILPSGHHVGPNTKLIYSLYAMGRMEHVWGGDCLEFKPERWISDKGQIIHVP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK++  +QMKM+AA +L  +   VV+  SV+P  SI+++ + GLK
Sbjct  447  SYKFIAFNAGPRSCLGKDISFIQMKMVAASVLWKFHIHVVEGQSVTPRVSIVLRVE-GLK  505

Query  235  VKFTKR  218
            V  +KR
Sbjct  506  VNVSKR  511



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HK     DVLPSGH V P  ++    Y+ GRM +IWG+DC+EFKPERWIS  G+IKHE
Sbjct  378  FQHKAPIQPDVLPSGHKVDPKMKIFFPVYAMGRMTAIWGKDCLEFKPERWISELGKIKHE  437

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FNAGPRTC+GKE+   QMK +AA I+H+Y  ++V  H V+P+ SII+  K G 
Sbjct  438  PSYKFFSFNAGPRTCIGKEVAFTQMKAVAATIIHNYHVEMVKGHHVAPNVSIILYMKRGF  497

Query  238  KVKFTKR  218
            KV+ +KR
Sbjct  498  KVRVSKR  504



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V+  ++++   YS GRM S+WGED +EFKPERWIS  GR  HEP
Sbjct  390  QHKSPTKPDVLPSGHKVEAKSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSIHEP  449

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+ + QMK +A  I+ +YE QVV+ H + P+ S+I+  KHGLK
Sbjct  450  SYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIQVVEGHKIEPAPSVILHMKHGLK  509

Query  235  VKFTKR  218
            V  +K+
Sbjct  510  VTVSKK  515



>ref|NP_001048917.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|ABF93893.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10831.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|EAZ25523.1| hypothetical protein OsJ_09347 [Oryza sativa Japonica Group]
Length=508

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK  A  DVLPSGH V+P  ++++S Y+ GRM+S+WG DCMEF+PERWIS  G++++ 
Sbjct  378  MEHKGPAAADVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISDDGKLRYV  437

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FN+GPRTCLGK+M  VQ+K  AA ++ ++E + V  H V P  SII+  K+G 
Sbjct  438  PSYKFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEIEAVAGHVVEPKLSIILHMKNGF  497

Query  238  KVKFTKR  218
             V+  +R
Sbjct  498  MVRVKRR  504



>gb|KHN27470.1| Cytochrome P450 86B1 [Glycine soja]
Length=412

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K++   DVLPSGH V   T ++ S Y+ GR +  WG+DC+EFKPERWIS K  I + P
Sbjct  285  ERKLAIKADVLPSGHSVNSRTMILFSLYAMGRFEETWGKDCLEFKPERWISEKRSIVYVP  344

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK++   QMKM+AA IL +Y  QVV+ +  +PS SI++  K GLK
Sbjct  345  SYKFIAFNAGPRTCLGKDLSFFQMKMVAAAILSNYRVQVVEGYVATPSLSIVLLMKDGLK  404

Query  235  VKFTKR  218
            VK TKR
Sbjct  405  VKITKR  410



>ref|XP_004968446.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=506

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK +A  D LPSG  V P+ R+I+SFY+ GRM+++WG+DC+EF+PERW+++ GR++HE
Sbjct  376  FEHKAAARPDTLPSGTPVGPSRRVIVSFYAMGRMEAVWGKDCLEFRPERWLTAAGRLRHE  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLG+++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  436  PSYKFVAFNVGPRTCLGRDLAYAQMKAVVAAVLPRFRVEVDAGAVVRPKLSIILHMKDGL  495

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  496  KVRVHKRE  503



>ref|XP_006411750.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
 gb|ESQ53203.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
Length=509

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A E K S   DVLPSGH V  N+++I+  Y+ GRM ++WGED ++FKPERWI+  G +KH
Sbjct  379  AFERKSSIEPDVLPSGHKVDANSKIIICLYALGRMRAVWGEDALQFKPERWITENGGLKH  438

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KF AFNAGPRTCLGK++ + QMK++   IL +Y+ +V+    + P    I+  KHG
Sbjct  439  EPSFKFLAFNAGPRTCLGKQLAMTQMKIVVVEILQNYDIKVIKGQKIEPVLGFILSMKHG  498

Query  241  LKVKFTKR  218
            L+V  T+R
Sbjct  499  LRVTITQR  506



>gb|KEH40822.1| cytochrome P450 family protein [Medicago truncatula]
Length=512

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK +   D+LPSG  VKPNT++I S Y+ GRM  IWG+D  EFKPERWIS KG I H P
Sbjct  387  QHKCAIKADILPSGDYVKPNTKLIYSLYAMGRMKQIWGKDRFEFKPERWISDKGHILHVP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S KF AFNAGPR+CLGK++ +VQMKM+AA +L  +  QVV+ HSV+P  SI+++ +HG K
Sbjct  447  SCKFIAFNAGPRSCLGKDISIVQMKMVAAAMLWKFHIQVVEGHSVTPRVSIVLRMEHGFK  506

Query  235  VKFTKR  218
            VK +KR
Sbjct  507  VKVSKR  512



>gb|EPS67771.1| hypothetical protein M569_06997, partial [Genlisea aurea]
Length=490

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK  A  D LPSGH V   T+++L  Y+ GRM+SIWG+DC EFKPERWIS +G I+H+P
Sbjct  364  QHKEPAEDDTLPSGHRVSRRTKVVLFLYAMGRMESIWGKDCGEFKPERWISERGTIRHQP  423

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLG+E  L Q+KM+AA I+ +YE  + + H  +P+ S+I+  K+GLK
Sbjct  424  SYKFLAFNAGPRTCLGREAALSQIKMVAAAIIQNYEVGLAEGHVAAPNCSVILYMKNGLK  483

Query  235  VKFTKR  218
            V   +R
Sbjct  484  VWIRRR  489



>ref|XP_007150924.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
 gb|ESW22918.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
Length=509

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLPSGH V P+T ++   YS GR + IWGEDCMEFKPERWIS KG I + P
Sbjct  382  ERKEALKSDVLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCMEFKPERWISEKGGIVYVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN GPRTCLGK + L+QMKM+A  ILH Y  QVV+ H   P  SI++  K GLK
Sbjct  442  SYKFVAFNTGPRTCLGKGVSLIQMKMVATAILHKYRLQVVEGHVAKPKLSIVLLMKDGLK  501

Query  235  VKFTKR  218
            V   KR
Sbjct  502  VTIKKR  507



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D LPSGH V P T+++ S Y+ GRM S+WGEDC EFKPERWI+ +G  KHEP
Sbjct  382  QHKEPLKPDSLPSGHPVYPKTKILFSLYALGRMKSVWGEDCFEFKPERWITDRGGNKHEP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+  VQMK +A+ I+++Y  QV++   V P+ SII+  K+GL 
Sbjct  442  SYKFLSFNAGPRTCLGKEVAFVQMKCVASAIIYNYRIQVLEETPVVPAVSIILHTKNGLM  501

Query  235  VKFTKR  218
             + ++R
Sbjct  502  ARVSRR  507



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A EHK     + LPSGH V+P TR++ S Y+ GRM S+WGEDC EFKPERWIS KG IK 
Sbjct  386  AFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMRSVWGEDCEEFKPERWISDKGTIKR  445

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvsp---sdsiiIQA  251
            EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+Y+ + VD    +    + S+I+  
Sbjct  446  EPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYDIEAVDEDINNVVVPAASVILHM  505

Query  250  KHGLKVKFTKR  218
            K G +VK +KR
Sbjct  506  KSGFRVKVSKR  516



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK++A  D+LPSGH +K N  +++S+Y+ GRM+ IWG+DC+EFKPERWIS K  I H P
Sbjct  391  NHKIAAQADILPSGHHIKKNQTVLISYYAMGRMEEIWGDDCLEFKPERWISEKWCIVHVP  450

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AF+AGPR CLGK+  L+QMKM+A+ ++ +Y  ++   H VSP +SII+  K+GLK
Sbjct  451  SYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNYHVKIAKGHPVSPCNSIILNMKYGLK  510

Query  235  VKFTKRN  215
            V+ +KR+
Sbjct  511  VQVSKRS  517



>gb|KEH24772.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH V PN  +  S YS GR  +IWGEDC+EFKPERWIS +G I + P
Sbjct  390  ERKQAIEADILPSGHHVFPNKMVFFSLYSMGRDANIWGEDCLEFKPERWISERGGIVYAP  449

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLG+E+ L+Q+KMIAA IL +Y   VV  H V+PS SI++  KHGLK
Sbjct  450  SYKFFSFNAGPRTCLGRELALIQVKMIAASILWNYCVHVVGDHQVTPSLSIVLLMKHGLK  509

Query  235  VKFTKR  218
            VK +KR
Sbjct  510  VKISKR  515



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK      +LPSGH V PN R++ S Y+ GR++SIWG+D  EFKPERWIS +G +KHEP
Sbjct  381  QHKTPREPCILPSGHHVHPNMRVMFSLYAMGRIESIWGKDAAEFKPERWISDRGIVKHEP  440

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y+ +V+  H V P+ SII+  +HG K
Sbjct  441  SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVEVIKGHKVYPNVSIILYMQHGFK  500

Query  235  VKFTKRNT  212
                KR T
Sbjct  501  ASIKKRWT  508



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSK-GRIKH  422
             +HK     D+LPSGH + PNT+ +LSFYS GRM+SIWG DC++FKP RWI  + GR++ 
Sbjct  379  FQHKAPVEHDILPSGHRISPNTKTVLSFYSMGRMESIWGNDCLDFKPGRWIDPETGRVRT  438

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPS+KF AFNAGPR+CLGK++  +Q+K++AA I+  +  +V    SV+PS S+I+  KHG
Sbjct  439  EPSFKFTAFNAGPRSCLGKDVSFIQLKIVAAAIVSRFNIRVARGFSVTPSISVILHMKHG  498

Query  241  LKVKFT  224
            LKVK +
Sbjct  499  LKVKVS  504



>gb|EAY88476.1| hypothetical protein OsI_09947 [Oryza sativa Indica Group]
Length=508

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            +EHK  A  DVLPSGH V+P  ++++S Y+ GRM+S+WG DCMEF+PERWIS  G++++ 
Sbjct  378  MEHKGPAAADVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISDDGKLRYV  437

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FN+GPRTCLGK+M  VQ+K  AA ++ ++E + V  H V P  SII+  K+G 
Sbjct  438  PSYKFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEIEAVAGHVVEPKLSIILHMKNGF  497

Query  238  KVKFTKR  218
             V   +R
Sbjct  498  MVTVKRR  504



>ref|XP_010527154.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=449

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK  A  DVLPSGH V+ N++++LS+Y+ GRM S+WG+D  +FKPERWIS  G  +HEP
Sbjct  321  QHKSPAKADVLPSGHRVEANSKIVLSYYALGRMRSVWGDDASDFKPERWISDSGGSRHEP  380

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S+KF AFNAGPRTCLGK++ L+QMK+ A  IL +++   ++   V    S+I++ KHG K
Sbjct  381  SFKFAAFNAGPRTCLGKQVALMQMKVAALEILENFDITAIEGQKVELVPSVILRMKHGFK  440

Query  235  VKFTKR  218
               TKR
Sbjct  441  AVMTKR  446



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK +A  D LPSG  V P+ R+I+SFYS GRM+++WG+DC EF+PERW+++ GR +HE
Sbjct  379  FEHKAAARTDTLPSGARVGPSRRVIVSFYSMGRMEAVWGKDCSEFRPERWLTAAGRFRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLG+++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  439  PSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFRVEVDAGAVVRPKLSIILHMKDGL  498

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  499  KVRVHKRE  506



>ref|XP_011005604.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=508

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EH VS   D LPSGH +  NTR+I   YS GRM+ IWGEDC+EFKPERWIS+ G IKH 
Sbjct  379  FEHTVSIDSDALPSGHRIGKNTRVIYCPYSMGRMEEIWGEDCLEFKPERWISNTGEIKHV  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
              YKF AFNAGPRTC+GK++ LV+MK + A ++ +Y  +VV+ H + P+++II+  KHGL
Sbjct  439  SPYKFIAFNAGPRTCIGKDLALVEMKAVGAAVIWNYSLKVVEDHPILPANAIILHMKHGL  498

Query  238  KVKFTKR  218
             V+  KR
Sbjct  499  MVRVLKR  505



>ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40966.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E KV    D+LP GH V  + +++ S YS GRM+ IWG+DC++F+PERWIS  G+IK  P
Sbjct  377  EVKVPVESDILPGGHHVNRDIKILYSLYSMGRMEDIWGKDCLKFRPERWISEAGKIKQVP  436

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+G V+MK++A+ I+ +Y  +VV+ H VSPS S+I+  K GLK
Sbjct  437  SYKFTAFNAGPRTCLGKELGFVEMKLVASAIIWNYSIKVVEDHPVSPSLSLILYMKDGLK  496

Query  235  VKFTKRNTA  209
            V+  KRN  
Sbjct  497  VRVAKRNAT  505



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK     +VLPSGH V  N++++   YS GRM S+WGED  EFKPERWIS  G+  HEPS
Sbjct  320  HKSPTKSEVLPSGHKVDANSKILFCLYSLGRMKSVWGEDAFEFKPERWISESGKSIHEPS  379

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE +VV+ H + P+ S+I+  KHGLKV
Sbjct  380  YKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEIKVVEGHKIEPAPSVILHMKHGLKV  439

Query  232  KFTKR  218
              +KR
Sbjct  440  TVSKR  444



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A +HK     D+LPSGH V PN R+++  Y+ GRM+SIWG+D  EFKP RWIS +G I +
Sbjct  381  AFQHKTPLEPDILPSGHHVHPNMRVMIPLYAMGRMESIWGKDASEFKPHRWISDRGTINY  440

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF +FNAGPRTCLGKE    QMK++ A I+H+Y+ ++V  H V P+ S+++  KHG
Sbjct  441  EPSYKFFSFNAGPRTCLGKEAAFTQMKVVVATIIHNYQIEMVKGHVVYPNVSVMLYMKHG  500

Query  241  LKVKFTKR  218
             KV+  ++
Sbjct  501  FKVRVKRK  508



>gb|KJB44331.1| hypothetical protein B456_007G246400 [Gossypium raimondii]
Length=507

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     D+LPSGH V P  +++ S Y+ GR+ S WGEDC+EFKPERWI+ +GRIKHEP
Sbjct  380  QHKEPLKPDILPSGHPVHPTMKILFSLYAMGRIKSFWGEDCLEFKPERWINERGRIKHEP  439

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGK++  +QMK +A+ I+++Y   V +   V P+ SII+  K+GL 
Sbjct  440  SYKFMSFNAGPRTCLGKDVAFLQMKAVASAIIYNYRIHVSEETPVVPAVSIILHTKNGLM  499

Query  235  VKFTKR  218
             + + R
Sbjct  500  ARISTR  505



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  +++++   YS GRM S+WGED  EFKPERWIS  GR+ H P
Sbjct  387  QHKSPTKSDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWISESGRLIHVP  446

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S+KF +FNAGPRTCLGKE+ + QMK +A  I+ +YE +VV+ H + P  SII+  KHGLK
Sbjct  447  SFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHKIEPVPSIILHMKHGLK  506

Query  235  VKFTKRN  215
            V  TKR+
Sbjct  507  VTVTKRS  513



>gb|KHN45347.1| Cytochrome P450 86B1 [Glycine soja]
Length=472

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IEHK +   D+LPSGH +  NT ++ S Y+ GR + IWGEDC++F PERWIS +G I H 
Sbjct  339  IEHKCALKSDMLPSGHWINSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISKQGGIIHI  398

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++   +MKM+A  IL +Y   +V+   +SP  SI++  KHGL
Sbjct  399  PSYKFIAFNAGPRSCLGKDISYTEMKMVAVSILSNYHVHLVEGQIISPRVSIVLHMKHGL  458

Query  238  KVKFTKRN  215
            KV+ TKR+
Sbjct  459  KVRVTKRS  466



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             E K++   DVLPSGH V   T ++ S Y+ GR +  WG+DC+EFKPERWIS K  I + 
Sbjct  374  FERKLAIKADVLPSGHSVNSRTMILFSLYAMGRFEETWGKDCLEFKPERWISEKRSIVYV  433

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGK++   QMKM+AA IL +Y  QVV+ +  +PS SI++  K GL
Sbjct  434  PSYKFIAFNAGPRTCLGKDLSFFQMKMVAAAILSNYRVQVVEGYVATPSLSIVLLMKDGL  493

Query  238  KVKFTKR  218
            KVK TKR
Sbjct  494  KVKITKR  500



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            + HK     DVLPSGH V+ N+++I+S Y+ GRM S+WGED  E+KPERWIS  G I+HE
Sbjct  370  LNHKSPLKSDVLPSGHNVEANSKIIISMYALGRMRSVWGEDASEYKPERWISEDGGIRHE  429

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AF+AGPR CLGK + L+QMKM+   I+ +Y+ ++V+ H++    SII++ KHGL
Sbjct  430  PSYKFVAFSAGPRACLGKHLALLQMKMVVVDIIQNYDLKIVEGHTIDSVPSIILRMKHGL  489

Query  238  KVKFTKR  218
            +V  +K+
Sbjct  490  RVTVSKK  496



>ref|XP_003629932.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04408.1| cytochrome P450 family protein [Medicago truncatula]
Length=493

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK +   DVLPSGH++K NT ++ S YS GR++ IWGEDC+EFKPERW+S KG   H P
Sbjct  366  EHKSNLKSDVLPSGHVIKSNTMILYSLYSIGRVEEIWGEDCLEFKPERWVSKKGGTIHVP  425

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+ LGK++  +++KM+A  IL +Y  QVV+ H + PS S+++  KHGLK
Sbjct  426  SYKFIAFNAGPRSRLGKDISFIELKMVAIAILLNYHIQVVEGHPIIPSLSVVLHMKHGLK  485

Query  235  VKFTKRN  215
            +   KR+
Sbjct  486  INVKKRS  492



>ref|XP_003555023.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Glycine max]
Length=509

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IEHK +   D+LPSGH +  NT ++ S Y+ GR + IWGEDC++F PERWIS +G I H 
Sbjct  376  IEHKCALKSDMLPSGHWINSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISKQGGIIHI  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++   +MKM+A  IL +Y   +V+   +SP  SI++  KHGL
Sbjct  436  PSYKFIAFNAGPRSCLGKDISYTEMKMVAVSILSNYHVHLVEGQIISPRVSIVLHMKHGL  495

Query  238  KVKFTKRN  215
            KV+ TKR+
Sbjct  496  KVRVTKRS  503



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWIS-SKGRIK  425
            A + K +   D+LPSGH +  NT+ +LS YS GRM+SIWG+DC+ FKP RWI+   GRIK
Sbjct  374  AFQFKSTVEHDILPSGHAINANTKTVLSLYSMGRMESIWGKDCLNFKPGRWINPETGRIK  433

Query  424  HEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKH  245
             EPS+KF AFN+GPR+CLGKE+  +QMK++AA I+  + F+V   H +SPS S+++  KH
Sbjct  434  TEPSFKFSAFNSGPRSCLGKEITFIQMKIVAAAIMSRFHFRVAQGHLISPSASVVLHMKH  493

Query  244  GLKVKFT  224
            GLKVK +
Sbjct  494  GLKVKVS  500



>gb|KHN19669.1| Cytochrome P450 86B1 [Glycine soja]
Length=455

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            +IE K +   D LPSGH V  NT ++ S Y+ GR + IWG+DC+EFKPERWIS +G + +
Sbjct  327  SIERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCEEIWGKDCLEFKPERWISERGEVVY  386

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
             P+YKF AFNAGPR CLGK++  VQMKM+AA IL  Y FQVV+ HS +PS SI++  K+G
Sbjct  387  APAYKFIAFNAGPRICLGKDLAFVQMKMVAAAILRKYRFQVVEGHSPTPSHSIVLLMKNG  446

Query  241  LKVKFTKR  218
            LK +  KR
Sbjct  447  LKARIMKR  454



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK +A  D LPSG  V P+ R+I+SFYS GRM+++WG+DC EF+PERW+++ GR +HE
Sbjct  379  FEHKAAARPDTLPSGARVGPSRRVIVSFYSMGRMEAVWGKDCSEFRPERWLTAAGRFRHE  438

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFN GPRTCLG+++   QMK + A +L  +  +V     V P  SII+  K GL
Sbjct  439  PSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFRVEVDAGAVVRPKLSIILHMKDGL  498

Query  238  KVKFTKRN  215
            KV+  KR 
Sbjct  499  KVRVHKRE  506



>ref|XP_007150922.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
 gb|ESW22916.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
Length=509

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH V P+T ++   YS GR + IWGEDCMEFKPERWIS KG I + P
Sbjct  382  ERKEALKSDLLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCMEFKPERWISEKGGIVYVP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFN GPRTCLGK++  +Q+KM+A  ILH Y  QVV+ +   P+ SI++  K GLK
Sbjct  442  SYKFVAFNTGPRTCLGKDVSFIQIKMVATAILHKYRLQVVEGYVAKPNLSIVLLIKDGLK  501

Query  235  VKFTKR  218
            V   KR
Sbjct  502  VTIKKR  507



>gb|KFK22353.1| hypothetical protein AALP_AAs42226U000100 [Arabis alpina]
Length=466

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V  N ++++S Y+ GRM SIWG+D  +F+PERWIS KG+++HEP
Sbjct  341  NHKSPAKPDVLPSGHKVDENWKIVISIYAVGRMRSIWGDDAEDFRPERWISDKGKLRHEP  400

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR+CLGK++  +Q+K +A  I+ +Y+ +VVD H   P+ S++++ KHGLK
Sbjct  401  SYKFLAFNAGPRSCLGKKLSFLQIKTVAVEIIRNYDIKVVDGHKAEPAPSVLLRMKHGLK  460

Query  235  VKFTK  221
            V  TK
Sbjct  461  VSVTK  465



>gb|EMT22280.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=197

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK +   D LP GH +K   +++L  YS GRM+ +WG+DCMEF+PERW++  G++++EPS
Sbjct  65   HKAAIAGDTLPRGHELKAGDKILLYCYSMGRMEGVWGKDCMEFRPERWVTDDGKLRYEPS  124

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AFNAGPRTCLGKE+   QMK IAA +L ++  + V  HSV P  S+I+  K+G  V
Sbjct  125  YKFIAFNAGPRTCLGKEVAFTQMKAIAAAVLWNFAVEAVPGHSVEPKLSVILHMKNGFAV  184

Query  232  KFTKRNTA  209
               +RN A
Sbjct  185  TVKRRNVA  192



>gb|KHN19678.1| Cytochrome P450 86B1 [Glycine soja]
Length=427

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IE K +   D LPSGH V  NT ++ S Y+ GR + IWG+DC+EFKPERWIS +G + + 
Sbjct  300  IERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCEEIWGKDCLEFKPERWISERGEVVYA  359

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            P+YKF AFNAGPR CLGK++  VQMKM+AA IL  Y FQVV+ HS +PS SI++  K+GL
Sbjct  360  PAYKFIAFNAGPRICLGKDLAFVQMKMVAASILRKYRFQVVEGHSPTPSHSIVLLMKNGL  419

Query  238  KVKFTKR  218
            K +  KR
Sbjct  420  KARIMKR  426



>ref|XP_006604019.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Glycine max]
Length=530

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IEHK +   D+LPSGH +  NT ++ S Y+ GR + IWGEDC++F PERWIS +G I H 
Sbjct  376  IEHKCALKSDMLPSGHWINSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISKQGGIIHI  435

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPR+CLGK++   +MKM+A  IL +Y   +V+ H++SP  SI++  KHGL
Sbjct  436  PSYKFIAFNAGPRSCLGKDISYTEMKMVAVSILSNYHVHLVEGHTISPGVSIVLHMKHGL  495

Query  238  KVKFTKRN  215
            KV+ TKR+
Sbjct  496  KVRVTKRS  503



>emb|CDY39934.1| BnaA09g15160D [Brassica napus]
Length=452

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK     DVLPSGH VK  +++++  Y+ GRM S+WGED  EFKPERWIS  G +KHEPS
Sbjct  327  HKSPLKSDVLPSGHKVKAESKIVICIYALGRMRSVWGEDASEFKPERWISENGGLKHEPS  386

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
             KF  F+AGPRTCLGK++ L+QMKM+A  I+ +Y+F+VVDS  + P  S+I++ KHGLKV
Sbjct  387  SKFLVFSAGPRTCLGKQLALLQMKMVAVEIIQNYDFKVVDSQKIEPVPSVILRIKHGLKV  446

Query  232  KFTKR  218
               K+
Sbjct  447  TVNKK  451



>gb|EPS72790.1| hypothetical protein M569_01963, partial [Genlisea aurea]
Length=491

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK  A   VLPSGH V P  +++ S Y+  RM  IWGEDC EF+PERWI+ +G++ +EP
Sbjct  365  QHKSPAAPAVLPSGHYVHPKMKVLFSLYAMARMAYIWGEDCKEFRPERWINGRGKVNYEP  424

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTC+GKE+   Q+K +AA ++++Y  ++V+ H VSP+ S+I+  KHG K
Sbjct  425  SYKFMAFNAGPRTCIGKEVAFTQLKAVAAAVIYNYRVELVEGHDVSPNVSVILYMKHGFK  484

Query  235  VKFTKR  218
            V+ TKR
Sbjct  485  VRVTKR  490



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             EHK     +VLPSG   +P+T+++ S YS GRM+ +WG+DC+EFKPERWIS KGR++HE
Sbjct  397  FEHKGVLQSEVLPSGDKAQPSTKILFSLYSMGRMEGVWGKDCLEFKPERWISEKGRLRHE  456

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF +FN+GPRTC+GK+M   QMK + A +++++   VV+ H V P  SII+  K+GL
Sbjct  457  PSYKFTSFNSGPRTCIGKDMAFTQMKAVVAAMVYNFHVDVVEGHVVQPKISIILHMKNGL  516

Query  238  KVKFTKRNTA  209
             V+  KR +A
Sbjct  517  MVRIRKRASA  526



>ref|XP_002888361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64620.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK  A  DVLPSGH V  N ++++S Y+ GRM S+WG+D  +F+PERWIS  GR+KHEP
Sbjct  227  NHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSVWGDDAEDFRPERWISYSGRLKHEP  286

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK++  +QMK +A  I+ +Y+ +VV+ H   P  S++ + +HGLK
Sbjct  287  SYKFLAFNAGPRACLGKKLTFLQMKTVAVEIIRNYDIKVVEGHKTEPVPSVLFRMQHGLK  346

Query  235  VKFTK  221
            V  TK
Sbjct  347  VNITK  351



>gb|KDP35252.1| hypothetical protein JCGZ_09411 [Jatropha curcas]
Length=491

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E+K     D+LPSGH V P  +++LS Y  GR+ S+WGEDC EFKPERWIS +GRI H+ 
Sbjct  363  EYKAPLQNDILPSGHYVDPKMKILLSSYLMGRLKSLWGEDCFEFKPERWISEQGRIIHQS  422

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvs-psdsiiIQAKHGL  239
             YKF AFNAGPRTC+GK++  VQMK +AA +LH+Y  +VV+ H+V     SII+  K+GL
Sbjct  423  PYKFLAFNAGPRTCVGKDIAFVQMKAMAAFLLHNYNIEVVEEHAVVPKYTSIILHMKYGL  482

Query  238  KVKFTKR  218
            KV+ ++R
Sbjct  483  KVRISRR  489



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -1

Query  589  KVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSY  410
            K S   DVLPSGH V  N+ +I+S Y+ GRM ++WGED ++FKPERWIS  G +K EPS+
Sbjct  382  KSSVESDVLPSGHRVDANSMIIISLYALGRMKAVWGEDALKFKPERWISENGGLKQEPSF  441

Query  409  KFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVK  230
            KF AFN+GPR CLGK + + QMK +A  ILH+Y+ +V     + P    I+  KHGLKV 
Sbjct  442  KFLAFNSGPRICLGKNLAMTQMKTVAVEILHNYDIKVTKGQKIEPVLGFILSMKHGLKVT  501

Query  229  FTKR  218
             TKR
Sbjct  502  ITKR  505



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
             +HK     DVLPSGH V P+T+++   YS GRM S+WGED  EFKPERWIS  GR+ H 
Sbjct  386  FQHKSPTKPDVLPSGHRVDPSTKIVFCLYSLGRMKSVWGEDASEFKPERWISETGRLIHV  445

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +YE ++V+ H + P  SII+  K GL
Sbjct  446  PSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEVKIVEGHKIEPVPSIILHMKQGL  505

Query  238  KVKFTKR  218
            +V  TKR
Sbjct  506  RVMVTKR  512



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 95/139 (68%), Gaps = 9/139 (6%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  +++++   YS GRM S+WGED  EFKPERW+S  GR+ H P
Sbjct  344  QHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVSESGRLTHVP  403

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y+ +VV+ H + P  SII+  KHGLK
Sbjct  404  SFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYDIKVVEGHKIEPVPSIILHMKHGLK  463

Query  235  VKFTKRNTA*HFVCICSFV  179
            V+ TK         IC+FV
Sbjct  464  VRVTK---------ICNFV  473



>gb|KEH24773.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH V PN  ++ S Y+ GR ++IWG+DC+EFKPERWIS +G I + P
Sbjct  390  ERKEAVKPDILPSGHHVYPNNMILFSLYAMGRDENIWGKDCLEFKPERWISERGGIVYAP  449

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLG+E+  +Q+KM+AA +L +Y   VV+ H V+P+ SI++  +HGLK
Sbjct  450  SYKFFSFNAGPRTCLGRELAFIQVKMVAASVLWNYCVHVVEDHQVTPNLSIVLLMEHGLK  509

Query  235  VKFTKR  218
            VK TKR
Sbjct  510  VKITKR  515



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGR-IKHE  419
            +HK     D LPSGH V P  +++ S Y+ GRM+SIWG+DC EFKPERWIS  GR ++HE
Sbjct  377  QHKEPVEPDTLPSGHFVHPKMKVLFSLYAMGRMESIWGKDCSEFKPERWISEGGRSVRHE  436

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            PSYKF AFNAGPRTCLGKE+   QMK +AA ++H+Y  +VVD H V P+ SII+  + GL
Sbjct  437  PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAALIHNYRVRVVDGHRVVPNCSIILYMRDGL  496

Query  238  KVKFTKR  218
            KV+   R
Sbjct  497  KVRVASR  503



>emb|CDY39926.1| BnaA09g15080D [Brassica napus]
Length=496

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK     DVLPSGH VK  +++++  Y+ GRM S+WGED ++FKPERWIS  G +KHEPS
Sbjct  371  HKSPLKSDVLPSGHKVKAESKIVICIYALGRMRSVWGEDALDFKPERWISESGELKHEPS  430

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AFNAGPR CLGK + L QMK++A  I+ +Y+F+V + H +    SI+++ K+GL+V
Sbjct  431  YKFMAFNAGPRACLGKHLALPQMKIVAVEIIQNYDFKVTEGHKIEAVPSIVLRMKNGLRV  490

Query  232  KFTKR  218
              TK+
Sbjct  491  TVTKK  495



>gb|EMT05588.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=508

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK +   DVLPSGH +K   ++++ +YS GRM+ +WG+DCMEF+PERW++  G++++EP
Sbjct  376  QHKAAVAGDVLPSGHEMKAGDKILIYYYSMGRMEGVWGKDCMEFRPERWLADDGKVRYEP  435

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGKE+   QMK++AA +L ++  + V  H V P  SII+  K+GL 
Sbjct  436  SYKFMAFNAGPRTCLGKEVAFTQMKVVAAAMLWNFAVEAVPGHVVEPKLSIILHMKNGLA  495

Query  235  VKFTKRNTA*HFVCI  191
            V   +RN    F C+
Sbjct  496  VAVKRRN----FPCV  506



>ref|XP_004515481.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=513

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK +   D+LP+G  V  NT++I S Y+ GRM+ IWGE+C+EFKPERWIS  G+  H P
Sbjct  385  NHKCAIKSDILPNGEHVSSNTKVIFSMYAMGRMEEIWGENCLEFKPERWISDIGQSIHVP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SY+F AFNAGPR+CLGK+M ++QMKM A  +L  +  QVV+  S++P  SI+++ +HG K
Sbjct  445  SYQFTAFNAGPRSCLGKDMSIIQMKMAAVTMLWKFHIQVVEGQSITPRASIVLRMEHGFK  504

Query  235  VKFTKR  218
            VK TKR
Sbjct  505  VKLTKR  510



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IE K +   D LPSGH V  NT ++ S Y+ GR + IWG+DC+EFKPERWIS +G + + 
Sbjct  375  IERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCEEIWGKDCLEFKPERWISERGEVVYA  434

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            P+YKF AFNAGPR CLGK++  VQMKM+AA IL  Y FQVV+ HS +PS SI++  K+GL
Sbjct  435  PAYKFIAFNAGPRICLGKDLAFVQMKMVAASILRKYRFQVVEGHSPTPSHSIVLLMKNGL  494

Query  238  KVKFTKR  218
            K +  KR
Sbjct  495  KARIMKR  501



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  +++++   YS GRM S+WGED  EFKPERW+S  GR+ H P
Sbjct  385  QHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVSESGRLIHVP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S+KF +FNAGPRTCLGKE+ + QMK +A  I+ +YE +VV+ H V P  SII+  KHGLK
Sbjct  445  SFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHKVEPVPSIILHMKHGLK  504

Query  235  VKFTKR  218
            V  TKR
Sbjct  505  VTVTKR  510



>ref|NP_001048918.1| Os03g0140200 [Oryza sativa Japonica Group]
 dbj|BAF10832.1| Os03g0140200 [Oryza sativa Japonica Group]
Length=227

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            EHK  A  DVLPSGH +K   ++++  YS GRM+ +WG+DC EF PERWI+S+G++++EP
Sbjct  96   EHKAVAADDVLPSGHEMKAGDKVLVFSYSMGRMEGVWGKDCTEFLPERWITSEGKLRYEP  155

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FNAGPRTCLGKE+  VQ+K +AA ++ ++  +VV  H+V P  SII+  K+GL 
Sbjct  156  SYKFFSFNAGPRTCLGKELAFVQLKTVAAAVMWNFAVEVVPGHAVEPKLSIILHMKNGLA  215

Query  235  VKFTKRNT  212
            V   +R T
Sbjct  216  VTVKRRAT  223



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V  N+ +++  Y+ GRM ++WGED +EFKPERWI+  G IKHEPS+KF +FN
Sbjct  389  DVLPSGHKVDANSNIVICLYALGRMRAVWGEDALEFKPERWITESGGIKHEPSFKFLSFN  448

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  212
            AGPRTCLGK + L QMK++A  IL +Y+ +VV+   + P   II+  KHGL++  TKR  
Sbjct  449  AGPRTCLGKHIALNQMKIVAVEILQNYDIKVVEGQKIEPVLGIILSMKHGLRITVTKRCL  508

Query  211  A  209
            A
Sbjct  509  A  509



>ref|XP_004515489.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=539

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK +   D+LP+G  V  NT++I S Y+ GRM+ IWGE+C+EFKPERWIS  G+  H P
Sbjct  411  NHKCAIKSDILPNGEHVSSNTKVIFSMYAMGRMEEIWGENCLEFKPERWISDIGQSIHVP  470

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SY+F AFNAGPR+CLGK+M ++QMKM A  +L  +  QVV+  S++P  SI+++ +HG K
Sbjct  471  SYQFTAFNAGPRSCLGKDMSIIQMKMAAVTMLWKFHIQVVEGQSITPRASIVLRMEHGFK  530

Query  235  VKFTKR  218
            VK TKR
Sbjct  531  VKLTKR  536



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V  N+++I+  Y+ GRM ++WGED  +FKPERWIS  G IKHEPS+KF +FN
Sbjct  386  DVLPSGHKVDANSKIIICLYALGRMRAVWGEDASQFKPERWISENGGIKHEPSFKFLSFN  445

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  212
            AGPRTCLGK + + QMK++A  IL +Y+ +V+    + P+   I+  KHGL++  TKR +
Sbjct  446  AGPRTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQKIVPALGFILSMKHGLQITVTKRCS  505

Query  211  A  209
            A
Sbjct  506  A  506



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V  N+++I+  Y+ GRM ++WGED  +FKPERWIS  G IKHEPS+KF +FN
Sbjct  386  DVLPSGHKVDANSKIIICLYALGRMRAVWGEDASQFKPERWISENGGIKHEPSFKFLSFN  445

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  212
            AGPRTCLGK + + QMK++A  IL +Y+ +V+    + P+   I+  KHGL++  TKR +
Sbjct  446  AGPRTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQKIVPALGFILSMKHGLQITVTKRCS  505

Query  211  A  209
            A
Sbjct  506  A  506



>ref|XP_010660343.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=503

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            D+LPSGH V P+T++I   Y+ GRM   WG+DC+EFKPERW++ KGR KHEP+YKF AF+
Sbjct  384  DILPSGHRVDPSTKVIFHAYAMGRMACAWGKDCLEFKPERWLTGKGRTKHEPAYKFLAFS  443

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  218
            AGPR CLGKE+   +MK +AA I+H+Y FQ+V  H V P+ SI++  KHGL+V    +
Sbjct  444  AGPRICLGKEVAFFKMKAVAAAIMHNYHFQMVKGHRVVPTVSIVLHMKHGLRVNVKNK  501



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  571  DVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFN  392
            DVLPSGH V  N+++I+  Y+ GRM ++WGED ++FKPERWI+  G IKHEPS+KF +FN
Sbjct  388  DVLPSGHKVDANSKIIICLYALGRMRAVWGEDALQFKPERWITENGGIKHEPSFKFLSFN  447

Query  391  AGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  218
            AGPRTCLGK + + QMK++A  IL +Y+ +VV    + P+  II+  KHGL++  TKR
Sbjct  448  AGPRTCLGKHIAMAQMKIVAVEILQNYDIKVVQGQKIEPALGIILSMKHGLRITVTKR  505



>dbj|BAA99522.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 gb|EAZ10814.1| hypothetical protein OsJ_00649 [Oryza sativa Japonica Group]
Length=510

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   DVLP+G  V  NTR+I S Y+ GR++ IWG+DCMEFKPERW+S  GR++HEP
Sbjct  382  EEKEALVDDVLPNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEP  441

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF +FN GPR+CLGKE+ L  MK+I A I+H+++ ++V+ H V P  S+I+  ++G+ 
Sbjct  442  SYKFLSFNTGPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSSVILHTQNGMM  501

Query  235  VKFTKRNTA  209
            V+  +R+ A
Sbjct  502  VRLKRRDAA  510



>gb|KEH24775.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH+V PNT ++   YS GR + IWG+DC+EFKPERWIS +G I H P
Sbjct  378  ERKQAIKGDILPSGHIVNPNTIILFFLYSMGRFEEIWGKDCLEFKPERWISERGGIVHTP  437

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF ++NAGPRTCLGK++  +Q+KM    IL  Y  QVVD H    S SI++  K+GLK
Sbjct  438  SYKFISYNAGPRTCLGKDLSFIQIKMTTIAILSKYCVQVVDGHVPILSHSIVLLMKNGLK  497

Query  235  VKFTKR  218
            V+ TKR
Sbjct  498  VRITKR  503



>ref|XP_007150926.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
 gb|ESW22920.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
Length=503

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  598  IEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHE  419
            IE K +   D LPSGH V  NT ++ S Y+ GR + IWG+DCMEFKPERWIS +G I + 
Sbjct  374  IERKQAVKADTLPSGHRVNGNTMIMFSLYAMGRCEEIWGKDCMEFKPERWISERGEIVYA  433

Query  418  PSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGL  239
            P YKF AFNAGPR CLGK++  +QMKM+AA IL  Y F+VV+ H  +PS SI++   +GL
Sbjct  434  PPYKFIAFNAGPRICLGKDLAFLQMKMVAAAILRSYRFKVVEGHVATPSHSIVLLMNNGL  493

Query  238  KVKFTKRN  215
            K   TKR 
Sbjct  494  KATITKRQ  501



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            E K +   D+LPSGH V   T ++ S Y+ GR +  WG+DC EFKPERWIS KG I + P
Sbjct  337  ERKQAISSDMLPSGHRVNSGTMILFSLYAMGRFEETWGKDCFEFKPERWISEKGGIVYVP  396

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPRTCLGK+   +QMKM+A  ILH Y  QVV+    +PS SI++  K GLK
Sbjct  397  SYKFIAFNAGPRTCLGKDSSFIQMKMVATAILHKYRVQVVEGFVATPSLSIVLLMKDGLK  456

Query  235  VKFTKR  218
            V+ TKR
Sbjct  457  VQITKR  462



>gb|EPS59359.1| hypothetical protein M569_15450, partial [Genlisea aurea]
Length=365

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGHLVK N R++LSFYS GRM+SIWG+D  EF+P RW S +G +K  P
Sbjct  240  QHKSPLNDDVLPSGHLVKRNDRIVLSFYSMGRMESIWGKDSGEFRPGRWFSDEGTMKLFP  299

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            ++KFPAFNAGPR+C+GKE+  VQMK++ A +L  ++  VVD     P  SI++Q + GLK
Sbjct  300  AFKFPAFNAGPRSCIGKEISFVQMKIVIAAVLSRFKIAVVDGDHARPRASIVLQLEDGLK  359

Query  235  VKFTK  221
             + TK
Sbjct  360  TRVTK  364



>ref|XP_009113345.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
             HK     DVLPSGH VK  +++++  Y+ GRM S+WGED ++FKPERWIS  G +KHEP
Sbjct  370  NHKSPLKSDVLPSGHKVKAESKIVICIYALGRMRSVWGEDALDFKPERWISESGELKHEP  429

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            SYKF AFNAGPR CLGK + L QMK++A  I+ +Y+F+V + H +    SI+++ K+GL 
Sbjct  430  SYKFMAFNAGPRACLGKHLALPQMKIVAVEIIQNYDFKVTEGHKIEAVPSIVLRMKNGLS  489

Query  235  VKFTKR  218
            V  TK+
Sbjct  490  VTVTKK  495



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  595  EHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEP  416
            +HK     DVLPSGH V  +++++   YS GRM S+WGED  EFKPERWIS  GR+ H P
Sbjct  385  QHKSPTKPDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWISESGRLIHMP  444

Query  415  SYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLK  236
            S+KF +FNAGPRTCLGKE+ + Q+K +A  I+ +YE ++VD H + P  SII+  KHGLK
Sbjct  445  SFKFLSFNAGPRTCLGKEVAMTQLKTVAVKIIQNYEIKIVDGHKIEPVPSIILHMKHGLK  504

Query  235  VKFTKR  218
            V  TKR
Sbjct  505  VTVTKR  510



>ref|XP_006301880.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
 gb|EOA34778.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
Length=456

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  592  HKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPS  413
            HK  +  +VLPSGH V+ ++++++S Y+ GRM S+WGED  +FKPERWI   G I+HEPS
Sbjct  331  HKSPSESEVLPSGHKVEAHSKIVISIYALGRMRSVWGEDASDFKPERWILEDGGIRHEPS  390

Query  412  YKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHGLKV  233
            YKF AFN+GPRTCLGK + L+Q+K++A  I+ +Y+F++V+   + P  S+I+  KHGLKV
Sbjct  391  YKFLAFNSGPRTCLGKNLALLQLKIVAVDIIRNYDFKIVEGQKIEPVTSVILTMKHGLKV  450

Query  232  KFTKR  218
              +K+
Sbjct  451  TVSKK  455



>ref|XP_009790818.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=512

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  601  AIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGEDCMEFKPERWISSKGRIKH  422
            A +HK     D+LPSGH V PN R+++   + GRM+SIWG+D  EFKP RWIS +G IKH
Sbjct  383  AFQHKTPLEPDILPSGHHVHPNMRVMIPLCAMGRMESIWGKDASEFKPHRWISDRGTIKH  442

Query  421  EPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQvvdshsvspsdsiiIQAKHG  242
            EPSYKF +FNAGPRTCLGKE+   QMK++ A I+++Y+ ++V  H V P+ S+++  KHG
Sbjct  443  EPSYKFFSFNAGPRTCLGKEVAFTQMKLVVATIIYNYQIEMVKGHVVYPNLSVMLYMKHG  502

Query  241  LKVKFTKR  218
              V+  ++
Sbjct  503  FNVRVKRK  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940