BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042P10

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           220   7e-68   Nicotiana tomentosiformis
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           220   8e-68   Nicotiana sylvestris
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           219   1e-67   Sesamum indicum [beniseed]
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           219   2e-67   Nicotiana sylvestris
ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                219   2e-67   Sesamum indicum [beniseed]
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           219   2e-67   Nicotiana tomentosiformis
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           219   3e-67   Nicotiana tomentosiformis
ref|XP_004148191.1|  PREDICTED: 40S ribosomal protein S4-like           217   3e-67   
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                218   3e-67   Nicotiana sylvestris
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                218   4e-67   Nicotiana tomentosiformis
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           217   9e-67   Nicotiana sylvestris
gb|KJB38001.1|  hypothetical protein B456_006G231800                    214   1e-66   Gossypium raimondii
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           216   2e-66   
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           216   3e-66   Cucumis sativus [cucumbers]
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              216   4e-66   Glycine max [soybeans]
gb|ACU24295.1|  unknown                                                 216   4e-66   Glycine max [soybeans]
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              215   5e-66   Cucumis melo [Oriental melon]
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         215   6e-66   Cucumis melo [Oriental melon]
ref|NP_001275093.1|  40S ribosomal protein S4-like                      215   7e-66   Solanum tuberosum [potatoes]
emb|CBI25428.3|  unnamed protein product                                214   8e-66   Vitis vinifera
ref|XP_010087529.1|  40S ribosomal protein S4                           216   9e-66   
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           214   1e-65   Solanum lycopersicum
gb|KHN10552.1|  40S ribosomal protein S4                                212   1e-65   Glycine soja [wild soybean]
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           214   1e-65   Solanum lycopersicum
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         214   1e-65   Cucumis melo [Oriental melon]
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           214   1e-65   
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                214   1e-65   Solanum lycopersicum
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         214   1e-65   Vitis vinifera
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              214   2e-65   Vitis vinifera
gb|KHN48586.1|  40S ribosomal protein S4-2                              214   2e-65   Glycine soja [wild soybean]
gb|KJB36905.1|  hypothetical protein B456_006G184600                    213   2e-65   Gossypium raimondii
gb|KJB38000.1|  hypothetical protein B456_006G231800                    213   3e-65   Gossypium raimondii
gb|KJB77064.1|  hypothetical protein B456_012G118500                    213   3e-65   Gossypium raimondii
ref|NP_001242281.1|  uncharacterized protein LOC100812132               213   3e-65   Glycine max [soybeans]
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              213   3e-65   Glycine max [soybeans]
gb|KJB77063.1|  hypothetical protein B456_012G118500                    213   3e-65   Gossypium raimondii
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        213   3e-65   Theobroma cacao [chocolate]
gb|ACU24626.1|  unknown                                                 213   4e-65   Glycine max [soybeans]
ref|NP_001275148.1|  40S ribosomal protein S4                           213   5e-65   Solanum tuberosum [potatoes]
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           213   5e-65   Solanum lycopersicum
gb|KJB71672.1|  hypothetical protein B456_011G136800                    213   5e-65   Gossypium raimondii
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    212   5e-65   Glycine max [soybeans]
gb|KJB37999.1|  hypothetical protein B456_006G231800                    213   5e-65   Gossypium raimondii
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              213   5e-65   Prunus mume [ume]
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           213   5e-65   Solanum tuberosum [potatoes]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           213   6e-65   
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           213   6e-65   Solanum tuberosum [potatoes]
gb|KHN03095.1|  40S ribosomal protein S4                                212   6e-65   Glycine soja [wild soybean]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       213   6e-65   Cucumis sativus [cucumbers]
gb|KHG02126.1|  40S ribosomal S4                                        213   6e-65   Gossypium arboreum [tree cotton]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        212   7e-65   
gb|KHN38535.1|  40S ribosomal protein S4-1                              212   8e-65   Glycine soja [wild soybean]
ref|NP_001235826.1|  40S ribosomal S4 protein                           212   8e-65   Glycine max [soybeans]
gb|KHG30713.1|  40S ribosomal S4                                        212   9e-65   Gossypium arboreum [tree cotton]
emb|CDP06439.1|  unnamed protein product                                211   1e-64   Coffea canephora [robusta coffee]
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                212   1e-64   Glycine max [soybeans]
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             213   1e-64   
gb|KCW49428.1|  hypothetical protein EUGRSUZ_K02962                     209   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006374217.1|  40S ribosomal protein S4                           212   1e-64   Populus trichocarpa [western balsam poplar]
gb|KJB17111.1|  hypothetical protein B456_002G266000                    209   1e-64   Gossypium raimondii
gb|KHN00473.1|  40S ribosomal protein S4-1                              213   2e-64   Glycine soja [wild soybean]
gb|KHG02041.1|  40S ribosomal S4                                        211   2e-64   Gossypium arboreum [tree cotton]
dbj|BAE20168.1|  ribosomal protein S4                                   211   2e-64   Panax ginseng [Asiatic ginseng]
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    211   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    211   2e-64   
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    211   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             211   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              211   2e-64   Populus euphratica
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         211   2e-64   Tarenaya hassleriana [spider flower]
gb|KHG26321.1|  40S ribosomal S4                                        211   3e-64   Gossypium arboreum [tree cotton]
gb|KCW60005.1|  hypothetical protein EUGRSUZ_H02737                     208   3e-64   Eucalyptus grandis [rose gum]
emb|CBI15899.3|  unnamed protein product                                210   3e-64   Vitis vinifera
gb|KJB17112.1|  hypothetical protein B456_002G266000                    210   3e-64   Gossypium raimondii
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              210   4e-64   Populus euphratica
gb|KJB29916.1|  hypothetical protein B456_005G123400                    210   4e-64   Gossypium raimondii
ref|XP_008809054.1|  PREDICTED: 40S ribosomal protein S4-like           208   6e-64   Phoenix dactylifera
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         209   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                210   8e-64   Vitis vinifera
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             209   8e-64   Populus trichocarpa [western balsam poplar]
gb|KJB29915.1|  hypothetical protein B456_005G123400                    209   9e-64   Gossypium raimondii
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           209   1e-63   Gossypium hirsutum [American cotton]
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         209   1e-63   Eucalyptus grandis [rose gum]
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 209   1e-63   Ricinus communis
gb|ACJ84252.1|  unknown                                                 207   2e-63   Medicago truncatula
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         209   2e-63   Populus euphratica
gb|KHG11751.1|  40S ribosomal S4                                        208   2e-63   Gossypium arboreum [tree cotton]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         208   2e-63   Pyrus x bretschneideri [bai li]
emb|CDX81032.1|  BnaC03g02860D                                          208   4e-63   
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              208   4e-63   Eucalyptus grandis [rose gum]
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         207   4e-63   Phoenix dactylifera
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                207   5e-63   Erythranthe guttata [common monkey flower]
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         207   5e-63   
ref|XP_007156131.1|  hypothetical protein PHAVU_003G261200g             205   5e-63   Phaseolus vulgaris [French bean]
emb|CDY58877.1|  BnaA03g55550D                                          208   7e-63   Brassica napus [oilseed rape]
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                207   8e-63   Erythranthe guttata [common monkey flower]
ref|XP_003604568.1|  40S ribosomal protein S4                           207   1e-62   Medicago truncatula
gb|ABK92450.1|  unknown                                                 207   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             206   1e-62   Eutrema salsugineum [saltwater cress]
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    206   1e-62   Arabis alpina [alpine rockcress]
dbj|BAH57121.1|  AT5G07090                                              204   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884052.1|  40S ribosomal protein S4                           206   1e-62   Arabidopsis lyrata subsp. lyrata
emb|CDY32700.1|  BnaA02g07620D                                          207   2e-62   Brassica napus [oilseed rape]
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         206   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002871248.1|  40S ribosomal protein S4                           206   2e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         206   2e-62   Elaeis guineensis
dbj|BAB10257.1|  ribosomal protein S4                                   205   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30303.1|  40S ribosomal S4                                        206   2e-62   Gossypium arboreum [tree cotton]
ref|XP_009345329.1|  PREDICTED: 40S ribosomal protein S4                203   2e-62   
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         206   2e-62   Jatropha curcas
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             207   2e-62   
emb|CDY02821.1|  BnaC02g10680D                                          206   2e-62   
emb|CDY60025.1|  BnaAnng16450D                                          206   3e-62   Brassica napus [oilseed rape]
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         206   3e-62   Populus euphratica
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             206   3e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         206   3e-62   Eucalyptus grandis [rose gum]
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         206   3e-62   Populus euphratica
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             205   4e-62   Populus trichocarpa [western balsam poplar]
ref|NP_001031846.1|  40S ribosomal protein S4-2                         205   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             205   4e-62   Capsella rubella
gb|KDO67007.1|  hypothetical protein CISIN_1g024108mg                   203   4e-62   Citrus sinensis [apfelsine]
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         205   4e-62   Camelina sativa [gold-of-pleasure]
gb|AAL49933.1|  AT5g58420/mqj2_10                                       205   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              205   5e-62   Elaeis guineensis
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              205   5e-62   Fragaria vesca subsp. vesca
ref|NP_200650.1|  40S ribosomal protein S4-3                            205   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 205   5e-62   Ricinus communis
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         205   6e-62   Brassica rapa
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             205   6e-62   Phaseolus vulgaris [French bean]
gb|EPS63485.1|  hypothetical protein M569_11297                         205   6e-62   Genlisea aurea
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              205   7e-62   Brassica rapa
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    204   7e-62   
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    204   7e-62   Arabis alpina [alpine rockcress]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             206   7e-62   
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              204   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             204   8e-62   Capsella rubella
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             204   8e-62   Populus trichocarpa [western balsam poplar]
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    204   8e-62   Arabis alpina [alpine rockcress]
dbj|BAB11167.1|  40S ribosomal protein S4                               204   8e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70008.1|  BnaA10g23570D                                          205   8e-62   
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         204   8e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565414.1|  40S ribosomal protein S4-1                            204   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568179.1|  40S ribosomal protein S4-2                            204   9e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              204   9e-62   Brassica rapa
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              204   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   204   1e-61   Citrus sinensis [apfelsine]
emb|CDY57385.1|  BnaCnng31910D                                          205   1e-61   Brassica napus [oilseed rape]
emb|CDX99006.1|  BnaC09g48290D                                          204   2e-61   
emb|CDY14056.1|  BnaC02g01730D                                          204   2e-61   Brassica napus [oilseed rape]
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         204   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY69841.1|  BnaAnng31720D                                          205   2e-61   Brassica napus [oilseed rape]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             203   2e-61   Capsella rubella
ref|XP_002864574.1|  40S ribosomal protein S4                           203   2e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    203   2e-61   
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         203   2e-61   Nelumbo nucifera [Indian lotus]
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   203   3e-61   Citrus sinensis [apfelsine]
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           203   3e-61   Citrus sinensis [apfelsine]
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    205   3e-61   
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         203   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY32986.1|  BnaA10g11920D                                          204   4e-61   Brassica napus [oilseed rape]
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           203   4e-61   Fragaria vesca subsp. vesca
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              203   4e-61   Brassica rapa
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           202   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    205   6e-61   
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         202   6e-61   Cicer arietinum [garbanzo]
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   7e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   7e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   8e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              202   8e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008374283.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     198   1e-60   
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           201   1e-60   Prunus armeniaca
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              201   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                201   1e-60   Prunus mume [ume]
ref|XP_010251772.1|  PREDICTED: 40S ribosomal protein S4-like           199   1e-60   Nelumbo nucifera [Indian lotus]
emb|CDY05015.1|  BnaAnng01970D                                          202   2e-60   
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             201   2e-60   Prunus persica
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         201   3e-60   Elaeis guineensis
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    202   4e-60   Phoenix dactylifera
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         200   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              200   6e-60   Fragaria vesca subsp. vesca
gb|EPS70681.1|  hypothetical protein M569_04077                         199   6e-60   Genlisea aurea
ref|XP_008374276.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     196   6e-60   
ref|XP_008343651.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    196   7e-60   
ref|XP_008801072.1|  PREDICTED: 40S ribosomal protein S4-like           196   1e-59   Phoenix dactylifera
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         199   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         199   2e-59   
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         198   2e-59   Jatropha curcas
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         197   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         197   7e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              196   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              196   2e-58   
dbj|BAJ94984.1|  predicted protein                                      195   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             194   8e-58   Prunus persica
gb|KDO63243.1|  hypothetical protein CISIN_1g023289mg                   192   8e-58   Citrus sinensis [apfelsine]
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                194   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         194   1e-57   Cicer arietinum [garbanzo]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           194   1e-57   Setaria italica
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                194   1e-57   Malus domestica [apple tree]
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   193   1e-57   Citrus sinensis [apfelsine]
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   194   2e-57   Citrus sinensis [apfelsine]
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   192   2e-57   Citrus sinensis [apfelsine]
ref|NP_001043015.1|  Os01g0358400                                       193   2e-57   
ref|NP_001045624.1|  Os02g0105900                                       193   3e-57   
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           193   3e-57   Oryza brachyantha
gb|ACV70143.1|  putative 40S ribosomal protein S4                       192   4e-57   Jatropha curcas
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         192   4e-57   Cicer arietinum [garbanzo]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             192   4e-57   Citrus clementina [clementine]
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          192   6e-57   Sorghum bicolor [broomcorn]
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          192   6e-57   Sorghum bicolor [broomcorn]
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          192   7e-57   Sorghum bicolor [broomcorn]
ref|NP_001266498.1|  40S ribosomal protein S4                           192   7e-57   Zea mays [maize]
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           192   8e-57   Oryza brachyantha
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           191   2e-56   
dbj|BAD22763.1|  ribosomal protein                                      190   3e-56   Bromus inermis [awnless brome grass]
gb|AAT38019.1|  putative 40S ribosomal protein S4                       189   3e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003623356.1|  40S ribosomal protein S4                           190   4e-56   Medicago truncatula
ref|NP_001055342.1|  Os05g0368300                                       189   8e-56   
ref|XP_003611879.1|  40S ribosomal protein S4                           189   1e-55   Medicago truncatula
gb|EAY97774.1|  hypothetical protein OsI_19685                          188   3e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           187   3e-55   Setaria italica
dbj|BAN18292.1|  40S ribosomal protein S4                               183   3e-55   Schiedea spergulina
dbj|BAN18309.1|  40S ribosomal protein S4                               183   4e-55   Schiedea helleri
ref|NP_001288485.1|  40S ribosomal protein S4-like                      187   5e-55   Zea mays [maize]
gb|AAS48726.1|  ribosomal protein S4                                    187   7e-55   Zea mays [maize]
dbj|BAN18311.1|  40S ribosomal protein S4                               182   9e-55   Schiedea jacobii
gb|EEE63465.1|  hypothetical protein OsJ_18278                          190   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          186   1e-54   
dbj|BAN18315.1|  40S ribosomal protein S4                               182   1e-54   Schiedea stellarioides
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             185   3e-54   Phaseolus vulgaris [French bean]
gb|ADW09573.1|  putative 40S ribosomal protein S4-like protein          179   1e-53   Schiedea stellarioides
gb|ADK97882.1|  40S ribosomal protein S4-like protein                   179   2e-53   Schiedea globosa
gb|ADK97878.1|  40S ribosomal protein S4-like protein                   178   3e-53   Schiedea globosa
gb|ADK97883.1|  40S ribosomal protein S4-like protein                   178   4e-53   Schiedea globosa
gb|ADW09574.1|  putative 40S ribosomal protein S4-like protein          178   4e-53   Schiedea stellarioides
gb|ABK21170.1|  unknown                                                 182   4e-53   Picea sitchensis
gb|ABK22322.1|  unknown                                                 182   6e-53   Picea sitchensis
gb|AGZ15374.1|  40S ribosomal S4 protein                                177   4e-51   Phaseolus vulgaris [French bean]
ref|XP_001759850.1|  predicted protein                                  176   6e-51   
gb|EMT14698.1|  40S ribosomal protein S4                                176   9e-51   
emb|CDX91445.1|  BnaC04g07050D                                          172   1e-50   
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             175   2e-50   Selaginella moellendorffii
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             175   2e-50   Selaginella moellendorffii
ref|XP_001751877.1|  predicted protein                                  174   4e-50   
ref|XP_001759591.1|  predicted protein                                  174   4e-50   
ref|XP_001780588.1|  predicted protein                                  174   5e-50   
ref|XP_007157713.1|  hypothetical protein PHAVU_002G092000g             168   5e-49   Phaseolus vulgaris [French bean]
ref|XP_001785339.1|  predicted protein                                  171   7e-49   
ref|XP_010921843.1|  PREDICTED: 40S ribosomal protein S4-3-like         169   1e-48   Elaeis guineensis
ref|XP_001766039.1|  predicted protein                                  171   2e-48   
emb|CAF89133.1|  unnamed protein product                                167   3e-48   Tetraodon nigroviridis
emb|CAF89132.1|  unnamed protein product                                167   3e-48   Tetraodon nigroviridis
ref|XP_006806979.1|  PREDICTED: 40S ribosomal protein S4-like           166   4e-47   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005750964.1|  PREDICTED: 40S ribosomal protein S4-like           166   6e-47   Pundamilia nyererei
ref|XP_003457778.1|  PREDICTED: 40S ribosomal protein S4-like           166   7e-47   Oreochromis niloticus
ref|XP_008318659.1|  PREDICTED: 40S ribosomal protein S4, X isoform     165   1e-46   
gb|ABD98758.1|  putative ribosomal protein S4e                          165   2e-46   Graphocephala atropunctata
gb|ACM41869.1|  40S ribosomal protein S4                                162   2e-46   Epinephelus coioides [estuary cod]
ref|XP_003966899.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    165   2e-46   Takifugu rubripes [tiger puffer]
ref|XP_004573481.1|  PREDICTED: 40S ribosomal protein S4-like           166   3e-46   
ref|XP_010010561.1|  PREDICTED: 40S ribosomal protein S4                164   3e-46   Nestor notabilis
gb|AIC59238.1|  RPS4X                                                   162   3e-46   synthetic construct
ref|XP_009330287.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   4e-46   Pygoscelis adeliae
ref|XP_009705067.1|  PREDICTED: 40S ribosomal protein S4                163   4e-46   Cariama cristata
ref|XP_010306572.1|  PREDICTED: 40S ribosomal protein S4                163   4e-46   Balearica regulorum gibbericeps
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           164   5e-46   Monodelphis domestica
ref|XP_010747631.1|  PREDICTED: 40S ribosomal protein S4, X isoform     164   5e-46   Larimichthys crocea [croceine croaker]
ref|XP_008945582.1|  PREDICTED: 40S ribosomal protein S4                164   5e-46   Merops nubicus
gb|EMP39148.1|  40S ribosomal protein S4                                163   5e-46   Chelonia mydas [green seaturtle]
ref|XP_009480425.1|  PREDICTED: 40S ribosomal protein S4                163   5e-46   Pelecanus crispus
ref|XP_010202370.1|  PREDICTED: 40S ribosomal protein S4                163   5e-46   Colius striatus
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform     164   6e-46   
ref|XP_009644675.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   6e-46   Egretta garzetta
ref|XP_010140642.1|  PREDICTED: 40S ribosomal protein S4                163   6e-46   Buceros rhinoceros silvestris
ref|XP_008919034.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   6e-46   
ref|XP_009923536.1|  PREDICTED: 40S ribosomal protein S4                163   6e-46   Haliaeetus albicilla
ref|XP_009557978.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   6e-46   Cuculus canorus
ref|XP_009881746.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   6e-46   Charadrius vociferus
ref|XP_009074657.1|  PREDICTED: 40S ribosomal protein S4                163   7e-46   Acanthisitta chloris
ref|XP_005428838.1|  PREDICTED: 40S ribosomal protein S4-like           163   7e-46   
gb|EOA93329.1|  40S ribosomal protein S4                                162   7e-46   
ref|XP_008639287.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   7e-46   
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    163   8e-46   
ref|XP_010001756.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   8e-46   
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    163   8e-46   
ref|XP_008300595.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     162   8e-46   
gb|EDL12419.1|  mCG124430                                               163   8e-46   
ref|XP_010216162.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   9e-46   
gb|ELK15681.1|  40S ribosomal protein S4                                162   9e-46   
gb|ERE63485.1|  40S ribosomal protein S4                                162   1e-45   
ref|XP_007955750.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    162   1e-45   
ref|XP_009682020.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   1e-45   
gb|EDL27273.1|  mCG127176                                               162   1e-45   
dbj|BAF45892.1|  ribosomal protein S4                                   163   1e-45   
ref|XP_007433627.1|  PREDICTED: 40S ribosomal protein S4-like           162   1e-45   
ref|XP_005313893.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     163   1e-45   
ref|XP_006873465.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   1e-45   
ref|XP_007185527.1|  PREDICTED: 40S ribosomal protein S4-like           162   1e-45   
ref|XP_009866762.1|  PREDICTED: 40S ribosomal protein S4                162   1e-45   
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           163   1e-45   
ref|XP_006193300.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   1e-45   
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     163   1e-45   
gb|AAA36597.1|  scar protein                                            162   1e-45   
ref|XP_010078274.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   1e-45   
gb|AAH07308.2|  RPS4X protein                                           162   1e-45   
gb|EMS68941.1|  40S ribosomal protein S4                                163   1e-45   
ref|XP_008498268.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   1e-45   
ref|XP_009463285.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   1e-45   
ref|XP_009902618.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   1e-45   
gb|EPY74423.1|  40S ribosomal protein S4                                162   1e-45   
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   2e-45   
ref|XP_009282877.1|  PREDICTED: 40S ribosomal protein S4, X isoform     163   2e-45   
emb|CAF90008.1|  unnamed protein product                                162   2e-45   
ref|NP_001232240.1|  putative ribosomal protein S4                      162   2e-45   
ref|XP_004758473.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    162   2e-45   
ref|XP_008300594.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     162   2e-45   
ref|XP_006767373.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   2e-45   
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|XP_004396498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|XP_010330703.1|  PREDICTED: 40S ribosomal protein S4, X isoform     161   2e-45   
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           162   2e-45   
dbj|BAB29207.1|  unnamed protein product                                162   2e-45   
dbj|BAE22507.1|  unnamed protein product                                162   2e-45   
ref|NP_001233602.1|  40S ribosomal protein S4                           162   2e-45   
ref|XP_006865002.1|  PREDICTED: 40S ribosomal protein S4-like           162   2e-45   
ref|XP_005435883.1|  PREDICTED: 40S ribosomal protein S4-like           163   2e-45   
ref|NP_988912.1|  40S ribosomal protein S4                              162   2e-45   
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   2e-45   
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   2e-45   
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         162   2e-45   
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   2e-45   
ref|NP_001075891.1|  40S ribosomal protein S4                           162   2e-45   
ref|NP_990439.1|  40S ribosomal protein S4                              162   3e-45   
gb|EFB14527.1|  hypothetical protein PANDA_015068                       162   3e-45   
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like           162   3e-45   
ref|XP_002708125.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|NP_001090472.1|  40S ribosomal protein S4                           162   3e-45   
ref|XP_006025231.1|  PREDICTED: 40S ribosomal protein S4-like           163   3e-45   
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4                162   3e-45   
ref|XP_004394286.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
gb|ETE69702.1|  40S ribosomal protein S4                                162   3e-45   
gb|AAB01670.1|  ribosomal protein S4                                    162   3e-45   
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   3e-45   
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       162   3e-45   
ref|NP_001084941.1|  40S ribosomal protein S4                           162   3e-45   
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           162   3e-45   
ref|XP_010372927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|XP_006885447.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   3e-45   
gb|KDR20779.1|  40S ribosomal protein S4                                162   3e-45   
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    162   3e-45   
gb|ELW69939.1|  40S ribosomal protein S4                                161   3e-45   
gb|KFO21995.1|  40S ribosomal protein S4                                161   3e-45   
ref|XP_008054194.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
gb|AER42698.1|  40S ribosomal protein S4                                162   3e-45   
ref|XP_009930575.1|  PREDICTED: 40S ribosomal protein S4, X isoform     161   3e-45   
ref|XP_005974427.1|  PREDICTED: 40S ribosomal protein S4-like           162   3e-45   
ref|XP_010798474.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    162   3e-45   
ref|XP_010078273.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   4e-45   
ref|XP_005030976.1|  PREDICTED: 40S ribosomal protein S4-like           162   4e-45   
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    161   4e-45   
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   4e-45   
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   4e-45   
ref|XP_002749534.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   4e-45   
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    162   4e-45   
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           161   4e-45   
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like           161   4e-45   
ref|XP_003764080.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    161   4e-45   
ref|XP_007173623.1|  PREDICTED: 40S ribosomal protein S4-like           158   5e-45   
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     161   5e-45   
gb|EGW14036.1|  40S ribosomal protein S4                                163   5e-45   
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           161   5e-45   
ref|XP_005228099.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    161   5e-45   
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    161   5e-45   
ref|XP_005199960.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   5e-45   
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4                161   6e-45   
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like           161   6e-45   
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    161   6e-45   
ref|XP_010149384.1|  PREDICTED: 40S ribosomal protein S4                159   7e-45   
ref|XP_004715961.1|  PREDICTED: 40S ribosomal protein S4, X isoform     162   8e-45   
ref|XP_006877763.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   8e-45   
ref|XP_003941964.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   8e-45   
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   8e-45   
gb|AFM86071.1|  40S ribosomal protein S4                                160   9e-45   
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     160   9e-45   
ref|XP_010189447.1|  PREDICTED: 40S ribosomal protein S4                160   9e-45   
gb|AFM89946.1|  40S ribosomal protein S4                                160   9e-45   
gb|AFM87393.1|  40S ribosomal protein S4                                160   9e-45   
gb|AFM90857.1|  40S ribosomal protein S4                                160   9e-45   
gb|ADG29131.1|  40S ribosomal protein S4                                160   9e-45   
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     160   9e-45   
gb|AFM86794.1|  40S ribosomal protein S4                                160   1e-44   
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   1e-44   
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   1e-44   
gb|AFM89018.1|  40S ribosomal protein S4                                160   1e-44   
tpg|DAA26280.1|  TPA: ribosomal protein S4, X-linked X-like             160   1e-44   
gb|AFM86034.1|  40S ribosomal protein S4                                160   1e-44   
gb|AFM85695.1|  40S ribosomal protein S4                                160   1e-44   
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   1e-44   
gb|AFM88708.1|  40S ribosomal protein S4                                160   1e-44   
gb|AFM87833.1|  40S ribosomal protein S4                                160   1e-44   
gb|AFM86700.1|  40S ribosomal protein S4                                160   1e-44   
gb|ABQ18253.1|  ribosomal protein S4e                                   160   1e-44   
ref|XP_002094667.1|  RpS4                                               160   1e-44   
ref|XP_001972620.1|  GG15623                                            160   1e-44   
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                160   1e-44   
ref|XP_001094914.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   1e-44   
ref|XP_004685634.1|  PREDICTED: 40S ribosomal protein S4, X isoform     159   1e-44   
ref|XP_006632866.1|  PREDICTED: 40S ribosomal protein S4-like           160   1e-44   
tpg|DAA27762.1|  TPA: ribosomal protein S4, X-linked X-like             160   2e-44   
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           160   2e-44   
ref|XP_006275921.1|  PREDICTED: 40S ribosomal protein S4-like           163   2e-44   
prf||1617101C  ribosomal protein S4                                     160   2e-44
ref|XP_010854947.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    160   2e-44   
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           160   2e-44   
gb|ELK27547.1|  40S ribosomal protein S4                                160   2e-44   
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like           160   2e-44   
ref|XP_008999395.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   2e-44   
ref|NP_001028160.1|  40S ribosomal protein S4, Y isoform 1              160   2e-44   
gb|AFM90740.1|  40S ribosomal protein S4                                159   2e-44   
gb|AFM89445.1|  40S ribosomal protein S4                                159   2e-44   
ref|XP_009439348.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    162   2e-44   
gb|EKC32468.1|  40S ribosomal protein S4, X isoform                     159   2e-44   
gb|AFM87450.1|  40S ribosomal protein S4                                159   2e-44   
gb|EHB08523.1|  40S ribosomal protein S4                                159   2e-44   
gb|EHH60989.1|  Single copy abundant mRNA protein                       159   2e-44   
ref|XP_003775056.1|  PREDICTED: 40S ribosomal protein S4, X isoform     160   2e-44   
ref|XP_010843737.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   2e-44   
ref|NP_001028159.1|  40S ribosomal protein S4, X isoform                159   2e-44   
ref|NP_001187069.1|  40S ribosomal protein S4                           159   3e-44   
ref|XP_005964326.1|  PREDICTED: 40S ribosomal protein S4-like iso...    159   3e-44   
ref|XP_006899825.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   3e-44   
ref|XP_001353585.1|  GA10883                                            159   3e-44   
gb|EAW71815.1|  ribosomal protein S4, X-linked, isoform CRA_a           162   3e-44   
ref|XP_005561444.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   3e-44   
ref|XP_010360955.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   3e-44   
ref|XP_006926381.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   3e-44   
ref|XP_001985577.1|  GH17143                                            159   3e-44   
dbj|BAA03786.1|  ribosomal protein S4                                   159   3e-44   
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                159   3e-44   
ref|NP_729871.1|  ribosomal protein S4, isoform A                       159   3e-44   
gb|AFM90173.1|  40S ribosomal protein S4                                159   3e-44   
tpe|CAL69092.1|  TPA: putative 40S ribosomal protein S4                 159   3e-44   
gb|AFM90836.1|  40S ribosomal protein S4                                159   3e-44   
ref|XP_003204899.1|  PREDICTED: 40S ribosomal protein S4-like           159   3e-44   
tpg|DAA12960.1|  TPA: ribosomal protein S4, X-linked-like               158   3e-44   
ref|XP_011503007.1|  PREDICTED: 40S ribosomal protein S4                158   3e-44   
ref|XP_002432788.1|  40S ribosomal protein S4, putative                 158   4e-44   
ref|XP_005900947.1|  PREDICTED: 40S ribosomal protein S4-like           159   4e-44   
ref|XP_011433431.1|  PREDICTED: 40S ribosomal protein S4-like           159   4e-44   
ref|XP_002062215.1|  GK17425                                            159   4e-44   
ref|XP_009233255.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    159   4e-44   
ref|XP_003761435.1|  PREDICTED: 40S ribosomal protein S4-like           159   4e-44   
gb|AFM88094.1|  40S ribosomal protein S4                                159   4e-44   
ref|XP_005889381.1|  PREDICTED: 40S ribosomal protein S4-like           159   4e-44   
ref|XP_009251197.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    159   4e-44   
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     159   5e-44   
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           159   5e-44   
ref|XP_004581137.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   5e-44   
ref|XP_001957453.1|  GF24027                                            159   5e-44   
ref|XP_005894604.1|  PREDICTED: 40S ribosomal protein S4-like           159   5e-44   
ref|XP_005806467.1|  PREDICTED: 40S ribosomal protein S4-like           159   5e-44   
ref|XP_002008552.1|  GI11752                                            159   5e-44   
ref|XP_002714210.1|  PREDICTED: 40S ribosomal protein S4-like           159   5e-44   
ref|XP_003785255.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   5e-44   
ref|XP_005512238.1|  PREDICTED: uncharacterized protein LOC102091224    163   5e-44   
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   5e-44   
ref|XP_005965959.1|  PREDICTED: 40S ribosomal protein S4-like           158   6e-44   
ref|XP_006998856.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    155   6e-44   
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                    158   6e-44   
gb|AFM90738.1|  40S ribosomal protein S4                                158   7e-44   
ref|XP_006088738.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   7e-44   
ref|XP_003740274.1|  PREDICTED: 40S ribosomal protein S4-like           158   7e-44   
ref|XP_002047468.1|  GJ13462                                            158   7e-44   
ref|XP_010840576.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   7e-44   
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                    158   8e-44   
gb|AFM90735.1|  40S ribosomal protein S4                                158   8e-44   
ref|XP_004643498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    158   8e-44   
ref|XP_004660965.1|  PREDICTED: 40S ribosomal protein S4, X isoform     157   8e-44   
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    156   9e-44   
ref|XP_010831486.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    158   1e-43   
gb|ELR46663.1|  hypothetical protein M91_05049                          157   1e-43   
ref|XP_007962468.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    159   1e-43   
ref|XP_005909061.1|  PREDICTED: 40S ribosomal protein S4-like           158   1e-43   
ref|XP_001498885.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   1e-43   
ref|XP_004668818.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    155   1e-43   
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   157   1e-43   
gb|ACU21243.1|  unknown                                                 153   1e-43   
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   1e-43   
ref|XP_004264287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   1e-43   
gb|ELR61037.1|  hypothetical protein M91_01196                          157   2e-43   
ref|XP_010792965.1|  PREDICTED: 40S ribosomal protein S4                157   2e-43   
ref|XP_010842313.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   2e-43   
ref|XP_006172301.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    156   2e-43   
gb|KIY68866.1|  ribosomal protein S4e                                   157   3e-43   
ref|XP_005360594.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    157   3e-43   



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  252  ARKRLAAQSATTA  264



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  252  ARKRLAAQSATTA  264



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAAQSAT 
Sbjct  252  ARKRLAAQSATA  263



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GSKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  252  ARKRLAAQSATTA  264



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAAQSAT 
Sbjct  252  ARKRLAAQSATA  263



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GTKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  252  ARKRLAAQSATTA  264



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDAQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  252  ARKRLAAQSATTA  264



>ref|XP_004148191.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=216

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  84   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  143

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  144  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  203

Query  234  AKKRLAAQSATTA  196
            A+KRLA+QSA TA
Sbjct  204  ARKRLASQSAVTA  216



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSAT A
Sbjct  252  ARKRLAAQSATAA  264



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSAT A
Sbjct  252  ARKRLAAQSATAA  264



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   217 bits (553),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  127  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  186

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSI EE
Sbjct  187  VGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSINEE  246

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSATTA
Sbjct  247  ARKRLAAQSATTA  259



>gb|KJB38001.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=191

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  61   GRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNVVMVTGGRNRGR  120

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  121  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  180

Query  234  AKKRLAAQSA  205
            A+KRLAAQSA
Sbjct  181  ARKRLAAQSA  190



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+QSA TA
Sbjct  252  ARKRLASQSAVTA  264



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTVGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+A TA
Sbjct  252  ARKRLASQAAVTA  264



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ ATTA
Sbjct  252  ARKRIAAQQATTA  264



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ ATTA
Sbjct  252  ARKRIAAQQATTA  264



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+A TA
Sbjct  252  ARKRLASQAAVTA  264



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVS+PKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSVPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+A TA
Sbjct  252  ARKRLASQAAVTA  264



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   215 bits (547),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            AKKRLAAQSAT A
Sbjct  252  AKKRLAAQSATPA  264



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+HIQDATGHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSATTA  196
            AKKRLAAQ+A++A
Sbjct  234  AKKRLAAQAASSA  246



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  186  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  245

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  246  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWLSLPKGKGIKLSIIEE  305

Query  234  AKKRLAAQSATTA  196
            AKKRLAAQ+A+TA
Sbjct  306  AKKRLAAQAASTA  318



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQSATTA
Sbjct  252  ARKRMAAQSATTA  264



>gb|KHN10552.1| 40S ribosomal protein S4 [Glycine soja]
Length=199

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  67   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  126

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  127  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  186

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ+ T A
Sbjct  187  ARKRLAAQNETVA  199



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQSATTA
Sbjct  252  ARKRMAAQSATTA  264



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+A TA
Sbjct  252  ARKRLASQAAVTA  264



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+  TA
Sbjct  252  ARKRLASQATVTA  264



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSAT A
Sbjct  252  ARKRLAAQSATPA  264



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPWV+LPKGKGIKLSIIEE
Sbjct  192  VGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWVTLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            AKKRLAAQ++ TA
Sbjct  252  AKKRLAAQASATA  264



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+HIQDATGHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            AKKRLAAQ+A++A
Sbjct  252  AKKRLAAQAASSA  264



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE N +VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENNIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ ATTA
Sbjct  252  ARKRIAAQQATTA  264



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  107  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  166

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  167  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  226

Query  234  AKKRLAAQSA  205
            A+KRLAAQ+A
Sbjct  227  ARKRLAAQNA  236



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSAT  202
            A+KRLAAQSA 
Sbjct  234  ARKRLAAQSAA  244



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  234  ARKRLAAQNAA  244



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  252  ARKRIAAQQATAA  264



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  252  ARKRIAAQQATAA  264



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  121  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  180

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  181  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  240

Query  234  AKKRLAAQSA  205
            A+KRLAAQ+A
Sbjct  241  ARKRLAAQNA  250



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQAAA  262



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  252  ARKRIAAQQATAA  264



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIE+
Sbjct  192  VGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIED  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQSAT A
Sbjct  252  ARKRLAAQSATPA  264



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQSAT A
Sbjct  252  ARKRMAAQSATAA  264



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQAAA  262



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  116  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  175

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  176  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  235

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ  T A
Sbjct  236  ARKRLAAQKETVA  248



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQSA 
Sbjct  252  ARKRLAAQSAA  262



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRL NVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            AKKR AAQ A+TA
Sbjct  252  AKKRQAAQQASTA  264



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+A QSATTA
Sbjct  252  ARKRMATQSATTA  264



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+K+LAAQSAT A
Sbjct  252  ARKKLAAQSATPA  264



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+A QSATTA
Sbjct  252  ARKRMATQSATTA  264



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   212 bits (540),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ  T A
Sbjct  234  ARKRLAAQKETVA  246



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKH GSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHTGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLA+Q+  TA
Sbjct  252  ARKRLASQATVTA  264



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQNAA  262



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLS+IEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSVIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQNAV  262



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QD+TGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  252  ARKRIAAQQATAA  264



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QD+TGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  252  ARKRIAAQQATAA  264



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  138  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  197

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  198  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  257

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  258  ARKRLAAQNAA  268



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVF IGKG KPWVSLPKGKGIKLS+IEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFIIGKGAKPWVSLPKGKGIKLSVIEE  233

Query  234  AKKRLAAQSATTA  196
             +KR+AAQ+ATTA
Sbjct  234  QRKRIAAQAATTA  246



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ+ T A
Sbjct  252  ARKRLAAQNETVA  264



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  164  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  223

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRL NVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  224  VGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTIGKGTKPWVSLPKGKGIKLTIIEE  283

Query  234  AKKRLAAQSATTA  196
            AKKR AAQ A+TA
Sbjct  284  AKKRQAAQQASTA  296



>gb|KCW49428.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=187

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+IKANDTVKLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  55   GQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFIKFDVGNVVMVTGGRNRGR  114

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+HIQDA GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  115  VGVIKNREKHKGTFETIHIQDAQGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  174

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ++ TA
Sbjct  175  ARKRLAAQASATA  187



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  AT 
Sbjct  252  ARKRLAASQATA  263



>gb|KJB17111.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=191

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  61   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  120

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEE
Sbjct  121  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEE  180

Query  234  AKKRLAAQSA  205
            A+KRLAAQ+A
Sbjct  181  ARKRLAAQNA  190



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  164  GQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  223

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  224  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEE  283

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ AT A
Sbjct  284  ARKRIAAQQATAA  296



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GLKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQAAA  262



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKIADFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFETVHIQD+ GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETVHIQDSLGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR  AQSATTA
Sbjct  252  ARKRNVAQSATTA  264



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  133  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  192

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  193  VGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  252

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  253  ARKRLASQQAA  263



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ  T A
Sbjct  252  ARKRLAAQKETVA  264



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            AKKRLAA  A  
Sbjct  252  AKKRLAASQAAA  263



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            AKKRLAA  A  
Sbjct  252  AKKRLAASQAAA  263



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ A 
Sbjct  252  ARKRLAAQQAA  262



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVNFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQNAA  262



>gb|KCW60005.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=197

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  65   GQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  124

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QD+ GHEFATRLGNV+ IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  125  VGVIKNREKHKGTFETIHVQDSQGHEFATRLGNVYMIGKGTKPWVSLPKGKGIKLSIIEE  184

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ++ TA
Sbjct  185  ARKRLAAQASATA  197



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREK KGSFET+H+QDATGHEFATRLGNVF IGKGTKPWV+LPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTKPWVTLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ+A++A
Sbjct  234  AQKRLAAQAASSA  246



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  107  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  166

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEE
Sbjct  167  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEE  226

Query  234  AKKRLAAQSA  205
            A+KRLAAQ+A
Sbjct  227  ARKRLAAQNA  236



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  AT 
Sbjct  252  ARKRLAASQATA  263



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQS  208
            A+KRLAAQ+
Sbjct  234  ARKRLAAQA  242



>ref|XP_008809054.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=200

 Score =   208 bits (529),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  67   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  126

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRL NVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  127  VGVIKNREKHKGSFETIHLQDATGHEFATRLANVFTIGKGTKPWVSLPKGKGIKLSIIEE  186

Query  234  AKKRLAAQSA  205
            A+KRLAA  A
Sbjct  187  ARKRLAASGA  196



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL AQ A 
Sbjct  252  ARKRLVAQQAA  262



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREK KGSFET+H+QDATGHEFATRLGNVF IGKGTKPWV+LPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTKPWVTLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ+A++A
Sbjct  252  AQKRLAAQAASSA  264



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            AKKRLAA  A  
Sbjct  252  AKKRLAASQAAA  263



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   209 bits (533),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQS  208
            A+KRLAAQ+
Sbjct  252  ARKRLAAQA  260



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ+A 
Sbjct  252  ARKRLAAQNAA  262



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+IKANDTVKLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+HIQDA GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHIQDAQGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ++ TA
Sbjct  252  ARKRLAAQASATA  264



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  A  
Sbjct  252  ARKRLAAAQAVA  263



>gb|ACJ84252.1| unknown [Medicago truncatula]
Length=196

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  64   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFIKFDVGNVVMVTGGRNRGR  123

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDA+GHEFATRLGN FTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  124  VGVIKNREKHKGTFETIHVQDASGHEFATRLGNAFTIGKGTKPWVSLPKGKGIKLTVIEE  183

Query  234  AKKRLAAQSATTA  196
            A+KR AAQ+ T A
Sbjct  184  ARKRQAAQNVTAA  196



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  A  
Sbjct  252  ARKRLAASQAAA  263



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTK WV LPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKLWVLLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSAT  202
            A+KRLAAQSA 
Sbjct  234  ARKRLAAQSAA  244



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            AKKR A Q+  TA
Sbjct  252  AKKRAAGQATATA  264



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             +G+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVVMVTGGRNR
Sbjct  147  QLGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVVMVTGGRNR  206

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  207  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  266

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  267  EEARKRLSAQQA  278



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QD+ GHEFATRLGNV+ IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDSQGHEFATRLGNVYMIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ++ TA
Sbjct  252  ARKRLAAQASATA  264



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTK WVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTKAWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSA  205
            A+KRLAA  A
Sbjct  234  ARKRLAASGA  243



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP+INTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GKKGIPYINTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+TG+EFATRL NV+TIGKGTKPWVSLPKGKGIK +IIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSTGNEFATRLSNVYTIGKGTKPWVSLPKGKGIKFTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQSAT
Sbjct  252  ARKRLAAQSAT  262



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             +G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVVMVTGGRNR
Sbjct  130  QLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVVMVTGGRNR  189

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  190  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  249

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  250  EEARKRLSAQQA  261



>ref|XP_007156131.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28125.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=199

 Score =   205 bits (522),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  67   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  126

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+R+K+KGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  127  VGVIKSRDKNKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  186

Query  234  AKKRLAAQSATTA  196
            A+KR++AQ +T A
Sbjct  187  ARKRISAQQSTAA  199



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             +G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVVMVTGGRNR
Sbjct  147  QLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVVMVTGGRNR  206

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  207  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  266

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  267  EEARKRLSAQQA  278



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   207 bits (527),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFETVHIQD+TGHEFATRLGNV+TIGKG+KPWVSLPKGKGIKL+IIEE
Sbjct  192  VGILKNREKHKGSFETVHIQDSTGHEFATRLGNVYTIGKGSKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KR+ +QSAT
Sbjct  252  ARKRITSQSAT  262



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDA+GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDASGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AAQ+ T A
Sbjct  252  ARKRQAAQNVTAA  264



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKF VGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFGVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            AK+RLAA  A  
Sbjct  252  AKERLAASQAAA  263



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ A 
Sbjct  252  ARKRLAAQQAA  262



>dbj|BAH57121.1| AT5G07090 [Arabidopsis thaliana]
Length=197

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  67   GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  126

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  127  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  186

Query  234  AKKRLAAQSA  205
            A+KRLA+Q A
Sbjct  187  ARKRLASQQA  196



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSA  205
            A+KRL+AQ A
Sbjct  252  ARKRLSAQQA  261



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
            S G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGRNR
Sbjct  172  SFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGRNR  231

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  232  GRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  291

Query  240  EEAKKRLAAQ  211
            EEA+KRLAAQ
Sbjct  292  EEARKRLAAQ  301



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  174  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  233

Query  234  AKKRLAAQSA  205
            A+KRL+AQ A
Sbjct  234  ARKRLSAQQA  243



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NTYDGRTIRYPDPLIK NDTVKLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPFLNTYDGRTIRYPDPLIKPNDTVKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWMSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  A  
Sbjct  252  ARKRLAASGAAA  263



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  174  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  233

Query  234  AKKRLAAQSA  205
            A+KRLA+Q A
Sbjct  234  ARKRLASQQA  243



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+K IP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK REKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKKREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQS  208
            A+KRLAAQ+
Sbjct  252  ARKRLAAQA  260



>ref|XP_009345329.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=171

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G++GIP+INTYDGRTIRYP+PLIKANDT+KLDL +NK+ +FIKFDVGNVVMVTGGRNRG 
Sbjct  39   GQRGIPYINTYDGRTIRYPNPLIKANDTIKLDLGTNKITNFIKFDVGNVVMVTGGRNRGH  98

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  99   VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  158

Query  234  AKKRLAAQSATTA  196
            AKKR AA  A TA
Sbjct  159  AKKRQAALQAATA  171



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 1/132 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLA-AQSAT  202
            A+KRLA AQ+  
Sbjct  252  ARKRLATAQTVA  263



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  182  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  241

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  242  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  301

Query  234  AKKRLAAQSAT  202
            A+KRLAAQ A 
Sbjct  302  ARKRLAAQQAA  312



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
            S G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGRNR
Sbjct  146  SFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGRNR  205

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  206  GRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  265

Query  240  EEAKKRLAAQ  211
            EEA+KRLAAQ
Sbjct  266  EEARKRLAAQ  275



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNR
Sbjct  153  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNR  212

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  213  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  272

Query  240  EEAKKRLAAQSA  205
            EEAKKRLA Q A
Sbjct  273  EEAKKRLAGQQA  284



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAA S T A
Sbjct  252  ARKRLAA-SQTAA  263



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKG+FET+H+QD+ GHEFATRLGNVF IGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGIIKNREKHKGTFETIHVQDSLGHEFATRLGNVFIIGKGSKPWLSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAAQ++ TA
Sbjct  252  ARKRLAAQASATA  264



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA S T A
Sbjct  252  ARKRQAA-SQTAA  263



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA S T A
Sbjct  252  ARKRQAA-SQTAA  263



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  174  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  233

Query  234  AKKRLAAQSA  205
            A+KRLA+Q A
Sbjct  234  ARKRLASQQA  243



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>gb|KDO67007.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
 gb|KDO67008.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=200

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  67   GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGR  126

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  127  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  186

Query  234  AKKRLAAQSATTA  196
            A+KR A  ++  A
Sbjct  187  ARKRQALATSAAA  199



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KRLAA  A  
Sbjct  252  ARKRLAASGAAA  263



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NKV+DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA    TA
Sbjct  252  ARKRQAALQTATA  264



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KRLAA S T A
Sbjct  252  ARKRLAA-SQTAA  263



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNR
Sbjct  130  QVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNR  189

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  190  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  249

Query  240  EEAKKRLAAQSA  205
            EEAKKRLA Q A
Sbjct  250  EEAKKRLAGQQA  261



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+R+K+KGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKSRDKNKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR++AQ +T A
Sbjct  252  ARKRISAQQSTAA  264



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV+MVTGGRNRGR
Sbjct  131  GKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIADFIKFDVGNVIMVTGGRNRGR  190

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKG+FET+H+QDATGHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  191  VGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  250

Query  234  AKKRLAAQSATT  199
            A+KR+AA SA+ 
Sbjct  251  ARKRIAAPSASA  262



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  130  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  189

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  190  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  249

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  250  EEARKRLSAQQA  261



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA Q A 
Sbjct  252  ARKRLAGQQAA  262



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  158  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  217

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  218  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  277

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  278  ARKRLSAQQAA  288



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA Q A 
Sbjct  252  ARKRLAGQQAA  262



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VD+IKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDYIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQS  208
            AKKRLAA  
Sbjct  252  AKKRLAASQ  260



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ A 
Sbjct  252  ARKRLSAQQAA  262



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  133  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  192

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  193  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  252

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  253  ARKRLASQQAA  263



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  137  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  196

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  197  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  256

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  257  EEARKRLSAQQA  268



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSA  205
            A+KRL+AQ A
Sbjct  252  ARKRLSAQQA  261



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSA  205
            A+KRL+AQ A
Sbjct  252  ARKRLSAQQA  261



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  114  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  174  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSATTA  196
            A+KR A  ++  A
Sbjct  234  ARKRQALATSAAA  246



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  166  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  225

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  226  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  285

Query  240  EEAKKRLAAQSA  205
            EEA+KRLA Q A
Sbjct  286  EEARKRLAGQQA  297



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  156  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  215

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  216  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  275

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+AQ A
Sbjct  276  EEARKRLSAQQA  287



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  161  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  220

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  221  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  280

Query  234  AKKRLAAQSA  205
            A+KRL+AQ A
Sbjct  281  ARKRLSAQQA  290



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGK TKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKATKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNR
Sbjct  179  QVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNR  238

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  239  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  298

Query  240  EEAKKRLAAQSA  205
            EEAKKRLA Q A
Sbjct  299  EEAKKRLAGQQA  310



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL+AQ + 
Sbjct  252  ARKRLSAQQSA  262



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA Q   
Sbjct  252  ARKRLAGQQVA  262



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTVGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLAA +  
Sbjct  252  ARKRLAASACC  262



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLI+ANDT+K+DLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GDKGIPYLNTYDGRTIRYPDPLIRANDTIKIDLEANKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGIIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AA +A+TA
Sbjct  252  ARKRIAAAAASTA  264



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  139  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGR  198

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  199  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  258

Query  234  AKKRLAAQSATTA  196
            A+KR A  ++  A
Sbjct  259  ARKRQALATSAAA  271



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR A  ++  A
Sbjct  252  ARKRQALATSAAA  264



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
            S G+KGIP++NTYDGR IRYPDPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGRNR
Sbjct  190  SFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGRNR  249

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  250  GRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  309

Query  240  EEAKKRLAAQ  211
            EEA+KRLAAQ
Sbjct  310  EEARKRLAAQ  319



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSF+T+H+QDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFDTIHVQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  156  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  215

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  216  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  275

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+ Q A
Sbjct  276  EEARKRLSGQQA  287



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H+QD+TGHEFATRLGNVFTIGKGTKPWVSLPKG+GIKLSIIEE
Sbjct  192  VGVIKSREKHKGSFETIHVQDSTGHEFATRLGNVFTIGKGTKPWVSLPKGRGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA  A+ A
Sbjct  252  ARKRQAALQASAA  264



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
             VG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNVVMVTGGRNR
Sbjct  130  QVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNVVMVTGGRNR  189

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  190  GRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  249

Query  240  EEAKKRLAAQSA  205
            EEA+KRL+ Q A
Sbjct  250  EEARKRLSGQQA  261



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+ K+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAKKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRLA+Q A 
Sbjct  252  ARKRLASQQAA  262



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGN+VMVTGGRN GR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNIVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
            S G+KGIP++NTYDGR IRYPDPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGRNR
Sbjct  219  SFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGRNR  278

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+II
Sbjct  279  GRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTII  338

Query  240  EEAKKRLAAQ  211
            EEA+KRLAAQ
Sbjct  339  EEARKRLAAQ  348



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FETVH+QDATG+EFATRL NVFTIGKGTKPWVSLPKG+GIKL++IEE
Sbjct  192  VGVIKNREKHKGTFETVHVQDATGNEFATRLSNVFTIGKGTKPWVSLPKGRGIKLTVIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR+AAQ    A
Sbjct  252  ARKRIAAQQVAAA  264



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL  Q A 
Sbjct  252  ARKRLGDQQAV  262



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP+INTYDGRTIRYPDPLI+ANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GDKGIPYINTYDGRTIRYPDPLIRANDTIKLDLETNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KR+
Sbjct  252  ARKRI  256



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSAT  202
            A+KRL  Q A 
Sbjct  252  ARKRLGDQQAA  262



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE+NK++DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GDKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLETNKIIDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KR+
Sbjct  252  ARKRI  256



>ref|XP_008374283.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374289.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374295.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
Length=159

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+N + DFIKFDVGNVVMVT GRNRGR
Sbjct  27   GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNNITDFIKFDVGNVVMVTSGRNRGR  86

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG KPWVSLPKG GIKL+IIEE
Sbjct  87   VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGXKPWVSLPKGXGIKLTIIEE  146

Query  234  AKKR  223
            AKKR
Sbjct  147  AKKR  150



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  128  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  187

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EE
Sbjct  188  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEE  247

Query  234  AKKR  223
            AKKR
Sbjct  248  AKKR  251



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKG+GIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGRGIKLTIIEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>ref|XP_010251772.1| PREDICTED: 40S ribosomal protein S4-like [Nelumbo nucifera]
Length=200

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTI YPDPLI+ANDT+K+DLE+NK+ +FIKFDV NVVMVTGGRNRG 
Sbjct  68   GDKGIPYLNTYDGRTIHYPDPLIRANDTIKIDLETNKITNFIKFDVENVVMVTGGRNRGH  127

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+ IQDATGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  128  VGIIKNREKHKGSFETILIQDATGHEFATRLGNVFTMGKGTKPWVSLPKGKGIKLSIIEE  187

Query  234  AKKRLAAQSATTA  196
            A+KR+ A +A+TA
Sbjct  188  ARKRITATAASTA  200



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  175  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  234

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  235  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  294

Query  234  AKKRLAAQSA  205
            A KRL+AQ A
Sbjct  295  AWKRLSAQQA  304



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRL  220
            A+KRL
Sbjct  252  ARKRL  256



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFT+GKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTVGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSA  205
            A+KRLAA   
Sbjct  252  ARKRLAASVC  261



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAA  214
            A+KRLA+
Sbjct  252  ARKRLAS  258



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKSREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            GKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  131  GKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  190

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKG+FET+H+QDA GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  191  VGIIKNREKHKGTFETIHVQDAAGHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEE  250

Query  234  AKKRLA  217
            A+KR+A
Sbjct  251  ARKRVA  256



>ref|XP_008374276.1| PREDICTED: 40S ribosomal protein S4 isoform X1 [Malus domestica]
Length=171

 Score =   196 bits (499),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+N + DFIKFDVGNVVMVT GRNRGR
Sbjct  39   GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNNITDFIKFDVGNVVMVTSGRNRGR  98

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG KPWVSLPKG GIKL+IIEE
Sbjct  99   VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGXKPWVSLPKGXGIKLTIIEE  158

Query  234  AKKR  223
            AKKR
Sbjct  159  AKKR  162



>ref|XP_008343651.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S4-like, 
partial [Malus domestica]
Length=152

 Score =   196 bits (497),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYD RTIRYPDPLIKANDT+KLDLE+N + DFIKFDVGNVVMVT GRNRGR
Sbjct  20   GQKGIPYINTYDXRTIRYPDPLIKANDTIKLDLETNNITDFIKFDVGNVVMVTSGRNRGR  79

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKG KPWVSLPKGKGIKL+IIEE
Sbjct  80   VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGGKPWVSLPKGKGIKLTIIEE  139

Query  234  AKKR  223
            AKKR
Sbjct  140  AKKR  143



>ref|XP_008801072.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=195

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP +NTYDG TIRYPDPLI+ANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  62   GQKGIPHLNTYDGHTIRYPDPLIRANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  121

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFAT LGNVFTIGKGTKPWVSLPKGK IKLSIIEE
Sbjct  122  VGVIKNREKHKGSFETIHLQDALGHEFATCLGNVFTIGKGTKPWVSLPKGKCIKLSIIEE  181

Query  234  AKKRLAAQSA  205
            A+K+LAA  A
Sbjct  182  ARKQLAASGA  191



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  136  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNVVMVTGGRNRGR  195

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  196  VGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  255

Query  234  AKKR  223
            AKKR
Sbjct  256  AKKR  259



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA + T A
Sbjct  252  ARKRQAAAAQTVA  264



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   197 bits (501),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE++K+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETSKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
            AKKR
Sbjct  252  AKKR  255



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG++KNREKHKGSFET+HI+DA GHEFATR GNVF IGKGTKPWVS+PKGKGIKL+IIEE
Sbjct  192  VGILKNREKHKGSFETIHIEDAAGHEFATRQGNVFIIGKGTKPWVSVPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR   + ATTA
Sbjct  252  ARKR-QQKEATTA  263



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATR+GNVF IGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KR A ++AT 
Sbjct  252  ARKR-AEKTATA  262



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQD+ GHEFATR+GNVF IGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKRLAAQSATT  199
            A+KR A ++AT 
Sbjct  252  ARKR-AEKTATA  262



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EE
Sbjct  192  VGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEE  251



>gb|KDO63243.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=187

 Score =   192 bits (487),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGR
Sbjct  57   GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGR  116

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  117  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  176



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTKPWISLPKGKGIKLTIIEE  251



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGR
Sbjct  124  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGR  183

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  184  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  243



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGR
Sbjct  154  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGR  213

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  214  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  273



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGR
Sbjct  114  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  174  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  233



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++DA GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDALGHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDAQGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HIQDATG EFATRLGNVFTIGKGTKPWVS PKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHIQDATGPEFATRLGNVFTIGKGTKPWVSFPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSATTA  196
            A+KR AA + T A
Sbjct  252  ARKRQAAAAQTVA  264



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+IKANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPVIKANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGR
Sbjct  132  GQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  251



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++DA GH FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDALGHAFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++D+ GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKDKKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSA  205
            A+KR A  +A
Sbjct  252  ARKRNAEAAA  261



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++D+ GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++D+ GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++D+ GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  152  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  211

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+H++D+ GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  212  VGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  271

Query  234  AKKR  223
             +KR
Sbjct  272  QRKR  275



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTNDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTIGKGTKPWV+LPKGKGIKL+IIEE
Sbjct  192  VGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTKPWVTLPKGKGIKLTIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+VMVTGGRN GR
Sbjct  114  GQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGR  173

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  174  VGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEE  233

Query  234  AKKRLAAQSA  205
            A+KR A  +A
Sbjct  234  ARKRNAEAAA  243



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKITDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG IKNR+KH G+FET+H+QDA GHEFATRLGNVFTIG+G KPWVSLPKG+GIKL++IEE
Sbjct  192  VGFIKNRKKHMGTFETIHVQDAAGHEFATRLGNVFTIGRGPKPWVSLPKGRGIKLTVIEE  251

Query  234  AKKRL  220
            A+KR+
Sbjct  252  ARKRM  256



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+VMVTGGRN GR
Sbjct  132  GQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQSA  205
            A+KR A  +A
Sbjct  252  ARKRNAEAAA  261



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGG+NRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGKNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG+FET+H+QDATGHEFATRL NVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  192  VGVIKNREKHKGTFETIHVQDATGHEFATRLVNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNVVMVTGGRN GR
Sbjct  148  GQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNVVMVTGGRNTGR  207

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  208  VGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEE  267

Query  234  AKKRLAAQSA  205
            A+KR A  +A
Sbjct  268  ARKRNAEAAA  277



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DL++NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLDTNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++D+ GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKDKKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKRLAAQS  208
            A+KR A  +
Sbjct  252  ARKRNAEAA  260



>dbj|BAN18292.1| 40S ribosomal protein S4, partial [Schiedea spergulina]
 dbj|BAN18293.1| 40S ribosomal protein S4, partial [Schiedea kealiae]
 dbj|BAN18294.1| 40S ribosomal protein S4, partial [Schiedea mannii]
 dbj|BAN18295.1| 40S ribosomal protein S4, partial [Schiedea adamantis]
 dbj|BAN18296.1| 40S ribosomal protein S4, partial [Schiedea menziesii]
 dbj|BAN18297.1| 40S ribosomal protein S4, partial [Schiedea hookeri]
 dbj|BAN18298.1| 40S ribosomal protein S4, partial [Schiedea sarmentosa]
 dbj|BAN18299.1| 40S ribosomal protein S4, partial [Schiedea lydgatei]
 dbj|BAN18300.1| 40S ribosomal protein S4, partial [Schiedea haleakalensis]
 dbj|BAN18301.1| 40S ribosomal protein S4, partial [Schiedea ligustrina]
 dbj|BAN18302.1| 40S ribosomal protein S4, partial [Schiedea salicaria]
 dbj|BAN18303.1| 40S ribosomal protein S4, partial [Schiedea globosa]
 dbj|BAN18304.1| 40S ribosomal protein S4, partial [Schiedea verticillata]
 dbj|BAN18305.1| 40S ribosomal protein S4, partial [Schiedea viscosa]
 dbj|BAN18306.1| 40S ribosomal protein S4, partial [Schiedea trinervis]
 dbj|BAN18307.1| 40S ribosomal protein S4, partial [Schiedea obovata]
 dbj|BAN18308.1| 40S ribosomal protein S4, partial [Schiedea membranacea]
 dbj|BAN18310.1| 40S ribosomal protein S4, partial [Schiedea apokremnos]
Length=135

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEE  131

Query  234  AKKR  223
            A+KR
Sbjct  132  ARKR  135



>dbj|BAN18309.1| 40S ribosomal protein S4, partial [Schiedea helleri]
Length=135

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IKNREKHKGSFET+HI+DA GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEE
Sbjct  72   VGIIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEE  131

Query  234  AKKR  223
            A+KR
Sbjct  132  ARKR  135



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKG F+T+H++D+ GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGGFDTIHVEDSMGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             ++R
Sbjct  252  QRRR  255



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDP IKANDT+K+DLE+NK+VDFIKFDVGNVVMVTGGRN GR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPPIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGS ET+H++D+ GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct  192  VGVIKNREKHKGSLETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE  251

Query  234  AKKR  223
             +KR
Sbjct  252  QRKR  255



>dbj|BAN18311.1| 40S ribosomal protein S4, partial [Schiedea jacobii]
 dbj|BAN18312.1| 40S ribosomal protein S4, partial [Schiedea nuttallii]
 dbj|BAN18313.1| 40S ribosomal protein S4, partial [Schiedea pentandra]
 dbj|BAN18314.1| 40S ribosomal protein S4, partial [Schiedea kauaiensis]
 dbj|BAN18316.1| 40S ribosomal protein S4, partial [Schiedea perlmanii]
 dbj|BAN18317.1| 40S ribosomal protein S4, partial [Schiedea kaalae]
 dbj|BAN18318.1| 40S ribosomal protein S4, partial [Schiedea laui]
Length=135

 Score =   182 bits (462),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEE  131

Query  234  AKKR  223
            A+KR
Sbjct  132  ARKR  135



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+VMVTGGRN GR
Sbjct  267  GQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGR  326

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEE
Sbjct  327  VGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEE  386

Query  234  AKKRLAAQSA  205
            A+KR A  +A
Sbjct  387  ARKRNAEAAA  396



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+K IP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  136  GQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGR  195

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG+IK+RE+HKGSF+ +HI+DA  HEFATRLGNVFTIGK +KPWVSLPKGKGIKLSIIEE
Sbjct  196  VGLIKSRERHKGSFDIIHIEDAAKHEFATRLGNVFTIGKASKPWVSLPKGKGIKLSIIEE  255

Query  234  AKKR  223
            A+KR
Sbjct  256  ARKR  259



>dbj|BAN18315.1| 40S ribosomal protein S4, partial [Schiedea stellarioides]
Length=135

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAXGHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEE  131

Query  234  AKKR  223
            A+KR
Sbjct  132  ARKR  135



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NT+DGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTFDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+RE+ KGSF+T+H+QDATGHEFATRL NVFTIGKGTKP +SLPKGKGIKLSIIEE
Sbjct  192  VGVIKSRERQKGSFDTIHVQDATGHEFATRLANVFTIGKGTKPLISLPKGKGIKLSIIEE  251

Query  234  AKKR  223
            A+KR
Sbjct  252  ARKR  255



>gb|ADW09573.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
stellarioides]
Length=132

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DATGHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDATGHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEE  131

Query  234  A  232
            A
Sbjct  132  A  132



>gb|ADK97882.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97885.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97886.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97887.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97888.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97889.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97893.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97894.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97895.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97898.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADW09575.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
adamantis]
 gb|ADW09576.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
adamantis]
 gb|ADW09577.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
membranacea]
 gb|ADW09578.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
membranacea]
 gb|ADW09579.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09581.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09583.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09585.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09587.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09588.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09593.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09594.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09595.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09596.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09597.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09598.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09599.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09600.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09601.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09602.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09603.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09604.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09605.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09606.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09607.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09608.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09609.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09610.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09611.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09613.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09615.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09625.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
Length=132

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEE  131

Query  234  A  232
            A
Sbjct  132  A  132



>gb|ADK97878.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97879.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97880.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97881.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97890.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97891.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97892.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97901.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97902.1| 40S ribosomal protein S4-like protein, partial [Schiedea adamantis]
Length=132

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L + K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLXTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEE  131

Query  234  A  232
            A
Sbjct  132  A  132



>gb|ADK97883.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97884.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97896.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97897.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97899.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97900.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADW09580.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09582.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09584.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09586.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09589.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09590.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09591.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09592.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09612.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09614.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09616.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09617.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09618.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09619.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09620.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09621.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09622.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09623.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09624.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09626.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
Length=132

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L + K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLYTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEE  131

Query  234  A  232
            A
Sbjct  132  A  132



>gb|ADW09574.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
stellarioides]
Length=132

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KL+L++ K+ DF+KFDVGNVVMVTGGRNRGR
Sbjct  12   GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNVVMVTGGRNRGR  71

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIKNREKHKGSFET+HI+DA GHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEE
Sbjct  72   VGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEE  131

Query  234  A  232
            A
Sbjct  132  A  132



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GDKGIPYLNTYDGRTIRYPDPLVKANDTIKIDLETGKIKEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFE +H+QDA G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSIIEE
Sbjct  192  VGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIEE  251

Query  234  AKKR  223
            A+KR
Sbjct  252  ARKR  255



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNV+MVTGGRNRGR
Sbjct  132  GDKGIPYLNTYDGRTIRYPDPLVKANDTIKVDLETGKIKEFIKFDVGNVIMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGVIK+REKHKGSFE +H+QDA G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSIIEE
Sbjct  192  VGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIEE  251

Query  234  AKKR  223
            A+KR
Sbjct  252  ARKR  255



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VGV K+R K+KGSFET+H+Q+ATGHE AT LGNVFTIGKGTKPWV   KGKGIKLSII E
Sbjct  192  VGVFKSRNKNKGSFETIHVQEATGHEIATCLGNVFTIGKGTKPWVFFSKGKGIKLSIIGE  251

Query  234  AKKRLAAQSATTA  196
             +K ++ Q  T A
Sbjct  252  GRKGISPQQGTGA  264



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+VMVTGGRNRGR
Sbjct  132  GDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI++REKHKGSF+ +H+ D+TG +FATR+GNVFT+G+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTVGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLAAQSAT  202
            AKKR  A  A+
Sbjct  252  AKKRTQALKAS  262



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   176 bits (446),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  600  SVGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnr  421
              G+KG+P +NTYDGRTIRYPDP IK NDT+K+DLE+NK+VDFIKF+VGN VMVTGGRN 
Sbjct  130  QCGQKGVPSLNTYDGRTIRYPDPAIKPNDTIKIDLETNKIVDFIKFEVGNFVMVTGGRNT  189

Query  420  grvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSII  241
            GR+GVIK+RE+H+GSFET+H++DA GH+FATRL NVF+IGK  K WVSLPKGKGIKL+II
Sbjct  190  GRIGVIKSRERHEGSFETIHVEDALGHQFATRLANVFSIGKDRKSWVSLPKGKGIKLTII  249

Query  240  EEAKKRLAA  214
            EEA+KR+AA
Sbjct  250  EEARKRIAA  258



>emb|CDX91445.1| BnaC04g07050D [Brassica napus]
Length=162

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -1

Query  555  RTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgVIKNREKHKGS  376
            R  RYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGS
Sbjct  45   RIFRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGS  104

Query  375  FETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  202
            FET+HIQD+TGHEFATRLGNVFT+GKGTKPW SLPKGKGIKL+IIEEA+KRL+ Q A 
Sbjct  105  FETIHIQDSTGHEFATRLGNVFTLGKGTKPWASLPKGKGIKLTIIEEARKRLSTQQAA  162



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGNVVMVTGGRNRGR
Sbjct  132  GAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNVVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG I++REKHKGSF+ +HI+D+ G +FATR+GNVFTIG+GTKPWVSLPKGKGIKLSI+EE
Sbjct  192  VGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTIGQGTKPWVSLPKGKGIKLSIVEE  251

Query  234  AKKRL  220
            A+KR+
Sbjct  252  ARKRV  256



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGN+VMVTGGRNRGR
Sbjct  132  GAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNLVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            VG I++REKHKGSF+ +HI+D+ G +FATR+GNVFTIG+GTKPWVSLPKGKGIKLSI+EE
Sbjct  192  VGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTIGQGTKPWVSLPKGKGIKLSIVEE  251

Query  234  AKKRL  220
            A+KR+
Sbjct  252  ARKRV  256



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+VMVTGGRNRGR
Sbjct  132  GDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI++REKHKGSF+ +H+ DATG +FATR+GNVFT+G+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIQHREKHKGSFDIIHVTDATGQQFATRMGNVFTVGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLAAQSATT  199
            AKKR  A  A  
Sbjct  252  AKKRGQALKAAA  263



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+VMVTGGRNRGR
Sbjct  132  GDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI++REKHKGSF+ +H+ D+TG +FATR+GNVFT+G+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTVGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLAAQSA  205
            AKKR  A  A
Sbjct  252  AKKRTQALKA  261



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+VMVTGGRNRGR
Sbjct  132  GDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI++REKHKGSF+ +H+ D+TG++FATR+GNVFTIG+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIQHREKHKGSFDIIHVTDSTGNQFATRMGNVFTIGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLAA  214
            AKKR A 
Sbjct  252  AKKRKAV  258



>ref|XP_007157713.1| hypothetical protein PHAVU_002G092000g [Phaseolus vulgaris]
 gb|ESW29707.1| hypothetical protein PHAVU_002G092000g [Phaseolus vulgaris]
Length=143

 Score =   168 bits (425),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 117/127 (92%), Gaps = 2/127 (2%)
 Frame = -1

Query  582  IPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgVI  403
            IP++NTY GRTIRY D + +ANDT+KL+LE NK+V+FIKFDVGNVVMVTG RNRGRVGVI
Sbjct  17   IPYLNTYVGRTIRYLDLITRANDTIKLNLEENKIVEFIKFDVGNVVMVTGVRNRGRVGVI  76

Query  402  KNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  223
            K+REK+KG FET+H+QDATGHEFATRLGNVFTIGKGT+  VSLPKGKGI+LSIIEEA+K+
Sbjct  77   KSREKNKGCFETIHVQDATGHEFATRLGNVFTIGKGTR--VSLPKGKGIELSIIEEARKK  134

Query  222  LAAQSAT  202
            ++AQ AT
Sbjct  135  ISAQQAT  141



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P + T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+VMVTGGRNRGR
Sbjct  132  GDKGVPHVTTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI +REKHKGSF+ +H+ DA G++FATR+GNVFTIG+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIHHREKHKGSFDIIHVTDAIGNQFATRMGNVFTIGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLAAQ  211
            AKKR A +
Sbjct  252  AKKRKATE  259



>ref|XP_010921843.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=209

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVD-FIKFDvgnvvmvtggrnrg  418
            G+KGIP+ NT DG  I   D +I+AN+T+KLDL++NK+VD FIKFDVG++ M+TGGRNR 
Sbjct  75   GRKGIPYQNTDDGHIIHCLDLIIRANNTIKLDLQTNKIVDCFIKFDVGSIAMITGGRNRE  134

Query  417  rvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIE  238
            RVGVIKNREKHKG FET+H+QD  GHEFATRLGNVFTIGKGTKPWVSLPKGKG+KLSII+
Sbjct  135  RVGVIKNREKHKGGFETIHLQDVLGHEFATRLGNVFTIGKGTKPWVSLPKGKGVKLSIIK  194

Query  237  EAKKRLAAQSATT  199
            E +KRLAA   T 
Sbjct  195  EDRKRLAASGVTA  207


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 20/78 (26%)
 Frame = -1

Query  405  IKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKK  226
            IKNREKHKGSF+T+H+QD                  GTKPWVSLPK K +KLSII+E +K
Sbjct  14   IKNREKHKGSFKTIHLQD------------------GTKPWVSLPKRKSVKLSIIKEDRK  55

Query  225  RLAAQSATTA*MHCRLSS  172
            RLAA  A  A M C++ S
Sbjct  56   RLAASGA--AAMLCKVRS  71



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  594  GKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgr  415
            G KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFDVGN+VMVTGGRNRGR
Sbjct  132  GDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDVGNIVMVTGGRNRGR  191

Query  414  vgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  235
            +GVI +REKHKGSF+ +H+ DATG++FATR+GNV+TIG+GTKPW++LP+GKGIKLSI+EE
Sbjct  192  IGVIHHREKHKGSFDIIHVTDATGNQFATRMGNVYTIGQGTKPWITLPRGKGIKLSIVEE  251

Query  234  AKKRLA  217
            AKKR A
Sbjct  252  AKKRKA  257



>emb|CAF89133.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=176

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  597  VGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrg  418
            +G KGIP + T+D RTIRYPDPLIK NDTV++DLES K+ DFIKFD GN+ MVTGG N G
Sbjct  44   IGTKGIPHLVTHDARTIRYPDPLIKVNDTVRIDLESGKITDFIKFDTGNMCMVTGGANLG  103

Query  417  rvgVIKNREKHKGSFETVHIQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIE  238
            R+GVI NRE+H GSF+ VH++D TG+ FATRL N+F IGKG KPWVSLP+GKGI+L+I E
Sbjct  104  RIGVITNRERHPGSFDVVHVKDTTGNSFATRLSNIFVIGKGNKPWVSLPRGKGIRLTIAE  163

Query  237  EAKKRLAAQSATT  199
            E  KRLAA+ A++
Sbjct  164  ERDKRLAAKQASS  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940