BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042J15

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798339.1|  PREDICTED: probable low-specificity L-threon...    209   3e-62   Nicotiana sylvestris
ref|XP_009631531.1|  PREDICTED: probable low-specificity L-threon...    206   7e-61   
emb|CDO99988.1|  unnamed protein product                                203   3e-60   Coffea canephora [robusta coffee]
ref|XP_006361420.1|  PREDICTED: uncharacterized protein R102.4 is...    197   1e-57   Solanum tuberosum [potatoes]
ref|NP_001275261.1|  L-allo-threonine aldolase-related protein          197   1e-57   Solanum tuberosum [potatoes]
ref|XP_004236787.1|  PREDICTED: probable low-specificity L-threon...    197   2e-57   Solanum lycopersicum
ref|XP_010319280.1|  PREDICTED: probable low-specificity L-threon...    197   2e-57   Solanum lycopersicum
ref|XP_009795458.1|  PREDICTED: probable low-specificity L-threon...    191   5e-55   Nicotiana sylvestris
emb|CBI22386.3|  unnamed protein product                                190   5e-55   Vitis vinifera
ref|XP_002266992.1|  PREDICTED: probable low-specificity L-threon...    190   6e-55   Vitis vinifera
ref|XP_007030420.1|  Threonine aldolase 1 isoform 1                     186   2e-53   
ref|XP_011101617.1|  PREDICTED: probable low-specificity L-threon...    186   4e-53   Sesamum indicum [beniseed]
ref|XP_007030422.1|  Threonine aldolase 1 isoform 3                     184   8e-53   
ref|XP_002521974.1|  l-allo-threonine aldolase, putative                182   8e-52   Ricinus communis
gb|KCW61508.1|  hypothetical protein EUGRSUZ_H04236                     179   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010024956.1|  PREDICTED: probable low-specificity L-threon...    179   1e-50   
ref|XP_007030424.1|  Threonine aldolase 1 isoform 5                     176   1e-49   
ref|XP_004494746.1|  PREDICTED: L-allo-threonine aldolase-like is...    176   3e-49   Cicer arietinum [garbanzo]
ref|XP_002325334.2|  L-allo-threonine aldolase-related family pro...    174   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011036295.1|  PREDICTED: probable low-specificity L-threon...    173   2e-48   Populus euphratica
gb|AFK43649.1|  unknown                                                 173   2e-48   Lotus japonicus
gb|EYU19887.1|  hypothetical protein MIMGU_mgv1a008896mg                173   2e-48   Erythranthe guttata [common monkey flower]
gb|KCW61511.1|  hypothetical protein EUGRSUZ_H04236                     173   2e-48   Eucalyptus grandis [rose gum]
ref|XP_003521772.1|  PREDICTED: uncharacterized protein R102.4-li...    173   3e-48   Glycine max [soybeans]
gb|KDP23711.1|  hypothetical protein JCGZ_23544                         172   3e-48   Jatropha curcas
gb|KJB82283.1|  hypothetical protein B456_013G187300                    172   4e-48   Gossypium raimondii
ref|XP_002319106.2|  L-allo-threonine aldolase-related family pro...    172   7e-48   
gb|KJB44860.1|  hypothetical protein B456_007G276400                    171   2e-47   Gossypium raimondii
gb|KJB44862.1|  hypothetical protein B456_007G276400                    171   3e-47   Gossypium raimondii
gb|KJB44861.1|  hypothetical protein B456_007G276400                    171   4e-47   Gossypium raimondii
ref|XP_011038517.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    169   7e-47   Populus euphratica
ref|XP_007147215.1|  hypothetical protein PHAVU_006G105400g             168   2e-46   Phaseolus vulgaris [French bean]
gb|KEH24599.1|  L-allo-threonine aldolase-like protein                  168   2e-46   Medicago truncatula
gb|AFK40044.1|  unknown                                                 168   2e-46   Medicago truncatula
ref|XP_006577318.1|  PREDICTED: uncharacterized protein R102.4-li...    168   2e-46   Glycine max [soybeans]
ref|XP_010102233.1|  L-allo-threonine aldolase                          167   3e-46   Morus notabilis
gb|KJB46043.1|  hypothetical protein B456_007G345500                    167   3e-46   Gossypium raimondii
gb|KHG25609.1|  L-allo-threonine aldolase                               167   5e-46   Gossypium arboreum [tree cotton]
ref|XP_009364444.1|  PREDICTED: probable low-specificity L-threon...    167   7e-46   Pyrus x bretschneideri [bai li]
ref|XP_008218319.1|  PREDICTED: probable low-specificity L-threon...    166   8e-46   Prunus mume [ume]
gb|KHN04944.1|  L-allo-threonine aldolase                               166   1e-45   Glycine soja [wild soybean]
ref|XP_008388714.1|  PREDICTED: probable low-specificity L-threon...    165   2e-45   
ref|XP_008388713.1|  PREDICTED: probable low-specificity L-threon...    166   2e-45   
gb|KDO44520.1|  hypothetical protein CISIN_1g0182431mg                  159   3e-45   Citrus sinensis [apfelsine]
ref|XP_010262337.1|  PREDICTED: probable low-specificity L-threon...    164   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_004170828.1|  PREDICTED: L-allo-threonine aldolase-like          164   4e-45   
ref|XP_010262335.1|  PREDICTED: probable low-specificity L-threon...    164   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008456444.1|  PREDICTED: probable low-specificity L-threon...    164   6e-45   Cucumis melo [Oriental melon]
ref|XP_010694951.1|  PREDICTED: probable low-specificity L-threon...    164   1e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139254.1|  PREDICTED: L-allo-threonine aldolase-like          163   2e-44   Cucumis sativus [cucumbers]
ref|XP_006577317.1|  PREDICTED: uncharacterized protein R102.4-li...    163   2e-44   Glycine max [soybeans]
ref|XP_003556456.2|  PREDICTED: uncharacterized protein R102.4-li...    164   2e-44   
ref|XP_011465993.1|  PREDICTED: probable low-specificity L-threon...    162   3e-44   Fragaria vesca subsp. vesca
gb|KJB46045.1|  hypothetical protein B456_007G345500                    163   3e-44   Gossypium raimondii
ref|XP_006417664.1|  hypothetical protein EUTSA_v10008026mg             162   3e-44   Eutrema salsugineum [saltwater cress]
ref|XP_007205422.1|  hypothetical protein PRUPE_ppa007684mg             162   5e-44   Prunus persica
emb|CDX93548.1|  BnaA06g05000D                                          161   7e-44   
ref|XP_009148115.1|  PREDICTED: probable low-specificity L-threon...    161   7e-44   Brassica rapa
ref|XP_006606453.1|  PREDICTED: uncharacterized protein R102.4-li...    161   8e-44   
ref|XP_006606452.1|  PREDICTED: uncharacterized protein R102.4-li...    161   1e-43   
ref|XP_010246795.1|  PREDICTED: probable low-specificity L-threon...    160   1e-43   Nelumbo nucifera [Indian lotus]
emb|CDX95045.1|  BnaC05g06260D                                          160   2e-43   
ref|XP_006606451.1|  PREDICTED: uncharacterized protein R102.4-li...    162   2e-43   
ref|XP_006487715.1|  PREDICTED: uncharacterized protein R102.4-li...    159   4e-43   Citrus sinensis [apfelsine]
gb|ADI24921.1|  L-allo-threonine aldolase                               159   4e-43   Carica papaya [mamon]
emb|CDY06323.1|  BnaA09g48800D                                          159   5e-43   
ref|XP_006442676.1|  hypothetical protein CICLE_v10020798mg             159   5e-43   Citrus clementina [clementine]
ref|XP_009118358.1|  PREDICTED: probable low-specificity L-threon...    159   6e-43   
ref|XP_006408182.1|  hypothetical protein EUTSA_v10021036mg             158   1e-42   Eutrema salsugineum [saltwater cress]
gb|AFK42511.1|  unknown                                                 151   1e-42   Lotus japonicus
ref|XP_009123981.1|  PREDICTED: probable low-specificity L-threon...    157   2e-42   Brassica rapa
ref|XP_003590971.1|  L-allo-threonine aldolase                          157   2e-42   
tpg|DAA36971.1|  TPA: putative threonine aldolase family protein ...    157   2e-42   
ref|XP_008661960.1|  PREDICTED: L-allo-threonine aldolase isoform X1    157   3e-42   
emb|CDY22672.1|  BnaC08g43060D                                          157   3e-42   Brassica napus [oilseed rape]
gb|AES61221.2|  L-allo-threonine aldolase-like protein                  157   3e-42   Medicago truncatula
gb|AFK38526.1|  unknown                                                 157   3e-42   Medicago truncatula
gb|ACF86035.1|  unknown                                                 154   3e-42   Zea mays [maize]
gb|ACG34432.1|  L-allo-threonine aldolase                               157   3e-42   Zea mays [maize]
ref|XP_003590972.1|  L-allo-threonine aldolase                          157   3e-42   Medicago truncatula
ref|NP_566228.1|  threonine aldolase 2                                  157   3e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42933.1|  BnaC05g47180D                                          157   4e-42   Brassica napus [oilseed rape]
emb|CDY49330.1|  BnaA05g32920D                                          157   4e-42   Brassica napus [oilseed rape]
ref|XP_003590973.1|  L-allo-threonine aldolase                          157   4e-42   
ref|XP_010906812.1|  PREDICTED: probable low-specificity L-threon...    156   7e-42   Elaeis guineensis
ref|XP_010906811.1|  PREDICTED: probable low-specificity L-threon...    156   7e-42   
ref|XP_004495577.1|  PREDICTED: L-allo-threonine aldolase-like is...    155   9e-42   Cicer arietinum [garbanzo]
ref|XP_010906809.1|  PREDICTED: probable low-specificity L-threon...    156   1e-41   
ref|XP_010906810.1|  PREDICTED: probable low-specificity L-threon...    156   1e-41   
ref|XP_004495576.1|  PREDICTED: L-allo-threonine aldolase-like is...    155   1e-41   Cicer arietinum [garbanzo]
ref|XP_002448187.1|  hypothetical protein SORBIDRAFT_06g022630          155   2e-41   Sorghum bicolor [broomcorn]
dbj|BAK03835.1|  predicted protein                                      155   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580135.1|  PREDICTED: probable low-specificity L-threon...    155   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_002884450.1|  hypothetical protein ARALYDRAFT_896488             154   3e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010489194.1|  PREDICTED: probable low-specificity L-threon...    154   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010463930.1|  PREDICTED: probable low-specificity L-threon...    154   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010553776.1|  PREDICTED: probable low-specificity L-threon...    154   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_010475669.1|  PREDICTED: probable low-specificity L-threon...    154   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010415759.1|  PREDICTED: probable low-specificity L-threon...    154   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006305180.1|  hypothetical protein CARUB_v10009546mg             154   5e-41   Capsella rubella
tpg|DAA45471.1|  TPA: hypothetical protein ZEAMMB73_239903              149   5e-41   
ref|XP_006298023.1|  hypothetical protein CARUB_v10014068mg             153   6e-41   Capsella rubella
ref|NP_001241763.1|  L-allo-threonine aldolase                          154   6e-41   
ref|XP_010553775.1|  PREDICTED: probable low-specificity L-threon...    154   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_008655940.1|  PREDICTED: probable low-specificity L-threon...    149   6e-41   
ref|XP_007144017.1|  hypothetical protein PHAVU_007G122200g             154   7e-41   Phaseolus vulgaris [French bean]
ref|XP_008667491.1|  PREDICTED: putative threonine aldolase famil...    153   8e-41   
ref|XP_008443794.1|  PREDICTED: probable low-specificity L-threon...    153   1e-40   
ref|XP_008655935.1|  PREDICTED: probable low-specificity L-threon...    149   1e-40   
ref|XP_003590970.1|  L-allo-threonine aldolase                          154   2e-40   
ref|XP_010485829.1|  PREDICTED: probable low-specificity L-threon...    152   3e-40   Camelina sativa [gold-of-pleasure]
gb|ACJ85157.1|  unknown                                                 153   3e-40   Medicago truncatula
ref|NP_001149239.1|  L-allo-threonine aldolase                          152   4e-40   Zea mays [maize]
ref|NP_001189807.1|  threonine aldolase 2                               150   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EMS52584.1|  L-allo-threonine aldolase                               150   1e-39   Triticum urartu
emb|CDY31134.1|  BnaA08g26840D                                          150   1e-39   Brassica napus [oilseed rape]
ref|XP_010458106.1|  PREDICTED: probable low-specificity L-threon...    150   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009110878.1|  PREDICTED: probable low-specificity L-threon...    150   2e-39   Brassica rapa
ref|XP_008802139.1|  PREDICTED: probable low-specificity L-threon...    150   2e-39   Phoenix dactylifera
gb|AAM63785.1|  unknown                                                 149   3e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CAE05443.2|  OSJNBa0073E02.3                                        149   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053314.1|  Os04g0516600                                       149   4e-39   
ref|NP_563822.1|  threonine aldolase                                    148   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667492.1|  PREDICTED: putative threonine aldolase famil...    148   6e-39   Zea mays [maize]
gb|EMS67121.1|  L-allo-threonine aldolase                               148   1e-38   Triticum urartu
ref|XP_004976222.1|  PREDICTED: uncharacterized protein R102.4-like     147   1e-38   Setaria italica
ref|XP_002892465.1|  hypothetical protein ARALYDRAFT_470930             147   2e-38   
ref|XP_007030423.1|  L-allo-threonine aldolase isoform 4                146   3e-38   
gb|AAF63783.1|  L-allo-threonine aldolase, putative                     146   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652519.1|  PREDICTED: uncharacterized protein R102.4-like     146   6e-38   Oryza brachyantha
ref|XP_009389078.1|  PREDICTED: probable low-specificity L-threon...    145   7e-38   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ93201.1|  predicted protein                                      145   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004142582.1|  PREDICTED: L-allo-threonine aldolase-like          145   1e-37   
ref|NP_001242307.1|  uncharacterized protein LOC100790890               145   1e-37   
ref|XP_006588445.1|  PREDICTED: uncharacterized protein LOC100790...    145   1e-37   Glycine max [soybeans]
emb|CDY54493.1|  BnaCnng27100D                                          143   2e-37   Brassica napus [oilseed rape]
ref|XP_004155692.1|  PREDICTED: L-allo-threonine aldolase-like          144   2e-37   
ref|XP_008453667.1|  PREDICTED: probable low-specificity L-threon...    144   4e-37   Cucumis melo [Oriental melon]
ref|XP_008453666.1|  PREDICTED: probable low-specificity L-threon...    144   4e-37   Cucumis melo [Oriental melon]
ref|XP_010906814.1|  PREDICTED: probable low-specificity L-threon...    143   5e-37   Elaeis guineensis
ref|XP_008802138.1|  PREDICTED: probable low-specificity L-threon...    141   3e-36   Phoenix dactylifera
gb|ACJ83727.1|  unknown                                                 134   3e-36   Medicago truncatula
ref|XP_006857300.1|  hypothetical protein AMTR_s00067p00056150          140   4e-36   Amborella trichopoda
gb|EPS60604.1|  hypothetical protein M569_14199                         139   1e-35   Genlisea aurea
ref|XP_004976228.1|  PREDICTED: uncharacterized protein R102.4-li...    138   5e-35   Setaria italica
ref|XP_010906817.1|  PREDICTED: probable low-specificity L-threon...    137   6e-35   Elaeis guineensis
gb|KHG00003.1|  ltaA                                                    137   6e-35   Gossypium arboreum [tree cotton]
gb|AAF99780.1|AC003981_30  F22O13.11                                    137   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KHG00004.1|  ltaA                                                    137   1e-34   Gossypium arboreum [tree cotton]
gb|ABR18450.1|  unknown                                                 132   7e-33   Picea sitchensis
ref|XP_004976227.1|  PREDICTED: uncharacterized protein R102.4-li...    132   1e-32   
gb|KJB44863.1|  hypothetical protein B456_007G276400                    131   1e-32   Gossypium raimondii
gb|KGN66766.1|  hypothetical protein Csa_1G681120                       122   1e-31   Cucumis sativus [cucumbers]
ref|XP_010520652.1|  PREDICTED: probable low-specificity L-threon...    127   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_008802141.1|  PREDICTED: probable low-specificity L-threon...    124   3e-30   
ref|NP_001077492.1|  threonine aldolase                                 123   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976226.1|  PREDICTED: uncharacterized protein R102.4-like     122   2e-29   Setaria italica
ref|XP_008655946.1|  PREDICTED: probable low-specificity L-threon...    117   7e-29   
ref|XP_001768407.1|  predicted protein                                  121   1e-28   
dbj|BAK01917.1|  predicted protein                                      120   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY59150.1|  BnaC08g13650D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_008657658.1|  PREDICTED: probable low-specificity L-threon...    116   3e-28   Zea mays [maize]
ref|XP_008675991.1|  PREDICTED: probable low-specificity L-threon...    114   4e-28   
ref|NP_001140767.1|  putative threonine aldolase family protein         117   8e-28   
ref|WP_020877756.1|  aromatic amino acid beta-eliminating lyase/t...    115   5e-27   Desulfococcus multivorans
gb|KGN66765.1|  hypothetical protein Csa_1G680120                       115   7e-27   Cucumis sativus [cucumbers]
ref|XP_004170415.1|  PREDICTED: L-allo-threonine aldolase-like          114   2e-26   
ref|XP_007030425.1|  Threonine aldolase 1 isoform 6                     113   3e-26   
ref|XP_008453668.1|  PREDICTED: probable low-specificity L-threon...    114   3e-26   Cucumis melo [Oriental melon]
ref|WP_011697570.1|  threonine aldolase                                 113   5e-26   Syntrophobacter fumaroxidans
ref|WP_027408853.1|  threonine aldolase                                 112   1e-25   Anoxybacillus tepidamans
ref|XP_008671569.1|  PREDICTED: probable low-specificity L-threon...    110   2e-25   Zea mays [maize]
tpg|DAA45470.1|  TPA: hypothetical protein ZEAMMB73_239903              112   3e-25   
ref|XP_008671685.1|  PREDICTED: uncharacterized protein LOC103649121    110   5e-25   
ref|WP_009609982.1|  threonine aldolase                                 109   1e-24   Caldanaerobacter subterraneus
ref|WP_011024735.1|  threonine aldolase                                 109   1e-24   Caldanaerobacter subterraneus
ref|WP_026677955.1|  threonine aldolase                                 109   1e-24   Fictibacillus gelatini
ref|WP_014100459.1|  threonine aldolase                                 108   2e-24   Chloracidobacterium thermophilum
ref|XP_005854754.1|  threonine aldolase                                 107   3e-24   Nannochloropsis gaditana CCMP526
ref|XP_002973664.1|  hypothetical protein SELMODRAFT_99781              108   3e-24   
ref|XP_002975719.1|  hypothetical protein SELMODRAFT_103881             108   3e-24   
ref|WP_025229058.1|  threonine aldolase                                 108   3e-24   Fimbriimonas ginsengisoli
ref|WP_020265088.1|  hypothetical protein                               107   5e-24   
ref|WP_037564212.1|  threonine aldolase                                 107   5e-24   Alkalispirochaeta odontotermitis
ref|WP_027448368.1|  threonine aldolase                                 107   6e-24   Pontibacillus marinus
ref|WP_025322967.1|  threonine aldolase                                 107   8e-24   
ref|WP_040378796.1|  threonine aldolase                                 106   1e-23   
ref|WP_018706849.1|  hypothetical protein                               106   1e-23   Bacillus fordii
gb|EEG77367.1|  Threonine aldolase                                      106   1e-23   Dethiobacter alkaliphilus AHT 1
gb|EGU57937.1|  L-allo-threonine aldolase                               102   2e-23   Vibrio nigripulchritudo ATCC 27043
dbj|GAL27114.1|  low-specificity L-threonine aldolase                   103   2e-23   Vibrio variabilis
ref|WP_014062139.1|  threonine aldolase                                 105   2e-23   Thermoanaerobacter wiegelii
emb|CAN82414.1|  hypothetical protein VITISV_039151                     105   2e-23   Vitis vinifera
ref|WP_038146243.1|  threonine aldolase                                 102   2e-23   
ref|WP_004400281.1|  MULTISPECIES: Threonine aldolase                   105   3e-23   Thermoanaerobacter
ref|WP_026475800.1|  threonine aldolase                                 105   4e-23   Alkaliphilus transvaalensis
gb|EWM22625.1|  threonine aldolase                                      107   5e-23   Nannochloropsis gaditana
ref|WP_042470320.1|  threonine aldolase                                 104   5e-23   
ref|WP_038227001.1|  threonine aldolase                                 104   7e-23   Vibrio sp. ER1A
ref|WP_012269711.1|  MULTISPECIES: threonine aldolase                   104   8e-23   Thermoanaerobacter
gb|KIG16688.1|  Low-specificity L-threonine aldolase                    103   9e-23   Enhygromyxa salina
ref|WP_014645330.1|  threonine aldolase                                 103   1e-22   Halobacillus halophilus
ref|WP_029688227.1|  threonine aldolase                                 103   1e-22   
ref|WP_003867083.1|  MULTISPECIES: threonine aldolase                   103   1e-22   Thermoanaerobacter
ref|WP_022601443.1|  Low specificity L-threonine aldolase               103   1e-22   Vibrio nigripulchritudo
ref|WP_013296780.1|  threonine aldolase                                 103   1e-22   Thermoanaerobacterium thermosaccharolyticum
ref|XP_006605267.1|  PREDICTED: uncharacterized protein LOC102668529  99.0    2e-22   
ref|WP_003540689.1|  threonine aldolase                                 102   2e-22   Desulfotomaculum nigrificans
ref|WP_003869086.1|  threonine aldolase                                 102   2e-22   
ref|WP_039929082.1|  threonine aldolase                                 102   3e-22   Thermoanaerobacter
ref|WP_022597498.1|  Low specificity L-threonine aldolase               102   3e-22   Vibrio nigripulchritudo
ref|WP_014394185.1|  threonine aldolase                                 102   3e-22   Corallococcus coralloides
gb|EIV99346.1|  threonine aldolase                                      102   3e-22   Thermoanaerobacter siderophilus SR4
ref|WP_015310760.1|  threonine aldolase                                 102   3e-22   Thermoanaerobacterium thermosaccharolyticum
ref|WP_022561270.1|  Low specificity L-threonine aldolase               102   3e-22   Vibrio nigripulchritudo
ref|WP_022592526.1|  Low specificity L-threonine aldolase               102   4e-22   Vibrio nigripulchritudo
ref|WP_042834178.1|  threonine aldolase                                 102   4e-22   Thermoanaerobacter sp. YS13
ref|XP_008659428.1|  PREDICTED: probable low-specificity L-threon...    100   4e-22   
ref|WP_041274354.1|  threonine aldolase                                 102   5e-22   
gb|ABO48655.1|  L-threonine aldolase                                    102   5e-22   Desulfotomaculum reducens MI-1
ref|XP_006442684.1|  hypothetical protein CICLE_v10020798mg             100   8e-22   
ref|WP_013778623.1|  threonine aldolase                                 101   9e-22   Tepidanaerobacter acetatoxydans
ref|WP_013275483.1|  threonine aldolase                                 101   9e-22   Thermosediminibacter oceani
ref|WP_008074850.1|  threonine aldolase                                 100   1e-21   Vibrio sinaloensis
ref|WP_008216429.1|  threonine aldolase                                 100   1e-21   Vibrionales bacterium SWAT-3
gb|AFW86293.1|  putative threonine aldolase family protein              100   1e-21   
ref|WP_006069652.1|  threonine aldolase                                 100   2e-21   Vibrio shilonii
ref|WP_034132280.1|  threonine aldolase                                 100   2e-21   
ref|WP_011196526.1|  threonine aldolase                                 100   2e-21   Symbiobacterium thermophilum
ref|WP_018133494.1|  hypothetical protein                               100   2e-21   Effusibacillus pohliae
ref|WP_006447171.1|  threonine aldolase                                 100   2e-21   Alicyclobacillus hesperidum
ref|WP_038083758.1|  threonine aldolase                                 100   2e-21   Tumebacillus flagellatus
ref|WP_017025760.1|  threonine aldolase                                 100   2e-21   Vibrio rumoiensis
ref|WP_027695975.1|  threonine aldolase                               99.8    2e-21   Vibrio litoralis
ref|WP_027365759.1|  threonine aldolase                                 100   2e-21   Desulfallas alcoholivorax
ref|WP_038559128.1|  threonine aldolase                               99.8    2e-21   Terribacillus
ref|WP_017109562.1|  threonine aldolase                               99.8    3e-21   Vibrio
ref|WP_004740139.1|  threonine aldolase                               99.8    3e-21   Vibrio splendidus
ref|WP_017067124.1|  threonine aldolase                               99.8    3e-21   Vibrio crassostreae
tpg|DAA54991.1|  TPA: putative threonine aldolase family protein        100   4e-21   
ref|WP_044162565.1|  threonine aldolase                               99.0    4e-21   
ref|WP_022934098.1|  threonine aldolase                               99.4    4e-21   
ref|WP_015049145.1|  threonine aldolase                               99.0    5e-21   Simiduia agarivorans
gb|AIE93607.1|  Beta-eliminating lyase superfamily protein (ltaE)     99.0    5e-21   uncultured marine group II/III euryarchaeote AD1000_39_C05
ref|WP_034217358.1|  threonine aldolase                               98.6    6e-21   
ref|WP_017104708.1|  threonine aldolase                               98.6    6e-21   Vibrio
dbj|GAK82526.1|  low-specificity L-threonine aldolase                 96.3    6e-21   Vibrio ponticus
ref|WP_011551549.1|  threonine aldolase                               98.6    7e-21   Myxococcus xanthus
ref|WP_019178138.1|  hypothetical protein                             98.6    7e-21   Methanomassiliicoccus luminyensis
ref|WP_019839219.1|  threonine aldolase                               98.6    7e-21   Aeromonas sp. MDS8
ref|WP_005299873.1|  threonine aldolase                               98.6    7e-21   Aeromonas dhakensis
ref|WP_005584362.1|  L-allo-threonine aldolase                        98.6    7e-21   
ref|WP_017781663.1|  threonine aldolase                               98.6    7e-21   Aeromonas hydrophila
ref|WP_002629188.1|  Low-specificity L-threonine aldolase             98.6    7e-21   Cystobacter fuscus
ref|WP_002635500.1|  threonine aldolase                               98.6    7e-21   Myxococcus hansupus
ref|WP_017078726.1|  threonine aldolase                               98.6    7e-21   Vibrio splendidus
ref|WP_017786172.1|  threonine aldolase                               98.6    7e-21   Aeromonas hydrophila
ref|WP_010634262.1|  MULTISPECIES: L-allo-threonine aldolase          98.6    7e-21   Aeromonas
ref|WP_009793967.1|  MULTISPECIES: threonine aldolase                 98.2    9e-21   Bacillus
ref|WP_042050919.1|  L-allo-threonine aldolase                        98.2    9e-21   Aeromonas dhakensis
ref|WP_027415105.1|  threonine aldolase                               98.2    9e-21   Aneurinibacillus terranovensis
ref|WP_017765885.1|  threonine aldolase                               98.2    9e-21   Aeromonas
ref|WP_039624451.1|  threonine aldolase                               98.2    1e-20   
gb|EVU16683.1|  L-allo-threonine aldolase                             95.5    1e-20   Vibrio parahaemolyticus V-223/04
ref|WP_005472373.1|  threonine aldolase                               97.8    1e-20   
ref|XP_004151117.1|  PREDICTED: L-allo-threonine aldolase-like        97.4    1e-20   
gb|ETM34050.1|  hypothetical protein, variant                         97.1    1e-20   Phytophthora parasitica
ref|WP_017070585.1|  threonine aldolase                               97.8    1e-20   Vibrio crassostreae
ref|WP_017086880.1|  threonine aldolase                               97.8    1e-20   Vibrio splendidus
ref|WP_008412134.1|  L-allo-threonine aldolase                        97.8    1e-20   Desulfotomaculum hydrothermale
ref|WP_033406166.1|  hypothetical protein                             97.8    1e-20   
ref|WP_016566240.1|  l-allo-threonine aldolase                        97.8    1e-20   
ref|WP_017095444.1|  threonine aldolase                               97.8    1e-20   Vibrio splendidus
ref|WP_043893263.1|  threonine aldolase                               97.8    1e-20   
ref|XP_008897473.1|  hypothetical protein, variant                    96.7    1e-20   Phytophthora parasitica INRA-310
dbj|BAL53180.1|  threonine aldolase                                   97.4    2e-20   uncultured Chloroflexi bacterium
ref|WP_017058210.1|  threonine aldolase                               97.4    2e-20   Vibrio kanaloae
gb|EPJ52411.1|  hypothetical protein OFPI_14000                       97.8    2e-20   Osedax symbiont Rs2
ref|WP_017064540.1|  threonine aldolase                               97.4    2e-20   Vibrio crassostreae
ref|WP_019822304.1|  threonine aldolase                               97.4    2e-20   
gb|ETK74181.1|  hypothetical protein, variant                         96.7    2e-20   
ref|WP_042008166.1|  L-allo-threonine aldolase                        97.4    2e-20   
ref|WP_041887564.1|  threonine aldolase                               97.4    2e-20   
ref|WP_017102851.1|  threonine aldolase                               97.4    2e-20   
ref|WP_027883536.1|  threonine aldolase                               97.1    2e-20   
ref|WP_027877883.1|  threonine aldolase                               97.1    2e-20   
ref|WP_017089379.1|  threonine aldolase                               97.1    2e-20   
ref|WP_006827009.1|  threonine aldolase                               97.1    2e-20   
ref|WP_035985324.1|  threonine aldolase                               97.1    2e-20   
ref|WP_016958887.1|  threonine aldolase                               97.1    2e-20   
ref|WP_017004902.1|  threonine aldolase                               97.1    2e-20   
ref|WP_034122282.1|  threonine aldolase                               97.1    2e-20   
ref|WP_006643962.1|  threonine aldolase                               97.1    2e-20   
ref|WP_017062565.1|  threonine aldolase                               97.1    2e-20   
ref|WP_017006944.1|  threonine aldolase                               97.1    2e-20   
ref|WP_042501630.1|  threonine aldolase                               97.1    2e-20   
ref|WP_009385056.1|  threonine aldolase                               97.1    2e-20   
ref|WP_006714392.1|  threonine aldolase                               97.1    2e-20   
ref|WP_017076025.1|  threonine aldolase                               97.1    3e-20   
gb|ADU51350.1|  L-threonine aldolase                                  97.1    3e-20   
ref|WP_025640491.1|  threonine aldolase                               97.1    3e-20   
ref|WP_034131989.1|  threonine aldolase                               97.1    3e-20   
ref|WP_009845431.1|  MULTISPECIES: threonine aldolase                 96.7    3e-20   
ref|WP_017632336.1|  threonine aldolase                               96.7    3e-20   
ref|WP_006092490.1|  threonine aldolase                               96.7    3e-20   
ref|WP_043171927.1|  MULTISPECIES: L-allo-threonine aldolase          96.7    3e-20   
ref|WP_029301221.1|  L-allo-threonine aldolase                        96.7    3e-20   
gb|EPZ48130.1|  hypothetical protein N007_04560                       96.7    3e-20   
ref|WP_042071615.1|  L-allo-threonine aldolase                        96.7    3e-20   
ref|WP_004731185.1|  threonine aldolase                               96.7    3e-20   
ref|WP_000854011.1|  threonine aldolase                               96.7    3e-20   
ref|WP_031218345.1|  threonine aldolase                               96.7    3e-20   
gb|ETM34049.1|  hypothetical protein L914_18796                       96.7    3e-20   
ref|WP_038899520.1|  threonine aldolase                               96.7    3e-20   
ref|WP_024050701.1|  hypothetical protein                             96.3    4e-20   
ref|WP_038886197.1|  threonine aldolase                               96.3    4e-20   
ref|WP_044799803.1|  L-allo-threonine aldolase                        96.3    4e-20   
ref|WP_031408953.1|  threonine aldolase                               96.3    4e-20   
ref|WP_038214282.1|  threonine aldolase                               96.3    4e-20   
ref|WP_010451642.1|  threonine aldolase                               96.3    4e-20   
ref|XP_008897472.1|  hypothetical protein PPTG_05622                  96.3    4e-20   
ref|WP_014757710.1|  MULTISPECIES: threonine aldolase                 96.3    5e-20   
gb|ETK74180.1|  hypothetical protein L915_18981                       96.3    5e-20   
ref|WP_039474404.1|  threonine aldolase                               96.3    5e-20   
ref|WP_038192232.1|  threonine aldolase                               95.9    5e-20   
ref|WP_004267657.1|  threonine aldolase                               95.9    5e-20   
ref|WP_006672298.1|  threonine aldolase                               95.9    5e-20   
ref|WP_005594507.1|  threonine aldolase                               95.9    5e-20   
ref|WP_031852043.1|  threonine aldolase                               95.9    5e-20   
ref|WP_013705006.1|  threonine aldolase                               95.9    5e-20   
ref|WP_042520986.1|  threonine aldolase                               95.9    6e-20   
ref|WP_042147273.1|  threonine aldolase                               95.9    6e-20   
ref|WP_012063574.1|  threonine aldolase                               95.9    6e-20   
ref|WP_013935419.1|  threonine aldolase                               95.9    6e-20   
ref|WP_000347574.1|  threonine aldolase                               95.9    6e-20   
ref|WP_010678507.1|  threonine aldolase                               95.9    6e-20   
ref|WP_012957344.1|  threonine aldolase                               95.9    6e-20   
ref|WP_017092987.1|  threonine aldolase                               95.9    6e-20   
ref|WP_034421730.1|  threonine aldolase                               95.9    7e-20   
ref|WP_025627548.1|  threonine aldolase                               95.5    7e-20   
ref|WP_005396402.1|  low-specificity L-threonine aldolase             95.5    7e-20   
ref|WP_027888175.1|  MULTISPECIES: threonine aldolase                 95.5    7e-20   
ref|WP_038321350.1|  threonine aldolase                               95.5    7e-20   
ref|WP_013970093.1|  threonine aldolase                               95.5    7e-20   
ref|WP_013787005.1|  threonine aldolase                               95.5    7e-20   
gb|EQB62887.1|  Aromatic amino acid beta-eliminating lyase/threon...  95.5    7e-20   
ref|WP_026444574.1|  threonine aldolase                               95.5    7e-20   
ref|WP_034427809.1|  threonine aldolase                               95.5    7e-20   
ref|WP_039480221.1|  threonine aldolase                               95.5    7e-20   
ref|WP_022611326.1|  Low specificity L-threonine aldolase             95.5    7e-20   
gb|AIV07123.1|  threonine aldolase                                    95.5    8e-20   
ref|WP_043122222.1|  L-allo-threonine aldolase                        95.5    8e-20   
ref|WP_017080978.1|  threonine aldolase                               95.5    8e-20   
ref|WP_031820542.1|  threonine aldolase                               95.5    8e-20   
ref|WP_039447431.1|  threonine aldolase                               95.5    8e-20   
ref|WP_011081042.1|  threonine aldolase                               95.5    8e-20   
ref|WP_043165668.1|  L-allo-threonine aldolase                        95.5    9e-20   
gb|EKM29605.1|  low specificity L-threonine aldolase                  95.5    9e-20   
ref|WP_009705325.1|  threonine aldolase                               95.1    9e-20   
ref|WP_006904712.1|  threonine aldolase                               95.5    9e-20   
ref|WP_012129284.1|  threonine aldolase                               95.1    1e-19   
ref|WP_039015891.1|  threonine aldolase                               95.1    1e-19   
ref|WP_040992653.1|  MULTISPECIES: threonine aldolase                 95.1    1e-19   
ref|WP_039839175.1|  threonine aldolase                               95.1    1e-19   
ref|WP_038891255.1|  threonine aldolase                               95.1    1e-19   
ref|WP_025767724.1|  threonine aldolase                               95.1    1e-19   
ref|WP_010644227.1|  threonine aldolase                               95.1    1e-19   
ref|WP_042028952.1|  L-allo-threonine aldolase                        95.1    1e-19   
ref|WP_005426721.1|  threonine aldolase                               95.1    1e-19   
ref|WP_024943462.1|  L-allo-threonine aldolase                        95.1    1e-19   
ref|WP_009696116.1|  MULTISPECIES: threonine aldolase                 95.1    1e-19   
ref|WP_000347573.1|  MULTISPECIES: threonine aldolase                 95.1    1e-19   
ref|WP_029789292.1|  threonine aldolase                               95.1    1e-19   
ref|WP_039987426.1|  threonine aldolase                               95.1    1e-19   
ref|WP_004411494.1|  threonine aldolase                               95.1    1e-19   
ref|WP_005446977.1|  L-allo-threonine aldolase                        95.1    1e-19   
ref|WP_034107576.1|  threonine aldolase                               95.1    1e-19   
ref|WP_034631722.1|  threonine aldolase                               95.1    1e-19   
ref|WP_005532104.1|  L-allo-threonine aldolase                        95.1    1e-19   
ref|WP_006648299.1|  threonine aldolase                               95.1    1e-19   
ref|WP_031781926.1|  threonine aldolase                               95.1    1e-19   
ref|WP_029802664.1|  threonine aldolase                               95.1    1e-19   
ref|WP_005375978.1|  MULTISPECIES: threonine aldolase                 95.1    1e-19   
ref|WP_026456738.1|  L-allo-threonine aldolase                        95.1    1e-19   
ref|WP_025794376.1|  threonine aldolase                               95.1    1e-19   
ref|WP_025501069.1|  threonine aldolase                               95.1    1e-19   
ref|WP_017820204.1|  threonine aldolase                               95.1    1e-19   
gb|EGU19361.1|  L-allo-threonine aldolase                             94.7    1e-19   
ref|WP_025504468.1|  threonine aldolase                               94.7    1e-19   
ref|WP_029955476.1|  threonine aldolase                               93.2    1e-19   
ref|WP_005498988.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025527060.1|  threonine aldolase                               94.7    1e-19   
ref|WP_005488643.1|  threonine aldolase                               94.7    1e-19   
gb|EQL91328.1|  cys/Met metabolism PLP-dependent enzyme family pr...  94.7    1e-19   
ref|WP_025551796.1|  threonine aldolase                               94.7    1e-19   
ref|WP_008989461.1|  threonine aldolase                               94.7    1e-19   
ref|WP_029834682.1|  threonine aldolase                               94.7    1e-19   
ref|WP_029849857.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025612068.1|  threonine aldolase                               94.7    1e-19   
ref|WP_017069124.1|  threonine aldolase                               94.7    1e-19   
ref|WP_030000032.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025817565.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025442802.1|  threonine aldolase                               94.7    1e-19   
ref|WP_004513587.1|  threonine aldolase                               94.7    1e-19   
ref|WP_028784440.1|  threonine aldolase                               94.7    1e-19   
ref|WP_035698102.1|  threonine aldolase                               93.2    1e-19   
ref|WP_025629171.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025541936.1|  threonine aldolase                               94.7    1e-19   
ref|WP_005480299.1|  threonine aldolase                               94.7    1e-19   
ref|WP_031855575.1|  threonine aldolase                               94.7    1e-19   
ref|WP_025557276.1|  threonine aldolase                               94.7    1e-19   
ref|WP_020837928.1|  threonine aldolase                               94.7    1e-19   
emb|CEG01512.1|  Aromatic amino acid beta-eliminating lyase/threo...  95.1    1e-19   
ref|WP_025624099.1|  threonine aldolase                               94.7    1e-19   
ref|WP_000347575.1|  threonine aldolase                               94.7    1e-19   
ref|WP_042601515.1|  threonine aldolase                               94.7    1e-19   
ref|WP_012842205.1|  threonine aldolase                               94.7    1e-19   
ref|WP_038960521.1|  threonine aldolase                               94.7    2e-19   
ref|WP_025521722.1|  threonine aldolase                               94.7    2e-19   
ref|WP_029822955.1|  threonine aldolase                               94.7    2e-19   
ref|WP_014234157.1|  threonine aldolase                               94.7    2e-19   
ref|WP_025622487.1|  threonine aldolase                               94.4    2e-19   
ref|WP_038137262.1|  threonine aldolase                               94.4    2e-19   
ref|WP_028022675.1|  threonine aldolase                               94.4    2e-19   
ref|WP_006653265.1|  threonine aldolase                               94.4    2e-19   
ref|XP_003080829.1|  L-allo-threonine aldolase, putative (ISS)        95.1    2e-19   
gb|EMS57977.1|  L-allo-threonine aldolase                             94.4    2e-19   
ref|WP_035551533.1|  threonine aldolase                               94.4    2e-19   
ref|WP_016350428.1|  L-allo-threonine aldolase                        94.4    2e-19   
ref|WP_042033568.1|  L-allo-threonine aldolase                        94.4    2e-19   
ref|WP_043851472.1|  L-allo-threonine aldolase                        94.4    2e-19   
ref|WP_039214922.1|  L-allo-threonine aldolase                        94.4    2e-19   
ref|WP_029810303.1|  threonine aldolase                               94.4    2e-19   
ref|WP_029303300.1|  L-allo-threonine aldolase                        94.4    2e-19   
ref|WP_005337176.1|  threonine aldolase                               94.4    2e-19   
ref|WP_000347576.1|  threonine aldolase                               94.4    2e-19   
ref|WP_029710900.1|  MULTISPECIES: threonine aldolase                 92.4    2e-19   
ref|WP_023623614.1|  threonine aldolase                               94.4    2e-19   
ref|WP_017302462.1|  hypothetical protein                             94.4    2e-19   
ref|WP_043045824.1|  threonine aldolase                               94.0    2e-19   
ref|WP_017053118.1|  threonine aldolase                               94.0    2e-19   
ref|WP_025610157.1|  threonine aldolase                               94.0    2e-19   
ref|WP_006182932.1|  threonine aldolase                               94.0    2e-19   
ref|WP_025574600.1|  threonine aldolase                               94.0    2e-19   
ref|WP_025027486.1|  threonine aldolase                               94.0    2e-19   
gb|AIE92478.1|  threonine aldolase (ltaE)                             94.0    3e-19   
ref|WP_025638678.1|  threonine aldolase                               94.0    3e-19   
ref|WP_042064361.1|  L-allo-threonine aldolase                        94.0    3e-19   
ref|WP_031427810.1|  threonine aldolase                               94.0    3e-19   
ref|WP_004745655.1|  threonine aldolase                               94.0    3e-19   
ref|WP_010675015.1|  MULTISPECIES: threonine aldolase                 94.0    3e-19   
ref|WP_031847875.1|  threonine aldolase                               94.0    3e-19   
ref|WP_025625462.1|  threonine aldolase                               94.0    3e-19   
dbj|GAJ99891.1|  LOW QUALITY PROTEIN: low-specificity L-threonine...  94.0    3e-19   
ref|WP_006665336.1|  threonine aldolase                               94.0    3e-19   
ref|WP_025508963.1|  threonine aldolase                               94.0    3e-19   
ref|WP_025533837.1|  threonine aldolase                               94.0    3e-19   
ref|WP_017190808.1|  threonine aldolase                               94.0    3e-19   
ref|WP_038177305.1|  threonine aldolase                               94.0    3e-19   
ref|WP_029857109.1|  threonine aldolase                               94.0    3e-19   
ref|WP_006166339.1|  threonine aldolase                               94.0    3e-19   
ref|WP_040121495.1|  threonine aldolase                               94.0    3e-19   
ref|WP_041207448.1|  L-allo-threonine aldolase                        94.0    3e-19   
ref|WP_031849072.1|  threonine aldolase                               93.6    3e-19   
ref|WP_034429132.1|  threonine aldolase                               93.6    3e-19   
ref|WP_029839720.1|  threonine aldolase                               93.6    3e-19   
gb|KJG03116.1|  threonine aldolase                                    93.6    3e-19   
ref|WP_041868473.1|  threonine aldolase                               94.0    3e-19   
ref|WP_029831322.1|  threonine aldolase                               93.6    3e-19   
gb|EOD01392.1|  Low-specificity L-threonine aldolase                  93.6    3e-19   
ref|WP_042019111.1|  L-allo-threonine aldolase                        93.6    3e-19   
ref|WP_043555330.1|  L-allo-threonine aldolase                        93.6    3e-19   
ref|WP_043136661.1|  L-allo-threonine aldolase                        93.6    3e-19   
ref|WP_039976577.1|  threonine aldolase                               93.6    3e-19   
ref|WP_025547634.1|  threonine aldolase                               93.6    3e-19   
dbj|GAK16991.1|  low-specificity L-threonine aldolase                 93.6    3e-19   
ref|WP_017790755.1|  threonine aldolase                               93.6    4e-19   
ref|WP_022579030.1|  threonine aldolase                               93.6    4e-19   
ref|WP_040094296.1|  L-allo-threonine aldolase                        93.6    4e-19   
ref|WP_031821878.1|  threonine aldolase                               93.6    4e-19   
ref|WP_009602342.1|  threonine aldolase                               93.6    4e-19   
ref|WP_042640779.1|  L-allo-threonine aldolase                        93.6    4e-19   
ref|WP_006880883.1|  threonine aldolase                               93.6    4e-19   
ref|WP_017410193.1|  threonine aldolase                               93.6    4e-19   
ref|WP_023585093.1|  threonine aldolase                               93.6    4e-19   
ref|WP_033129146.1|  L-allo-threonine aldolase                        93.6    4e-19   
ref|WP_028777176.1|  threonine aldolase                               93.6    4e-19   
gb|KEK21307.1|  threonine aldolase                                    93.6    4e-19   
ref|WP_042057263.1|  L-allo-threonine aldolase                        93.6    4e-19   
ref|WP_016785291.1|  threonine aldolase                               93.2    4e-19   
ref|WP_013171710.1|  threonine aldolase [                             93.2    4e-19   
ref|WP_034635021.1|  threonine aldolase                               93.6    4e-19   
ref|WP_024700669.1|  threonine aldolase                               93.2    4e-19   
ref|WP_042764629.1|  threonine aldolase                               93.2    4e-19   
ref|WP_017008285.1|  threonine aldolase                               93.2    4e-19   
ref|WP_021821732.1|  cys/Met metabolism PLP-dependent enzyme fami...  93.2    5e-19   
ref|WP_017013973.1|  threonine aldolase                               93.2    5e-19   
ref|WP_032088129.1|  threonine aldolase                               93.2    5e-19   
ref|WP_025535532.1|  threonine aldolase                               93.2    5e-19   
ref|WP_016768093.1|  threonine aldolase                               93.2    5e-19   



>ref|XP_009798339.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798340.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798341.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798342.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798343.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=359

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+I+RKTLGGGMRQ+GVLCAAA + FQEN+ KLEGDHKKAK LAE LNKI GL+
Sbjct  221  KSFIAKAKILRKTLGGGMRQVGVLCAAAFIAFQENLVKLEGDHKKAKILAEELNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E E+CK L +HG+LILPEGP+RIRFVIHHQIS+ DV Y
Sbjct  281  VDIAAVETNIVYCDILKGSKISETEMCKTLEQHGLLILPEGPQRIRFVIHHQISENDVHY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            A S VQRA+ GVA  +GD
Sbjct  341  AASCVQRALAGVAEENGD  358



>ref|XP_009631531.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631532.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631533.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+I+RKTLGGGMRQ+GVLCAAA +GFQEN+ KLEGDHKKAK LAE LNKI GL+
Sbjct  221  KSFIAKAKILRKTLGGGMRQVGVLCAAAFIGFQENLVKLEGDHKKAKILAEELNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E E+CK L +HG+LILPEG  RIRFVIHHQIS+ DV Y
Sbjct  281  VDIAAVETNIVYCDILKGSKISETEMCKILEQHGLLILPEGLMRIRFVIHHQISENDVHY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            A+S VQRA+ GVA  +GD
Sbjct  341  AVSCVQRALAGVAEENGD  358



>emb|CDO99988.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI RARI+RKTLGGGMRQ+GVLCAAAL+  QENVGKLEGDHKKAKTLA GLNKI GL 
Sbjct  202  ETFIARARILRKTLGGGMRQVGVLCAAALIALQENVGKLEGDHKKAKTLAVGLNKIKGLN  261

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ SVETNIV+CDILK  N TE +LCK L  HG+LILPEGP RIR V+HHQIS++DV Y
Sbjct  262  VDIDSVETNIVYCDILKSVNITETKLCKILEGHGILILPEGPFRIRMVLHHQISESDVHY  321

Query  283  ALSRVQRAVTGV  248
             LS +Q+AV GV
Sbjct  322  TLSCMQQAVNGV  333



>ref|XP_006361420.1| PREDICTED: uncharacterized protein R102.4 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361421.1| PREDICTED: uncharacterized protein R102.4 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361422.1| PREDICTED: uncharacterized protein R102.4 isoform X3 [Solanum 
tuberosum]
Length=361

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RA+I+RKTLGGGMRQIGVLCAAA    QEN+ KLEGDH+KAK+LA  LNKI GL+
Sbjct  223  KSFIARAKILRKTLGGGMRQIGVLCAAAFTALQENLVKLEGDHRKAKSLAAELNKIKGLK  282

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV Y
Sbjct  283  VDVATVETNIVYCDILKGSRISETELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHY  342

Query  283  ALSRVQRAVTGVANGSGD  230
            A+S +QRA+ GVA  +GD
Sbjct  343  AVSCLQRALAGVAEENGD  360



>ref|NP_001275261.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
 ref|XP_006361424.1| PREDICTED: uncharacterized protein R102.4 isoform X5 [Solanum 
tuberosum]
 ref|XP_006361425.1| PREDICTED: uncharacterized protein R102.4 isoform X6 [Solanum 
tuberosum]
 gb|ABB72802.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
Length=359

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RA+I+RKTLGGGMRQIGVLCAAA    QEN+ KLEGDH+KAK+LA  LNKI GL+
Sbjct  221  KSFIARAKILRKTLGGGMRQIGVLCAAAFTALQENLVKLEGDHRKAKSLAAELNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV Y
Sbjct  281  VDVATVETNIVYCDILKGSRISETELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            A+S +QRA+ GVA  +GD
Sbjct  341  AVSCLQRALAGVAEENGD  358



>ref|XP_004236787.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236788.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236789.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
Length=359

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RA+I+RKTLGGGMRQIGVLCAAA    QEN+ KLEGDH+KAK LA  LNKI GL+
Sbjct  221  KSFIARAKILRKTLGGGMRQIGVLCAAAFTALQENLVKLEGDHRKAKILAAELNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV Y
Sbjct  281  VDVATVETNIVYCDILKGSRISEAELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            A+S +QRA+ GVA  +GD
Sbjct  341  AVSCIQRALAGVAEENGD  358



>ref|XP_010319280.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319281.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319282.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RA+I+RKTLGGGMRQIGVLCAAA    QEN+ KLEGDH+KAK LA  LNKI GL+
Sbjct  223  KSFIARAKILRKTLGGGMRQIGVLCAAAFTALQENLVKLEGDHRKAKILAAELNKIKGLK  282

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNIV+CDILK +  +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV Y
Sbjct  283  VDVATVETNIVYCDILKGSRISEAELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHY  342

Query  283  ALSRVQRAVTGVANGSGD  230
            A+S +QRA+ GVA  +GD
Sbjct  343  AVSCIQRALAGVAEENGD  360



>ref|XP_009795458.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RA+I+RKTLGGGMRQIGVLCAAA V  QEN+ KLEGDH+KAK LAE LNKI GL+
Sbjct  221  KSFIARAKILRKTLGGGMRQIGVLCAAASVALQENLVKLEGDHRKAKLLAEELNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD A+VETNIV+C ILK +  +   LCK L +HG+L+LPEGP RIRFVIHHQIS++DV Y
Sbjct  281  VDSAAVETNIVYCHILKGSKVSRTHLCKILEQHGILVLPEGPMRIRFVIHHQISESDVHY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             +S +Q+ + G A  +GD
Sbjct  341  TVSCLQQTLAGEAEENGD  358



>emb|CBI22386.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G++CAAALV  QEN+ KLEGDHKKAK LAEGLN+I GL+
Sbjct  202  KSFIAKARRLRKTLGGGMRQVGIICAAALVALQENIAKLEGDHKKAKILAEGLNQIKGLK  261

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ SVETNIV+ +I++ +N T  +LCK L EHGVL++PE   RIR V+HHQIS TDVQY
Sbjct  262  VNVTSVETNIVYFEIVEGSNITAEKLCKYLQEHGVLMMPESSSRIRVVLHHQISGTDVQY  321

Query  283  ALSRVQRAVTGVANGSGD  230
             LS +Q+AVTGV + +GD
Sbjct  322  TLSCIQQAVTGVHDCNGD  339



>ref|XP_002266992.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633695.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633696.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_010660226.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
Length=364

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G++CAAALV  QEN+ KLEGDHKKAK LAEGLN+I GL+
Sbjct  221  KSFIAKARRLRKTLGGGMRQVGIICAAALVALQENIAKLEGDHKKAKILAEGLNQIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ SVETNIV+ +I++ +N T  +LCK L EHGVL++PE   RIR V+HHQIS TDVQY
Sbjct  281  VNVTSVETNIVYFEIVEGSNITAEKLCKYLQEHGVLMMPESSSRIRVVLHHQISGTDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS +Q+AVTGV + +GD
Sbjct  341  TLSCIQQAVTGVHDCNGD  358



>ref|XP_007030420.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030421.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10922.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10923.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
Length=358

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+V+TNI++ DI++ +  T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY
Sbjct  281  VDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+A+TGV   +G+
Sbjct  341  TLSCFQQALTGVQEENGN  358



>ref|XP_011101617.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
 ref|XP_011101618.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
Length=359

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+I+RKTLGG MRQ+GV+CAAALV   ENVGKLE DHKKAK L+EGLNKI GL+
Sbjct  221  KSFISKAKILRKTLGGAMRQVGVICAAALVALGENVGKLESDHKKAKILSEGLNKIEGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++ASVETNIV+ DIL+E   TE+EL K+L  HG+L++ EG  +IR VIHHQIS+ DVQY
Sbjct  281  INLASVETNIVYFDILEEVGITEIELVKKLEAHGILVMAEGRLKIRLVIHHQISEYDVQY  340

Query  283  ALSRVQRAVTGVANGSG  233
             LS +Q+AVTG+   +G
Sbjct  341  TLSCIQKAVTGMKAENG  357



>ref|XP_007030422.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY10924.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
Length=355

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+V+TNI++ DI++ +  T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY
Sbjct  281  VDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQY  340

Query  283  ALSRVQRAVTGV  248
             LS  Q+A+TGV
Sbjct  341  TLSCFQQALTGV  352



>ref|XP_002521974.1| l-allo-threonine aldolase, putative [Ricinus communis]
 gb|EEF40378.1| l-allo-threonine aldolase, putative [Ricinus communis]
Length=358

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR++RKTLGGGMRQ+G+LCAAALV  QEN GKLE DHKK K LAEGLN+I GL 
Sbjct  221  ESFIAKARVLRKTLGGGMRQVGILCAAALVAVQENAGKLENDHKKTKALAEGLNQIKGLS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ DI++ +  T  +LCK L +HGVL++ EGP  IR V+HHQIS +DVQY
Sbjct  281  VDVATVETNIIYLDIIEGSKFTAEKLCKYLEKHGVLVMKEGPFSIRIVLHHQISASDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+A+TGV   +G+
Sbjct  341  TLSIFQQALTGVQEENGN  358



>gb|KCW61508.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=362

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR +RKTLGGGMRQ+G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL 
Sbjct  225  ESFITKARRLRKTLGGGMRQVGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLA  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++ASVETNI++ DI + +N T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV Y
Sbjct  285  LNVASVETNIIYFDINEGSNMTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHY  344

Query  283  ALSRVQRAVTGVANGSG  233
            ALS  QR + G  + +G
Sbjct  345  ALSCFQRIMMGTPSENG  361



>ref|XP_010024956.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024958.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024959.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024960.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024961.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024962.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024963.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 gb|KCW61509.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
 gb|KCW61510.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=358

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR +RKTLGGGMRQ+G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL 
Sbjct  221  ESFITKARRLRKTLGGGMRQVGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLA  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++ASVETNI++ DI + +N T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV Y
Sbjct  281  LNVASVETNIIYFDINEGSNMTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHY  340

Query  283  ALSRVQRAVTGVANGSG  233
            ALS  QR + G  + +G
Sbjct  341  ALSCFQRIMMGTPSENG  357



>ref|XP_007030424.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
 gb|EOY10926.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
Length=357

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+V+TNI++ DI++ +  T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY
Sbjct  281  VDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQY  340

Query  283  ALSRVQ  266
             LS  Q
Sbjct  341  TLSCFQ  346



>ref|XP_004494746.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
 ref|XP_004494747.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=358

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             SFI +AR +RKTLGGGMRQ+GVLCAAALV  QENVGKLE DHK A+  A+GLNKI GL+
Sbjct  221  NSFITKARRLRKTLGGGMRQVGVLCAAALVALQENVGKLESDHKNARFFADGLNKIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETN+VF +I + + TT  ++CK L ++G+L+LP G  R+R V HHQIS++DV+Y
Sbjct  281  VDISSVETNMVFIEIEESSGTTAAKICKDLEDYGILLLPIGSSRLRVVFHHQISNSDVKY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            ALS  Q+AV+G  N +G+
Sbjct  341  ALSCFQQAVSGGLNENGN  358



>ref|XP_002325334.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE99715.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=359

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +ARI+RKTLGGGMRQ+GVLCAAALV   E V KLE DHKK K LAEGLN+I GL 
Sbjct  221  KSFIAKARILRKTLGGGMRQVGVLCAAALVALHETVLKLEDDHKKTKMLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++A+VETNI+F D+++ A  T  +LCK L +HG+L++ E P RIR V+HHQIS++DVQY
Sbjct  281  LNVAAVETNIIFFDVVEGAKITAEKLCKNLEQHGILVMQESPVRIRVVLHHQISESDVQY  340

Query  283  ALSRVQRAVTG  251
            ALS  ++A+TG
Sbjct  341  ALSCFKQALTG  351



>ref|XP_011036295.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036297.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036298.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036299.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
Length=359

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +ARI+RKTLGGGMRQ+G+LCAA LV   ENV KLE DHKKAK LAEGLN+I GL 
Sbjct  221  KSFIAKARILRKTLGGGMRQVGILCAADLVALHENVLKLEDDHKKAKMLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++A+VETNI+F DI++ A  T  +LCK L  HG+L++ E P RIR V+HHQIS++DVQY
Sbjct  281  LNVAAVETNIIFFDIVEGAKITAEKLCKNLEHHGILVMQESPVRIRVVLHHQISESDVQY  340

Query  283  ALSRVQRAVTG  251
            ALS  ++A++G
Sbjct  341  ALSCFKQALSG  351



>gb|AFK43649.1| unknown [Lotus japonicus]
Length=358

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             SFI +AR +RKTLGGGMRQ+G+LCAAALV  Q+ VG+LE DHKKA+TLA+GLN+I GL 
Sbjct  221  SSFIAKARRLRKTLGGGMRQVGILCAAALVALQDIVGELESDHKKARTLADGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETNIV+ +I + + TT  +L K L  +GVL++P G  +IR V HHQISD+DVQY
Sbjct  281  VDTSSVETNIVYIEIKEGSGTTAAKLSKDLENYGVLLMPLGSSKIRVVFHHQISDSDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            ALS  Q+AV GV N +G+
Sbjct  341  ALSCFQQAVNGVGNENGN  358



>gb|EYU19887.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19888.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19889.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19890.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
Length=359

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+I+RKTLGGGMRQ+GV+CAAALV  +ENV KLE DHKKAKTLAEG+N I GL 
Sbjct  221  RDFIYKAKILRKTLGGGMRQVGVICAAALVALEENVAKLETDHKKAKTLAEGVNNIKGLN  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETNIV+ DI +    TE +L K L  HG+  + EGP +IR VIHHQIS+TDVQY
Sbjct  281  VDLASVETNIVYFDIQESLGITEGKLLKNLEAHGIFAMSEGPLKIRLVIHHQISETDVQY  340

Query  283  ALSRVQRAVTGVANGSG  233
             +S +Q+ V G+   +G
Sbjct  341  TVSCIQKIVGGLVGENG  357



>gb|KCW61511.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=365

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR +RKTLGGGMRQ+G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL 
Sbjct  221  ESFITKARRLRKTLGGGMRQVGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLA  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++ASVETNI++ DI + +N T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV Y
Sbjct  281  LNVASVETNIIYFDINEGSNMTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHY  340

Query  283  ALSRVQ  266
            ALS  Q
Sbjct  341  ALSCFQ  346



>ref|XP_003521772.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
 gb|KHN31499.1| L-allo-threonine aldolase [Glycine soja]
Length=358

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             +FI +AR +RKTLGGGMRQ+G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL 
Sbjct  221  NNFITKARRLRKTLGGGMRQVGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETNI++ ++ + +  T  +LCK L ++G+L++P G  R+R V HHQIS +DVQY
Sbjct  281  VDISSVETNIIYVEVEEGSRATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            ALS  Q+AV GV N +G+
Sbjct  341  ALSCFQQAVNGVRNENGN  358



>gb|KDP23711.1| hypothetical protein JCGZ_23544 [Jatropha curcas]
Length=354

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI ++RI+RKTLGGGMRQ+G+LCAA LV  QENVGKLE DHKKAKT+AEGL++   L 
Sbjct  217  KSFIAKSRILRKTLGGGMRQVGMLCAAGLVAVQENVGKLEDDHKKAKTIAEGLHQFKELR  276

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD A+VETNI++ D+++ +  T  +LCK L +HGVL++ EGP   R V+HHQIS +DVQY
Sbjct  277  VDAAAVETNIIYVDVVESSKFTAEKLCKSLEQHGVLVMLEGPFSFRIVLHHQISASDVQY  336

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+ +TGV   +G+
Sbjct  337  TLSCFQQILTGVQAENGN  354



>gb|KJB82283.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
 gb|KJB82284.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
Length=358

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFISKARRLRKTLGGGMRQLGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI+F DI++ +  T  +L K+L EHGVL++ EGP R+R V+HHQIS +DV Y
Sbjct  281  VNVAAVETNIIFFDIVEGSKITAEKLYKKLEEHGVLVMLEGPLRMRIVLHHQISSSDVLY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+A+ GV   +G+
Sbjct  341  TLSCFQQALIGVQVENGN  358



>ref|XP_002319106.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE95029.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=356

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 106/132 (80%), Gaps = 3/132 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSF+ +ARI+RKTLGGGMRQ+GVLCAAALVG QENV KLE DHKKAK LAEGLN+I GL 
Sbjct  221  KSFVAKARILRKTLGGGMRQVGVLCAAALVGVQENVSKLEDDHKKAKMLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ D+++ A     +LCK L +HG+LI+ E P  IR  +HHQIS +DVQY
Sbjct  281  VNVAAVETNIIYIDVVEGAAE---KLCKNLEQHGILIMQESPISIRVALHHQISASDVQY  337

Query  283  ALSRVQRAVTGV  248
             LS  ++A+TGV
Sbjct  338  TLSCFKQALTGV  349



>gb|KJB44860.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=370

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ DI++ +  T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y
Sbjct  281  VDIAAVETNIIYVDIVEGSKITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHY  340

Query  283  ALSRVQRAVTGVANGSGDH  227
             LS  Q+A +G+   +G +
Sbjct  341  TLSCFQQAFSGMHQENGSY  359



>gb|KJB44862.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=413

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+
Sbjct  264  KSFITKARRLRKTLGGGMRQVGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLK  323

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ DI++ +  T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y
Sbjct  324  VDIAAVETNIIYVDIVEGSKITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHY  383

Query  283  ALSRVQRAVTGVANGSGDH  227
             LS  Q+A +G+   +G +
Sbjct  384  TLSCFQQAFSGMHQENGSY  402



>gb|KJB44861.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=417

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+
Sbjct  268  KSFITKARRLRKTLGGGMRQVGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLK  327

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ DI++ +  T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y
Sbjct  328  VDIAAVETNIIYVDIVEGSKITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHY  387

Query  283  ALSRVQRAVTGVANGSGDH  227
             LS  Q+A +G+   +G +
Sbjct  388  TLSCFQQAFSGMHQENGSY  406



>ref|XP_011038517.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 1 [Populus euphratica]
Length=356

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSF+ +ARI+RKTLGGGMRQ+GVLCAAALV  QENV KLE DHKKAK LAEGLN+I GL 
Sbjct  221  KSFVAKARILRKTLGGGMRQVGVLCAAALVAVQENVSKLEDDHKKAKMLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VET I++ D+++ A     +LCK L +HG+LI+ E P  IR V+HHQIS +DVQY
Sbjct  281  VNVAAVETKIIYIDVVEGAAE---KLCKNLEQHGILIMQESPISIRVVLHHQISTSDVQY  337

Query  283  ALSRVQRAVTG  251
             LS  Q+A+TG
Sbjct  338  TLSCFQQALTG  348



>ref|XP_007147215.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 ref|XP_007147216.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19209.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19210.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
Length=362

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             SFI +AR +RKTLGGGMRQ+G+LCAAALV  QENV KLE DHKKAK LA+GLN+I GL 
Sbjct  221  NSFISKARRLRKTLGGGMRQVGILCAAALVALQENVEKLESDHKKAKLLADGLNEIKGLS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN++F ++ +   TT  +LCK L ++G+L++  G  R+R V HHQIS +DVQY
Sbjct  281  VDTSSVETNMMFVEVEEGLGTTASKLCKDLEDYGILLMAIGSSRLRIVFHHQISASDVQY  340

Query  283  ALSRVQRAVTGVAN  242
            ALS  Q+AV GV N
Sbjct  341  ALSCFQQAVNGVRN  354



>gb|KEH24599.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=358

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             SFI +AR +RKTLGGGMRQ+G+LCAAALV   ENV KLE DHK A+ LA+GLN+I GL 
Sbjct  221  NSFITKARRLRKTLGGGMRQVGILCAAALVALHENVEKLESDHKNARFLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETNI++ +I + + TT  +L K L E+G+LI+P G  R+R V HHQISD+DV+Y
Sbjct  281  VDTSSVETNIIYIEIEENSGTTAAKLSKDLEEYGILIMPMGTSRLRVVFHHQISDSDVRY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  +RAV G  N +G+
Sbjct  341  TLSCFERAVAGEPNENGN  358



>gb|AFK40044.1| unknown [Medicago truncatula]
Length=358

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             SFI +AR +RKTLGGGMRQ+G+LCAAALV   ENV KLE DHK A+ LA+GLN+I GL 
Sbjct  221  NSFITKARRLRKTLGGGMRQVGILCAAALVALHENVEKLESDHKNARFLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETNI++ +I + + TT  +L K L E+G+LI+P G  R+R V HHQISD+DV+Y
Sbjct  281  VDTSSVETNIIYIEIEENSGTTAAKLSKDLEEYGILIMPMGTSRLRVVFHHQISDSDVRY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  +RAV G  N +G+
Sbjct  341  TLSCFERAVAGEPNENGN  358



>ref|XP_006577318.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=357

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             +FI +AR +RKTLGGGMRQ+G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL 
Sbjct  221  NNFITKARRLRKTLGGGMRQVGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETNI++ ++ + +  T  +LCK L ++G+L++P G  R+R V HHQIS +DVQY
Sbjct  281  VDISSVETNIIYVEVEEGSRATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
            ALS  Q AV GV N +G+
Sbjct  341  ALSCFQ-AVNGVRNENGN  357



>ref|XP_010102233.1| L-allo-threonine aldolase [Morus notabilis]
 gb|EXB93176.1| L-allo-threonine aldolase [Morus notabilis]
Length=358

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR +RKTLGGGMRQ+GVLCAAA V  QENVGKLE DHK AK LA+GL+KI GL 
Sbjct  221  ESFIKKARRLRKTLGGGMRQVGVLCAAAFVAVQENVGKLEADHKNAKFLADGLHKIKGLF  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETNI+F DI + +  T  +LCK L EHG++++ E   RIR V+HHQIS  DV++
Sbjct  281  VDVASVETNIIFIDIEEGSKMTAEKLCKNLEEHGIVVMKESSSRIRIVLHHQISYDDVKF  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q A+ GV+  +G+
Sbjct  341  TLSCFQNALNGVSVENGN  358



>gb|KJB46043.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
 gb|KJB46044.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=358

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI +AR +RKTLGGGMRQ+GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL 
Sbjct  221  ETFITKARRLRKTLGGGMRQVGVICAAALVALQENLIKLEGDHKNAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI+F DI++ +  +  +L K L E GV +L EGP R+R V+HHQIS +DVQY
Sbjct  281  VNVAAVETNIIFFDIVEGSKISGEKLYKHLVERGVFVLLEGPSRMRIVLHHQISSSDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+A +G+   +G+
Sbjct  341  TLSCFQQAFSGLQEENGN  358



>gb|KHG25609.1| L-allo-threonine aldolase [Gossypium arboreum]
Length=358

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI +AR +RKTLGGGMRQ+GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL 
Sbjct  221  ETFITKARRLRKTLGGGMRQVGVICAAALVALQENLVKLEGDHKNAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI+F DI++ +  +  +L K L E GV ++ EGP R+R V+HHQIS +DVQY
Sbjct  281  VNVAAVETNIIFFDIVEGSKISGEKLYKHLVERGVFVMLEGPSRMRIVLHHQISSSDVQY  340

Query  283  ALSRVQRAVTGVANGSGD  230
             LS  Q+A +G+   +G+
Sbjct  341  TLSCFQQAFSGLQEENGN  358



>ref|XP_009364444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364445.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364446.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
Length=359

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR ++KTLGGGMRQ+G+LCAAALVG   NV KLE DHK+AK LAEGLN+I GL 
Sbjct  221  KSFITKARRLKKTLGGGMRQVGILCAAALVGLHNNVAKLETDHKRAKILAEGLNQIKGLS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETNI++  + + +N T  +L K L EHG+L++ E    IR VIHHQIS +DVQY
Sbjct  281  VDVASVETNILYIHVEEGSNVTTEKLVKNLEEHGILMMQESSSSIRIVIHHQISASDVQY  340

Query  283  ALSRVQRAVTG  251
             LS  Q+A+TG
Sbjct  341  TLSCFQKALTG  351



>ref|XP_008218319.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218320.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218321.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218322.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218323.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
Length=359

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G+LCAAALV   ENV KLE DHK+AK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGILCAAALVALHENVAKLETDHKRAKILAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ +VETNIV+  +++ +N +  +L K L EHG+L++ E    IR V+HHQIS +DVQY
Sbjct  281  VDIDTVETNIVYIHVVEGSNISAEKLLKNLEEHGILMMRESSSSIRIVLHHQISASDVQY  340

Query  283  ALSRVQRAVTG  251
             LS  QRAVTG
Sbjct  341  TLSCFQRAVTG  351



>gb|KHN04944.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL 
Sbjct  221  KNFIAKARRLRKTLGGGMRQIGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VDACSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  340

Query  283  ALSRVQRAVT--GVANGSGD  230
            ALS  Q+AV   GV N  G+
Sbjct  341  ALSCFQQAVAVKGVQNEMGN  360



>ref|XP_008388714.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388715.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388716.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
Length=359

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR ++KTLGGGMRQ+G+LCAAALVG  +NV KLE DHK+AK LAEGLN+I GL 
Sbjct  221  KSFIAKARRLKKTLGGGMRQVGILCAAALVGLHDNVAKLETDHKRAKILAEGLNQIKGLS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETNI++  + + +N T  +L K L EHGVL++ E    IR VIHHQIS +DVQY
Sbjct  281  VDVASVETNILYIHVEEGSNVTTEKLVKNLEEHGVLMMQESSSSIRIVIHHQISASDVQY  340

Query  283  ALSRVQRAVTG  251
             LS  Q+A+ G
Sbjct  341  TLSCFQKALXG  351



>ref|XP_008388713.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Malus domestica]
Length=371

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR ++KTLGGGMRQ+G+LCAAALVG  +NV KLE DHK+AK LAEGLN+I GL 
Sbjct  233  KSFIAKARRLKKTLGGGMRQVGILCAAALVGLHDNVAKLETDHKRAKILAEGLNQIKGLS  292

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETNI++  + + +N T  +L K L EHGVL++ E    IR VIHHQIS +DVQY
Sbjct  293  VDVASVETNILYIHVEEGSNVTTEKLVKNLEEHGVLMMQESSSSIRIVIHHQISASDVQY  352

Query  283  ALSRVQRAVTG  251
             LS  Q+A+ G
Sbjct  353  TLSCFQKALXG  363



>gb|KDO44520.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
 gb|KDO44521.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
Length=174

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGL  467
            K FI +AR +RKTLGGGMRQ+GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL
Sbjct  36   KEFIKKARRLRKTLGGGMRQVGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGL  95

Query  466  EVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQ  287
             VD+ +VETNIV+ +I +++      L K+L EHGVL++PE   R+R V+HHQIS  DV 
Sbjct  96   RVDVDAVETNIVYFEITEDSKLYAACLLKKLEEHGVLVMPESSTRVRIVVHHQISANDVH  155

Query  286  YALSRVQRAVTGVANGSGD  230
            Y LS  Q+   GV   +G+
Sbjct  156  YTLSCFQKIYAGVCEENGN  174



>ref|XP_010262337.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+ +RKTLGGGMRQ+G+LCAAA V   ENVGKLE DHKK K LA+G+N+I  L 
Sbjct  204  KSFIAKAKRLRKTLGGGMRQVGILCAAAYVALHENVGKLEDDHKKTKILADGINQIKELS  263

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +DM+S+ETNI+F DIL+ +N T  +L + L +HG+L++P     IR V+HHQIS+ DVQY
Sbjct  264  IDMSSIETNIIFFDILEGSNVTVEKLVQFLEKHGILVMPASSSSIRLVLHHQISECDVQY  323

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  324  TLSCIQQAV  332



>ref|XP_004170828.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=359

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI++AR +RKTLGGGMRQ+G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+
Sbjct  221  RAFINKARRLRKTLGGGMRQVGILCAAALVAIQENIVKLEGDHENAKILADGLNKIKGLQ  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   +ETNI+F DI + +  T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY
Sbjct  281  VESHLIETNIIFVDIKEGSTITGDKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQY  340

Query  283  ALSRVQRAVTG-VANGSG  233
             LS  Q+A+ G + N +G
Sbjct  341  TLSCFQQAMAGAITNENG  358



>ref|XP_010262335.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262336.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+ +RKTLGGGMRQ+G+LCAAA V   ENVGKLE DHKK K LA+G+N+I  L 
Sbjct  221  KSFIAKAKRLRKTLGGGMRQVGILCAAAYVALHENVGKLEDDHKKTKILADGINQIKELS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +DM+S+ETNI+F DIL+ +N T  +L + L +HG+L++P     IR V+HHQIS+ DVQY
Sbjct  281  IDMSSIETNIIFFDILEGSNVTVEKLVQFLEKHGILVMPASSSSIRLVLHHQISECDVQY  340

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  341  TLSCIQQAV  349



>ref|XP_008456444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=358

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI++AR +RKTLGGGMRQ+G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+
Sbjct  221  RAFINKARRLRKTLGGGMRQVGILCAAALVAIQENIVKLEGDHENAKFLADGLNKIKGLQ  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   +ETNI+F DI K++  T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY
Sbjct  281  VESHLIETNIIFVDI-KDSTITGEKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQY  339

Query  283  ALSRVQRAVTG-VANGSG  233
             LS  Q+A+ G + N +G
Sbjct  340  TLSCFQQAMAGAITNENG  357



>ref|XP_010694951.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694952.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
Length=371

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+ +RKTLGGGMRQIG+LCAAALV  Q+NV KLE DHK AK LA+GLN+I+GL+
Sbjct  233  KSFITKAKNLRKTLGGGMRQIGILCAAALVALQDNVRKLEDDHKNAKLLADGLNQITGLK  292

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETNI++  + + +NTT  +L K L E+G+L++ E   R R VIHHQI+ +DVQ 
Sbjct  293  VDNSSVETNIIYVRVCENSNTTAPKLSKSLEENGILVMLENTFRFRVVIHHQITTSDVQR  352

Query  283  ALSRVQRAVTGVAN  242
            ALS +Q+AVTG ++
Sbjct  353  ALSCIQQAVTGASS  366



>ref|XP_004139254.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
 gb|KGN60769.1| hypothetical protein Csa_2G009560 [Cucumis sativus]
Length=359

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI++AR +RKTLGGGMRQ+G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+
Sbjct  221  RAFINKARRLRKTLGGGMRQVGILCAAALVAIQENIVKLEGDHENAKILADGLNKIKGLQ  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   +ETNI+F DI + +  T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY
Sbjct  281  VESHLIETNIIFVDIKEGSIITGDKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQY  340

Query  283  ALSRVQRAVTG-VANGSG  233
             LS  Q+A+ G + N +G
Sbjct  341  TLSCFQQAMAGAITNENG  358



>ref|XP_006577317.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=368

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
             +FI +AR +RKTLGGGMRQ+G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL 
Sbjct  221  NNFITKARRLRKTLGGGMRQVGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETNI++ ++ + +  T  +LCK L ++G+L++P G  R+R V HHQIS +DVQY
Sbjct  281  VDISSVETNIIYVEVEEGSRATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQY  340

Query  283  ALSRVQR  263
            ALS  Q+
Sbjct  341  ALSCFQK  347



>ref|XP_003556456.2| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
Length=421

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL 
Sbjct  282  KNFIAKARRLRKTLGGGMRQIGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLR  341

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  342  VDACSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  401

Query  283  ALSRVQRAV  257
            ALS  Q+AV
Sbjct  402  ALSCFQQAV  410



>ref|XP_011465993.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465994.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465995.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI +AR +RKTLGGGMRQ+G+LCAAALV  QENV KLEGDHKKAKTLAEGLN+I G+ 
Sbjct  221  ESFISKARRLRKTLGGGMRQVGILCAAALVALQENVAKLEGDHKKAKTLAEGLNRIKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD   VETNI++  + + +  +  +L K+L ++G+L + E    IR V+HHQIS++DVQY
Sbjct  281  VDTEMVETNILYVHVDEGSTISAEKLYKKLEDYGILAMKESSSSIRIVLHHQISESDVQY  340

Query  283  ALSRVQRAVTGVANGSGDH  227
             LS  Q+A+TG    +G +
Sbjct  341  TLSCFQKALTGAPEENGHY  359



>gb|KJB46045.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=388

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI +AR +RKTLGGGMRQ+GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL 
Sbjct  221  ETFITKARRLRKTLGGGMRQVGVICAAALVALQENLIKLEGDHKNAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI+F DI++ +  +  +L K L E GV +L EGP R+R V+HHQIS +DVQY
Sbjct  281  VNVAAVETNIIFFDIVEGSKISGEKLYKHLVERGVFVLLEGPSRMRIVLHHQISSSDVQY  340

Query  283  ALSRVQRAVTGVANGSGDH*N*GNCYLCFKIFYLVK------KCNIPVDLQFIFIFK  131
             LS  Q  +                +L F++F  +K           V +Q+  +F+
Sbjct  341  TLSCFQVII--------------RAFLLFRLFIFIKTLISDSSSYTSVGIQWCMLFR  383



>ref|XP_006417664.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
 gb|ESQ36017.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
Length=358

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQLKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETN++F D+   +  T  +L K L E+G+L++P    RIR VIHHQI+ +DV Y
Sbjct  281  VDVAAVETNMIFMDMEDGSRLTAEKLSKSLTEYGILVIPANSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS VQ+AV
Sbjct  341  TLSCVQQAV  349



>ref|XP_007205422.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 ref|XP_007205423.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06621.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06622.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
Length=359

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G+LCAAALV   ENV KLE DHK+AK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGILCAAALVALHENVAKLETDHKRAKILAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ +VETNI++  +++ +N +  +L   L EHG+L++ E    +R V+HHQIS +DVQY
Sbjct  281  VDIDTVETNIIYIHVVEGSNISAEKLLMNLEEHGILMMRESSSSVRIVLHHQISASDVQY  340

Query  283  ALSRVQRAVTG  251
             LS  QRA+TG
Sbjct  341  TLSCFQRALTG  351



>emb|CDX93548.1| BnaA06g05000D [Brassica napus]
Length=358

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLNK+ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNKMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A++ETN++F D+   +  T  +L K L EHG+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAMETNMIFMDMEDGSRLTAEKLRKSLTEHGILVIPESSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  341  TLSCLQQAV  349



>ref|XP_009148115.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148116.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148118.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLNK+ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A++ETN++F D+   +  T  +L K L EHG+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAMETNMIFMDMEDGSRLTAEKLRKSLTEHGILVIPESSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  341  TLSCLQQAV  349



>ref|XP_006606453.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Glycine 
max]
Length=380

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL 
Sbjct  221  KNFIAKARRLRKTLGGGMRQIGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VDACSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  340

Query  283  ALSRVQRAVT  254
            ALS  Q  +T
Sbjct  341  ALSCFQVMLT  350



>ref|XP_006606452.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=390

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL 
Sbjct  231  KNFIAKARRLRKTLGGGMRQIGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLR  290

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  291  VDACSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  350

Query  283  ALSRVQRAVT  254
            ALS  Q  +T
Sbjct  351  ALSCFQVMLT  360



>ref|XP_010246795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nelumbo 
nucifera]
Length=358

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +A+ +RKTLGGGMRQIG+LCAAA V   ENVGKLEGDHKKAK LAEGLN+I  L 
Sbjct  221  KSFIAKAKRLRKTLGGGMRQIGILCAAAYVALHENVGKLEGDHKKAKVLAEGLNQIKELR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETNI+F  +L+ +     +L + L +HG+L++P     IR V+HHQIS++DVQY
Sbjct  281  VDVSSVETNIIFFHVLEGSEVIVEKLTQFLEKHGILVMPVSSSGIRLVLHHQISESDVQY  340

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  341  TLSCIQQAV  349



>emb|CDX95045.1| BnaC05g06260D [Brassica napus]
Length=358

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLNK+ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A++ETN++F D+   +  T  +L K L EHG+L++PE   RIR V+HHQI+ +DV Y
Sbjct  281  VNVAAMETNMIFMDMEDGSKLTAEKLRKSLTEHGILVIPENSTRIRMVLHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS +Q+AV
Sbjct  341  TLSCLQQAV  349



>ref|XP_006606451.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=441

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL 
Sbjct  282  KNFIAKARRLRKTLGGGMRQIGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLR  341

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  342  VDACSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  401

Query  283  ALSRVQRAVT  254
            ALS  Q  +T
Sbjct  402  ALSCFQVMLT  411



>ref|XP_006487715.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487716.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487717.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487718.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Citrus 
sinensis]
Length=359

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGL  467
            K FI +AR +RKTLGGGMRQ+GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL
Sbjct  221  KEFIKKARRLRKTLGGGMRQVGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGL  280

Query  466  EVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQ  287
             VD+ +VETNIV+ +I +++      L K+L EHGVL++PE   R+R V+HHQIS +DV 
Sbjct  281  RVDVDAVETNIVYFEITEDSKLDAACLLKKLEEHGVLVMPESSTRVRIVVHHQISASDVH  340

Query  286  YALSRVQRAVTGVANGSGD  230
            Y LS  Q+   GV   +G+
Sbjct  341  YTLSCFQKIYAGVCEENGN  359



>gb|ADI24921.1| L-allo-threonine aldolase [Carica papaya]
Length=360

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI +AR +RKTLGGGMRQ+G+LCAAA+V  ++N+ KLEGDHKKAK LA+GLN+I+GL 
Sbjct  221  ETFITKARRLRKTLGGGMRQVGILCAAAVVALRKNLSKLEGDHKKAKILADGLNQINGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD A VETNI++  +++ +  T   LCK L +HG+L++ EG  RIR V+HHQIS +DVQY
Sbjct  281  VDAAKVETNIIYFKVMEYSRMTAERLCKYLKDHGILVIYEGEFRIRIVLHHQISASDVQY  340

Query  283  ALSRVQRAVTGVAN  242
             LS  Q  VT +A+
Sbjct  341  TLSCFQ--VTNLAH  352



>emb|CDY06323.1| BnaA09g48800D [Brassica napus]
Length=358

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K LAEHG+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSKLTAEKLRKSLAEHGILVIPENSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS  ++AV
Sbjct  341  TLSCFKQAV  349



>ref|XP_006442676.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442677.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442678.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442679.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442680.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442681.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442682.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442683.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55916.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55917.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55918.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55919.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55920.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55921.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55922.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55923.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=359

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGL  467
            K FI +AR +RKTLGGGMRQ+GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL
Sbjct  221  KEFIKKARRLRKTLGGGMRQVGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGL  280

Query  466  EVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQ  287
             VD+ +VETNIV+ +I +++      L K+L EHGVL++PE   R+R V+HHQIS  DV 
Sbjct  281  RVDVDAVETNIVYFEITEDSKLYAACLLKKLEEHGVLVMPESSTRVRIVVHHQISANDVH  340

Query  286  YALSRVQRAVTGVANGSGD  230
            Y LS  Q+   GV   +G+
Sbjct  341  YTLSCFQKIYAGVCEENGN  359



>ref|XP_009118358.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118360.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118361.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118362.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118363.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K LAEHG+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSKLTAEKLRKSLAEHGILVIPENSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS  ++AV
Sbjct  341  TLSCFKQAV  349



>ref|XP_006408182.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
 gb|ESQ49635.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
Length=352

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIGVLCAAALV   ENV KL+ DHKKAK LAEGLN+I  L 
Sbjct  224  KSFITKARWLRKTLGGGMRQIGVLCAAALVALHENVAKLDDDHKKAKILAEGLNRIERLR  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ +VETNI++ DI K+      + CK L   GVL++P+   RIR V+HHQISD+DV+Y
Sbjct  284  VDVTAVETNIIYVDIPKDPKFRAEDACKSLEVLGVLVIPQATFRIRIVLHHQISDSDVEY  343

Query  283  ALS  275
             LS
Sbjct  344  VLS  346



>gb|AFK42511.1| unknown [Lotus japonicus]
Length=121

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  592  MRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILK  413
            MRQ+G+LCAAALV  Q+ VG+LE DHKKA+TLA+GLN+I GL VD +SVETNIV+ +I +
Sbjct  1    MRQVGILCAAALVALQDIVGELESDHKKARTLADGLNQIKGLRVDTSSVETNIVYIEIKE  60

Query  412  EANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  233
             + TT  +L K L  +GVL++P G  +IR V HHQISD+DVQYALS  Q+AV GV N +G
Sbjct  61   GSGTTAAKLSKDLENYGVLLMPLGSSKIRVVFHHQISDSDVQYALSCFQQAVNGVGNENG  120

Query  232  D  230
            +
Sbjct  121  N  121



>ref|XP_009123981.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
 ref|XP_009123982.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
Length=360

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIGVLCAAALV  +ENV KLE DHKKAK LAEGLN+I  L+
Sbjct  224  KSFITKARWLRKTLGGGMRQIGVLCAAALVALRENVAKLEDDHKKAKILAEGLNRIERLK  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ D+ K+      + CK L   GV ++P+   RIR V+HHQISD+D+ Y
Sbjct  284  VDVAAVETNIIYVDLPKDPKFGAEDACKSLEVLGVFVIPQTTFRIRIVLHHQISDSDLDY  343

Query  283  ALSRVQRAVTGV  248
             LS  ++  + V
Sbjct  344  VLSCFEKLFSSV  355



>ref|XP_003590971.1| L-allo-threonine aldolase [Medicago truncatula]
Length=336

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  202  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  261

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  262  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  321

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  322  TLSCFQQAVQ-IENGN  336



>tpg|DAA36971.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36972.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=372

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  L 
Sbjct  221  EAFIDKARILRKTLGGGMRQVGVLCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQLT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI+ +   +  +LC+ L +  VL +P   K +RFVIH+QISD+DVQY
Sbjct  281  VDSSSVETNMVFFDIV-DPRISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQISDSDVQY  339

Query  283  ALSRVQRAV  257
            AL+ V++AV
Sbjct  340  ALTCVEKAV  348



>ref|XP_008661960.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 ref|XP_008661961.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 gb|ACG33933.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58856.1| putative threonine aldolase family protein [Zea mays]
Length=377

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  ++NVGKL  DH+KAK LA+GLNKI    
Sbjct  222  KAFIDKAKILRKTLGGGMRQVGVLCAAAHVAVRDNVGKLADDHRKAKALADGLNKIEQFR  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASV+TN+VF DI+ ++  +  +LC+ L  H VL  P  PK +R V+H+QISD DVQY
Sbjct  282  VDSASVQTNMVFLDIV-DSRISSNKLCQVLGTHNVLASPRSPKSVRLVLHYQISDDDVQY  340

Query  283  ALSRVQRAVTGVANGS  236
            AL+  ++A   +  GS
Sbjct  341  ALTCFKKAAEQLLMGS  356



>emb|CDY22672.1| BnaC08g43060D [Brassica napus]
Length=358

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K L EHG+L++PE   RIR VIHH I+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSKLTAEKLRKSLTEHGILVIPENSSRIRMVIHHHITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS  Q+AV
Sbjct  341  TLSCFQQAV  349



>gb|AES61221.2| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=355

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  221  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  341  TLSCFQQAVQ-IENGN  355



>gb|AFK38526.1| unknown [Medicago truncatula]
Length=370

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  236  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  295

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  296  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  355

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  356  TLSCFQQAVQ-IENGN  370



>gb|ACF86035.1| unknown [Zea mays]
 tpg|DAA36966.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=231

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  80   KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQIT  139

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF +++ +   +  +LC+ L +  VL LP   K IRFVIH+QISD DV Y
Sbjct  140  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGY  198

Query  283  ALSRVQRAVTGVANGS  236
            AL+ V++A+  +  GS
Sbjct  199  ALACVEKAIKELLEGS  214



>gb|ACG34432.1| L-allo-threonine aldolase [Zea mays]
Length=377

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+GVLCAAA V   +NVGKL  DH+KAK LA+GLNKI    
Sbjct  222  KAFIDKAKILRKTLGGGMRQVGVLCAAAHVAVHDNVGKLADDHRKAKALADGLNKIEQFR  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASV+TN+VF DI+ ++  +  +LC+ L  H VL  P  PK +R V+H+QISD DVQY
Sbjct  282  VDSASVQTNMVFLDIV-DSRISSNKLCQVLGTHNVLASPRSPKSVRLVLHYQISDDDVQY  340

Query  283  ALSRVQRAVTGVANGS  236
            AL+  ++A   +  GS
Sbjct  341  ALTCFKKAAEQLLMGS  356



>ref|XP_003590972.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61223.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=370

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  236  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  295

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  296  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  355

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  356  TLSCFQQAVQ-IENGN  370



>ref|NP_566228.1| threonine aldolase 2 [Arabidopsis thaliana]
 sp|Q9FPH3.1|THA2_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 2; 
AltName: Full=Threonine aldolase 2 [Arabidopsis thaliana]
 gb|AAG40385.1|AF325033_1 AT3g04520 [Arabidopsis thaliana]
 gb|AAM14044.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 gb|AAM62682.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
 gb|AAM67566.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 dbj|BAD43108.1| L-allo-threonine aldolase like protein [Arabidopsis thaliana]
 gb|AEE74091.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=355

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KLE DHKKA+ LAEGLN+I  L 
Sbjct  225  KKFITKARWLRKTLGGGMRQIGVLCAAALVALHENVAKLEDDHKKARVLAEGLNRIERLR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      E CK L + GVL++P+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVETNIIYVDIPEDPKFGAEEACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEY  344

Query  283  ALS  275
             LS
Sbjct  345  VLS  347



>emb|CDY42933.1| BnaC05g47180D [Brassica napus]
Length=360

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIGVLCAAALV  +ENV KLE DHK AK LAEGLN+I  L+
Sbjct  224  KSFITKARWLRKTLGGGMRQIGVLCAAALVALRENVAKLEDDHKNAKILAEGLNRIERLK  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ D+ K+      + CK L   GVL++P+   RIR V+HHQISD+D+ Y
Sbjct  284  VNVAAVETNIIYVDLPKDPKFGAEDACKSLEVLGVLVIPQTTFRIRIVLHHQISDSDLDY  343

Query  283  ALSRVQRAVTGVA  245
             LS  ++  + VA
Sbjct  344  VLSCFEKLFSSVA  356



>emb|CDY49330.1| BnaA05g32920D [Brassica napus]
Length=360

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIGVLCAAALV  +ENV KLE DHKKAK LAEGLN+I  L+
Sbjct  224  KSFITKARWLRKTLGGGMRQIGVLCAAALVALRENVAKLEDDHKKAKILAEGLNRIERLK  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A+VETNI++ D+ K+      + CK L    VL++P+   RIR V+HHQISD+D+ Y
Sbjct  284  VDVAAVETNIIYVDLPKDPKFGAEDACKSLEVLSVLVIPQTTFRIRIVLHHQISDSDLDY  343

Query  283  ALSRVQRAVTGV  248
             LS  ++  + V
Sbjct  344  VLSCFEKLFSSV  355



>ref|XP_003590973.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61224.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=396

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  262  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  321

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  322  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  381

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  382  TLSCFQQAVQ-IENGN  396



>ref|XP_010906812.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
 ref|XP_010906813.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
Length=359

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+ +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L 
Sbjct  221  REFITKAKRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI++ +  T   LC+ L EHGVL +P     +RFV+H+QIS++D+ Y
Sbjct  281  VDTSSVETNMVFFDIVESSLITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHY  340

Query  283  ALSRVQRAV  257
            AL+ VQ+AV
Sbjct  341  ALACVQQAV  349



>ref|XP_010906811.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Elaeis guineensis]
Length=365

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+ +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L 
Sbjct  227  REFITKAKRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELT  286

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI++ +  T   LC+ L EHGVL +P     +RFV+H+QIS++D+ Y
Sbjct  287  VDTSSVETNMVFFDIVESSLITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHY  346

Query  283  ALSRVQRAV  257
            AL+ VQ+AV
Sbjct  347  ALACVQQAV  355



>ref|XP_004495577.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=355

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAA+LV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  221  KNFITKAKRLRKTLGGGMRQIGILCAASLVALKENVGKLESDHKKTRLLADGLNEIEGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  SVETNI+F DI + + TT  ++CK L E G+L+L +   R+R V+H QIS +DVQY
Sbjct  281  VNPCSVETNIIFIDIEEGSRTTAEKICKYLEERGILLLQDKSSRLRVVLHFQISSSDVQY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+A+  + NG+
Sbjct  341  TLSCFQQALQ-IENGN  355



>ref|XP_010906809.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=387

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+ +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L 
Sbjct  249  REFITKAKRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELT  308

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI++ +  T   LC+ L EHGVL +P     +RFV+H+QIS++D+ Y
Sbjct  309  VDTSSVETNMVFFDIVESSLITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHY  368

Query  283  ALSRVQRAV  257
            AL+ VQ+AV
Sbjct  369  ALACVQQAV  377



>ref|XP_010906810.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=384

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+ +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L 
Sbjct  246  REFITKAKRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELT  305

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI++ +  T   LC+ L EHGVL +P     +RFV+H+QIS++D+ Y
Sbjct  306  VDTSSVETNMVFFDIVESSLITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHY  365

Query  283  ALSRVQRAV  257
            AL+ VQ+AV
Sbjct  366  ALACVQQAV  374



>ref|XP_004495576.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
Length=370

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAA+LV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  236  KNFITKAKRLRKTLGGGMRQIGILCAASLVALKENVGKLESDHKKTRLLADGLNEIEGLR  295

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  SVETNI+F DI + + TT  ++CK L E G+L+L +   R+R V+H QIS +DVQY
Sbjct  296  VNPCSVETNIIFIDIEEGSRTTAEKICKYLEERGILLLQDKSSRLRVVLHFQISSSDVQY  355

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+A+  + NG+
Sbjct  356  TLSCFQQALQ-IENGN  370



>ref|XP_002448187.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
 gb|EES12515.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
Length=372

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  221  KAFIDKAKILRKTLGGGMRQVGVLCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQFT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI+ +   +  +LC+ L +  VL +P   K +RFV+H+QISD+DVQY
Sbjct  281  VDSSSVETNMVFFDIV-DPRISPNKLCQVLEQRNVLAMPASSKSVRFVVHYQISDSDVQY  339

Query  283  ALSRVQRAV  257
            AL+ V++AV
Sbjct  340  ALTCVEKAV  348



>dbj|BAK03835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++NVGKL  DH+KAK LA+GL KI    
Sbjct  223  KAFIDQARILRKTLGGGMRQVGVLCAAAYVAVRDNVGKLADDHRKAKVLADGLKKIKQFT  282

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ SVETN+VF DI  +   T  +LC+ L    VL +P   K +R VIH+QISD+DVQY
Sbjct  283  VDLTSVETNMVFFDI-ADPRITSDKLCQLLERRNVLAMPGTSKSVRLVIHYQISDSDVQY  341

Query  283  ALSRVQRAVTGVANGS  236
             L+ +++AV  + +GS
Sbjct  342  TLTCIEKAVEEILSGS  357



>ref|XP_003580135.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
 ref|XP_010240138.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
Length=372

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+G+LCAAA VG ++ VGKL  DH+KAK LAEGL KI    
Sbjct  221  KAFIDKAKIVRKTLGGGMRQVGILCAAAYVGVRDTVGKLADDHRKAKVLAEGLKKIKQFT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ SVETN+VF DI  +   +  +LC+ L +  VL +P   K +R VIH+QISDTDVQY
Sbjct  281  VDLTSVETNMVFFDI-TDPRISPDKLCQVLEQRNVLAMPASSKSVRLVIHYQISDTDVQY  339

Query  283  ALSRVQRAVTGVANGS  236
            AL+ +++ V  + +G+
Sbjct  340  ALTCIEKVVEEILSGN  355



>ref|XP_002884450.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60709.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KLE DHKKA+ LAEGL++I  L 
Sbjct  225  KEFITKARWLRKTLGGGMRQIGVLCAAALVALHENVAKLEDDHKKARFLAEGLSRIERLR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      E CK L + GVLI+P+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVETNIIYVDIPEDPKFGAEEACKSLEDVGVLIIPQATFRIRIVLHHQISDVDVEY  344

Query  283  ALS  275
             LS
Sbjct  345  VLS  347



>ref|XP_010489194.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489200.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489206.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RK LGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G++
Sbjct  221  QSFIEKAKTVRKALGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +VETN++F D+   +  T  +L K L E+G+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVTAVETNMIFMDMEDGSRLTAEKLRKTLEENGILVIPEKSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS +Q+AV  +   S
Sbjct  341  TLSCLQQAVETIQEPS  356



>ref|XP_010463930.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR MRKTLGGGMRQIGVLCAAALV   ENV KL  DHKKAK LAEGLN+I  L 
Sbjct  225  KKFITKARWMRKTLGGGMRQIGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERLR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VE+NI++ DI ++      + CK L + GVL+LP+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVESNIIYVDIPEDPKFGAEDACKSLKDVGVLVLPQATFRIRIVLHHQISDVDVEY  344

Query  283  ALS  275
             LS
Sbjct  345  VLS  347



>ref|XP_010553776.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Tarenaya hassleriana]
Length=339

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++AR +RKTLGGGMRQIGVLCAAAL+  QENV KLE DHKKAK LA+GLN+I G+ V+
Sbjct  204  FIEKARTLRKTLGGGMRQIGVLCAAALIALQENVSKLEYDHKKAKILAQGLNQIKGIRVN  263

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
             A+VETNI+F ++   +     +L K L E+G+L++P    RIR VIHHQIS  DV + L
Sbjct  264  AAAVETNIIFLEMEDSSRLGAEKLRKNLEENGILVIPVNSSRIRIVIHHQISAGDVYHTL  323

Query  277  SRVQRAVTGVANGSGD  230
            S +Q+AV G    + D
Sbjct  324  SCIQQAVNGAQEANVD  339



>ref|XP_010475669.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010475670.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RK LGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKALGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQLKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +VETN++F D+   +  T  +L K L E+G+L++PE   RIR VIHHQI+  DVQY
Sbjct  281  VNVTAVETNMIFMDMEDGSRLTAGKLRKALEENGILVIPENSSRIRMVIHHQITTCDVQY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS +Q+A+  +   S
Sbjct  341  TLSCLQQALQTIQEPS  356



>ref|XP_010415759.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KL  DHKKAK LAEGLN+I  L 
Sbjct  225  KKFITKARWLRKTLGGGMRQIGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERLR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      + CK L + GVL+LP+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVETNIIYVDIPEDPKFGAEDACKSLEDVGVLVLPQATFRIRIVLHHQISDVDVEY  344

Query  283  ALS  275
             LS
Sbjct  345  VLS  347



>ref|XP_006305180.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
 gb|EOA38078.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
Length=358

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RK LGGGMRQIGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKALGGGMRQIGVLCAAALVAIQENLPKLQHDHKKTKLLAEGLNQVKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K L E+G+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSRLTAEKLRKTLEENGILVIPENSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS +Q+A+  +   S
Sbjct  341  TLSCLQQALQTIQEPS  356



>tpg|DAA45471.1| TPA: hypothetical protein ZEAMMB73_239903 [Zea mays]
Length=194

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+ARI+RKTLGGGMRQ+G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  55   EAFIDKARILRKTLGGGMRQVGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFT  114

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI+ + + +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQY
Sbjct  115  VDSSSVETNMVFFDIV-DPHISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQY  173

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  174  ALTCVE  179



>ref|XP_006298023.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
 gb|EOA30921.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
Length=353

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KL+ DHKKAK LAEGLN+I  L+
Sbjct  225  KKFITKARWLRKTLGGGMRQIGVLCAAALVALNENVPKLDDDHKKAKILAEGLNRIERLK  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      + CK L + GVL++P+   R+R V+HHQISD DV Y
Sbjct  285  VNVAAVETNIIYVDIPEDPKFGAEDACKSLKDVGVLVIPQSTFRMRIVLHHQISDDDVDY  344

Query  283  ALSRVQR  263
             LS  Q+
Sbjct  345  VLSCFQK  351



>ref|NP_001241763.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG36649.1| L-allo-threonine aldolase [Zea mays]
Length=370

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ +GKL  DH+KAK LA GL KI  + 
Sbjct  219  KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTMGKLADDHRKAKALAVGLKKIEQIT  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF +++ +   +  +LC+ L +H VL +P   K IRFV+H+QISD DV+Y
Sbjct  279  VDPASVETNMVFFEVM-DPRISPDKLCQVLEQHNVLAMPANSKSIRFVVHYQISDADVRY  337

Query  283  ALSRVQRAVTGVANGS  236
            AL+ VQ+A+  +  GS
Sbjct  338  ALACVQKAIKELLEGS  353



>ref|XP_010553775.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Tarenaya hassleriana]
Length=365

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++AR +RKTLGGGMRQIGVLCAAAL+  QENV KLE DHKKAK LA+GLN+I G+ V+
Sbjct  230  FIEKARTLRKTLGGGMRQIGVLCAAALIALQENVSKLEYDHKKAKILAQGLNQIKGIRVN  289

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
             A+VETNI+F ++   +     +L K L E+G+L++P    RIR VIHHQIS  DV + L
Sbjct  290  AAAVETNIIFLEMEDSSRLGAEKLRKNLEENGILVIPVNSSRIRIVIHHQISAGDVYHTL  349

Query  277  SRVQRAVTGVANGSGD  230
            S +Q+AV G    + D
Sbjct  350  SCIQQAVNGAQEANVD  365



>ref|XP_008655940.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Zea mays]
Length=198

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+ARI+RKTLGGGMRQ+G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  55   EAFIDKARILRKTLGGGMRQVGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFT  114

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI+ + + +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQY
Sbjct  115  VDSSSVETNMVFFDIV-DPHISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQY  173

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  174  ALTCVE  179



>ref|XP_007144017.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 ref|XP_007144018.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16011.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16012.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
Length=365

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI +AR +RKTLGGGMRQIG+LCAAALV  QEN+GKLE DHKKA+ LA+GL ++ GL 
Sbjct  221  ENFIAKARRLRKTLGGGMRQIGILCAAALVALQENIGKLENDHKKARLLADGLRELKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD   VETNIVF DI     T   ++CK L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VDTLGVETNIVFIDIEDGIQTRAEKICKYLEERGILLMQESSSRMRVVLHHQISASDVQY  340

Query  283  ALS  275
            ALS
Sbjct  341  ALS  343



>ref|XP_008667491.1| PREDICTED: putative threonine aldolase family protein isoform 
X1 [Zea mays]
 tpg|DAA36968.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=370

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  219  KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQIT  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF +++ +   +  +LC+ L +  VL LP   K IRFVIH+QISD DV Y
Sbjct  279  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGY  337

Query  283  ALSRVQRAVTGVANGS  236
            AL+ V++A+  +  GS
Sbjct  338  ALACVEKAIKELLEGS  353



>ref|XP_008443794.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
 ref|XP_008443795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=360

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH KAK LA GL +I G++
Sbjct  222  KSFISKARRVRKTLGGGMRQIGILCAAGLVALKENVQKLEADHHKAKQLASGLCQIKGIK  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ SVETNI+F +I +++  +   LCK + EHG+L++ E   RIR V+HHQIS +DV+Y
Sbjct  282  VDLKSVETNIIFFEIEEDSQISAKLLCKSMEEHGILLMQESLSRIRIVLHHQISTSDVEY  341

Query  283  ALSRVQRAVTGV  248
             L  +++ + GV
Sbjct  342  TLKCMKQFLCGV  353



>ref|XP_008655935.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Zea mays]
Length=216

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+ARI+RKTLGGGMRQ+G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  73   EAFIDKARILRKTLGGGMRQVGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFT  132

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF DI+ + + +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQY
Sbjct  133  VDSSSVETNMVFFDIV-DPHISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQY  191

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  192  ALTCVE  197



>ref|XP_003590970.1| L-allo-threonine aldolase [Medicago truncatula]
Length=463

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 104/152 (68%), Gaps = 7/152 (5%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  278  KNFITKAKRLRKTLGGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  337

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  338  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  397

Query  283  ALSRVQRAVTGVANGSGDH*N*GNCYLCFKIF  188
             LS  Q     +A         G   LC++I 
Sbjct  398  TLSCFQLYKLKMATS-------GKIALCWRII  422



>ref|XP_010485829.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQ+GVLCAAALV   ENV KL  DHKKAK LAEGLN+I    
Sbjct  225  KEFITKARWLRKTLGGGMRQVGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERFR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      + CK L + GVL+LP+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVETNIIYVDIPEDPKFGAEDACKSLEDVGVLVLPQATFRIRIVLHHQISDVDVEY  344

Query  283  ALS  275
             LS
Sbjct  345  VLS  347



>gb|ACJ85157.1| unknown [Medicago truncatula]
 gb|AFK44463.1| unknown [Medicago truncatula]
Length=421

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ ++KTL GGMRQIG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL 
Sbjct  287  KNFITKAKRLQKTLSGGMRQIGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLR  346

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  S+ETNI+F DI+  + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  347  VNPCSIETNIIFIDIVDGSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQY  406

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+AV  + NG+
Sbjct  407  TLSCFQQAVQ-IENGN  421



>ref|NP_001149239.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG34688.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58857.1| putative threonine aldolase family protein [Zea mays]
Length=375

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  ++NVGKL  DH+KAK LA+GLNKI    
Sbjct  222  KAFIDKAKILRKTLGGGMRQVGVLCAAAHVAVRDNVGKLADDHRKAKALADGLNKIEQFR  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASV+TN+VF DI+ ++  +  +LC+ L  H VL  P  PKR+  V+H+QISD DVQY
Sbjct  282  VDSASVQTNMVFLDIV-DSRISSNKLCQVLGTHNVLASPRSPKRL--VLHYQISDDDVQY  338

Query  283  ALSRVQRAVTGVANGS  236
            AL+  ++A   +  GS
Sbjct  339  ALTCFKKAAEQLLMGS  354



>ref|NP_001189807.1| threonine aldolase 2 [Arabidopsis thaliana]
 gb|AEE74092.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=354

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KLE DHKKA+ LA GLN+I  L 
Sbjct  225  KKFITKARWLRKTLGGGMRQIGVLCAAALVALHENVAKLEDDHKKARVLA-GLNRIERLR  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNI++ DI ++      E CK L + GVL++P+   RIR V+HHQISD DV+Y
Sbjct  284  VNVAAVETNIIYVDIPEDPKFGAEEACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEY  343

Query  283  ALS  275
             LS
Sbjct  344  VLS  346



>gb|EMS52584.1| L-allo-threonine aldolase [Triticum urartu]
Length=349

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+G+LCAAA +  ++ VGKL  DH+KAK LA+GL KI    
Sbjct  198  KAFIDKAKILRKTLGGGMRQVGILCAAAYLAVRDTVGKLADDHRKAKVLADGLTKIKQFT  257

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETN+VF DI  +   T  +LC+ L +  VL +P   K +R V H+QISD+DVQY
Sbjct  258  VDLASVETNMVFFDI-ADPRITPDKLCQVLEQRNVLAMPASSKSVRLVTHYQISDSDVQY  316

Query  283  ALSRVQRAVTGVANGS  236
             L+ +++AV  + +G+
Sbjct  317  TLTCIEKAVEEILSGN  332



>emb|CDY31134.1| BnaA08g26840D [Brassica napus]
Length=369

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +
Sbjct  222  TFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRI  281

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            ++A+VETN++F D+   +  T  +L K L E G+L+LP    RIR V+HHQI+ +DV Y 
Sbjct  282  NVAAVETNMIFMDMEDGSKLTAEKLRKSLTECGILVLPGNSSRIRMVVHHQITISDVHYT  341

Query  280  LSRVQRAV  257
            LS +Q+A+
Sbjct  342  LSCLQQAM  349



>ref|XP_010458106.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458107.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458108.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RK LGGGMRQIGVL AAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKALGGGMRQIGVLWAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +VETN++F D+   +  T  +L + L E+G+L++PE   RIR VIHHQI+ +DV Y
Sbjct  281  VNVTAVETNMIFMDMEDGSRLTAEKLRRTLEENGILVIPENSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS +Q+AV  +   S
Sbjct  341  TLSCLQQAVQTIQEPS  356



>ref|XP_009110878.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=369

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +
Sbjct  222  TFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRI  281

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            ++A+VETN++F D+   +  T  +L K L E G+L+LP    RIR V+HHQI+ +DV Y 
Sbjct  282  NVAAVETNMIFMDMEDGSRLTAEKLRKSLTECGILVLPGNSSRIRMVVHHQITISDVHYT  341

Query  280  LSRVQRAV  257
            LS +Q+A+
Sbjct  342  LSCLQQAM  349



>ref|XP_008802139.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI +AR +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD
Sbjct  223  FITKARRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKLFADGLKQIKELTVD  282

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
             +SVETN+VF DI++ ++ +   LC+ L EHGVL +P     +R V+HHQI ++D++Y L
Sbjct  283  TSSVETNMVFLDIVESSHISPERLCQVLEEHGVLAMPASSTSVRLVVHHQILESDIRYVL  342

Query  277  SRVQRAV  257
            + +++AV
Sbjct  343  ACMKQAV  349



>gb|AAM63785.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKTLGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K L E+G+L++     RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSRLTAEKLRKNLEENGILLIRGKSSRIRIVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS  Q+A+
Sbjct  341  TLSXFQQAM  349



>emb|CAE05443.2| OSJNBa0073E02.3 [Oryza sativa Japonica Group]
Length=349

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+I+RKTLGGGMRQ+G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    V
Sbjct  199  AFIEKAKILRKTLGGGMRQVGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRV  258

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            D  SVETN+VF DI+ ++  +  +LC+ L +  VL +P G K +R VIH+QISD+DVQYA
Sbjct  259  DTTSVETNMVFFDIV-DSRISPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYA  317

Query  280  LSRVQRAVTGVANGS  236
            L+ V++A   +  GS
Sbjct  318  LTCVEKAAEEILTGS  332



>ref|NP_001053314.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAD41482.2| OSJNBb0072M01.18 [Oryza sativa Japonica Group]
 dbj|BAF15228.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAH67219.1| OSIGBa0145M07.1 [Oryza sativa Indica Group]
 dbj|BAG94039.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77644.1| hypothetical protein OsI_16646 [Oryza sativa Indica Group]
 gb|EEE61341.1| hypothetical protein OsJ_15466 [Oryza sativa Japonica Group]
Length=372

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+I+RKTLGGGMRQ+G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    V
Sbjct  222  AFIEKAKILRKTLGGGMRQVGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRV  281

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            D  SVETN+VF DI+ ++  +  +LC+ L +  VL +P G K +R VIH+QISD+DVQYA
Sbjct  282  DTTSVETNMVFFDIV-DSRISPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYA  340

Query  280  LSRVQRAVTGVANGS  236
            L+ V++A   +  GS
Sbjct  341  LTCVEKAAEEILTGS  355



>ref|NP_563822.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849614.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849615.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_001031001.2| threonine aldolase [Arabidopsis thaliana]
 sp|Q8RXU4.1|THA1_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 1; 
AltName: Full=Threonine aldolase 1 [Arabidopsis thaliana]
 gb|AAL86346.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51302.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01898.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28320.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28321.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28322.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28323.1| threonine aldolase [Arabidopsis thaliana]
Length=358

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKTLGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K L E+G+L++     RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSRLTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHY  340

Query  283  ALSRVQRAV  257
             LS  Q+A+
Sbjct  341  TLSCFQQAM  349



>ref|XP_008667492.1| PREDICTED: putative threonine aldolase family protein isoform 
X2 [Zea mays]
Length=360

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  219  KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQIT  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF +++ +   +  +LC+ L +  VL LP   K IRFVIH+QISD DV Y
Sbjct  279  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGY  337

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  338  ALACVE  343



>gb|EMS67121.1| L-allo-threonine aldolase [Triticum urartu]
Length=367

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+I+RKTLGGGMRQ+GVLCAAA VG ++ VGKL  DH+KAK LA+GL KI    
Sbjct  221  KAFIHKAKILRKTLGGGMRQVGVLCAAAEVGVRDTVGKLADDHRKAKVLADGLKKIKQFT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD++SVETN+VF D + +   +  +LC+ L +  VL +P   K +RFV+H+QISD+D+QY
Sbjct  281  VDLSSVETNMVFFD-MADPRISPAKLCQALKQRNVLAMPTSSKSVRFVVHYQISDSDIQY  339

Query  283  ALSRVQRAV  257
             L  ++ AV
Sbjct  340  TLKCIEEAV  348



>ref|XP_004976222.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=372

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+A+I+RKTLGGGMRQ+GVLCAAA V  +++V KL  DH++AK LAEGLNK+    
Sbjct  221  KAFIDKAKILRKTLGGGMRQVGVLCAAAHVAVRDSVEKLADDHRRAKALAEGLNKMEQFT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI+ ++  +  +LC+ L +H V + P  PK +R V+H+ ISD+DVQY
Sbjct  281  VDSTSVETNMVFFDIV-DSRISSYKLCQILEKHNVHVNPRSPKSVRLVLHYHISDSDVQY  339

Query  283  ALSRVQRAVTGVANG  239
            AL+  ++ V  +  G
Sbjct  340  ALTCFEKVVEELLTG  354



>ref|XP_002892465.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68724.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV   EN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKTLGGGMRQIGVLCAAALVALHENLPKLQHDHKKAKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN++F D+   +  T  +L K L E+G+L++     RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETNMIFMDMEDGSRLTAEKLRKSLEENGILLIRGNSSRIRMVIHHQITTSDVHY  340

Query  283  ALSRVQRAVTGVANGS  236
             LS  Q+A+  +   S
Sbjct  341  TLSCFQQAMQTIQEPS  356



>ref|XP_007030423.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 ref|XP_007030426.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10925.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10928.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
Length=359

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKR  332
            VD+A+V+TNI++ DI++ +  T  +L K L EHGVL++PEGP R
Sbjct  281  VDVAAVQTNIIYFDIVEGSKLTAEKLYKNLEEHGVLVMPEGPAR  324



>gb|AAF63783.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
Length=370

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 6/123 (5%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAALV   ENV KLE DHKKA+ LAEGLN+I  L 
Sbjct  225  KKFITKARWLRKTLGGGMRQIGVLCAAALVALHENVAKLEDDHKKARVLAEGLNRIERLR  284

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETNIV      E      E CK L + GVL++P+   RIR V+HHQISD DV+Y
Sbjct  285  VNVAAVETNIVNPKFGAE------EACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEY  338

Query  283  ALS  275
             LS
Sbjct  339  VLS  341



>ref|XP_006652519.1| PREDICTED: uncharacterized protein R102.4-like [Oryza brachyantha]
Length=372

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FID+A+I+RKTLGGGMRQ+G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    V
Sbjct  222  AFIDKAKILRKTLGGGMRQVGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRV  281

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            D  SVETN+VF DI+ ++  +  +LC+ L    VL +P   K +R V+H+QISD+DVQYA
Sbjct  282  DSTSVETNMVFFDIV-DSRISPNKLCQILEHRNVLAMPASSKSMRLVVHYQISDSDVQYA  340

Query  280  LSRVQRAVTGVANGS  236
            L+ +++A   +  GS
Sbjct  341  LACLEKAAEEILTGS  355



>ref|XP_009389078.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Musa 
acuminata subsp. malaccensis]
Length=359

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIGVLCAAA V  Q+NV KLE DH+KAK  A+GL +I  L 
Sbjct  221  KDFITKARRLRKTLGGGMRQIGVLCAAAYVALQDNVVKLEDDHRKAKIFADGLKEIKQLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+VF +I + +  + + LC+ L + GVL +P     +R VIH+QIS++DV Y
Sbjct  281  VDSSSVETNMVFFNINESSMISPISLCEALEKFGVLAMPASSTSVRVVIHYQISESDVHY  340

Query  283  ALSRVQRAV  257
            AL+ +++A+
Sbjct  341  ALTSIKQAI  349



>dbj|BAJ93201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI++ +I+RKTLGGGMRQ+GVLCAAA VG ++ +GKL  DH+KAK LA+GL KI    
Sbjct  221  KAFINKTKILRKTLGGGMRQVGVLCAAAEVGVRDTIGKLTDDHRKAKVLADGLKKIEQFT  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ SVETN+VF   + +   T  +LCK L +  VL +P   K +R V+H+QISD+DVQY
Sbjct  281  VDLTSVETNMVFFH-MADPRITPAKLCKVLEQRNVLAMPTSSKSVRLVVHYQISDSDVQY  339

Query  283  ALSRVQRAV  257
             L+ +++AV
Sbjct  340  TLTCIEKAV  348



>ref|XP_004142582.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=365

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+
Sbjct  222  KSFISKARRVRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLK  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+  SVETNI+F +I +++  +   LC+ + E G+L++ E   RIR V+HHQIS +DVQY
Sbjct  282  VNPKSVETNIIFFEIEEDSQISAKLLCESMKERGILLMQESLSRIRIVVHHQISTSDVQY  341

Query  283  AL  278
             L
Sbjct  342  TL  343



>ref|NP_001242307.1| uncharacterized protein LOC100790890 [Glycine max]
 gb|ACU17690.1| unknown [Glycine max]
Length=360

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GL ++ GL 
Sbjct  221  KNFIAKARRLRKTLGGGMRQIGLLCAAALVALQENVGKLESDHKKARLLADGLKEVKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VDAGSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  340

Query  283  ALSRVQR--AVTGVANGSGD  230
            ALS  Q+  AV GV N  G+
Sbjct  341  ALSCFQQALAVKGVQNEMGN  360



>ref|XP_006588445.1| PREDICTED: uncharacterized protein LOC100790890 isoform X1 [Glycine 
max]
 gb|KHN14818.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RKTLGGGMRQIG+LCAAALV  QENVGKLE DHKKA+ LA+GL ++ GL 
Sbjct  221  KNFIAKARRLRKTLGGGMRQIGLLCAAALVALQENVGKLESDHKKARLLADGLKEVKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETN+VF DI +   T   ++CK + E G+L++ E   R+R V+HHQIS +DVQY
Sbjct  281  VDAGSVETNMVFIDIEEGTKTRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQY  340

Query  283  ALSRVQR--AVTGVANGSGD  230
            ALS  Q+  AV GV N  G+
Sbjct  341  ALSCFQQALAVKGVQNEMGN  360



>emb|CDY54493.1| BnaCnng27100D [Brassica napus]
Length=315

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +
Sbjct  180  TFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRI  239

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYA  281
            ++A+VETN++F D+   +  T  +L K L E G+L+LP    RIR VI+H I+ +DV Y 
Sbjct  240  NVAAVETNMIFMDMEDGSKLTAEKLRKSLTECGILVLPGNSSRIRMVIYHHIT-SDVHYT  298

Query  280  LSRVQRA  260
            LS +Q+A
Sbjct  299  LSCLQQA  305



>ref|XP_004155692.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=358

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RKTLGGGMRQIG+LCAA LV  +ENV KLE DHKKAK LA GL +I GL+
Sbjct  221  KDFIAKARRVRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHKKAKQLASGLFQIKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D  SVETNI+  +I  +   +   LCK L E G+ ++ +   R R V HHQIS +DVQY
Sbjct  281  IDPKSVETNIILFEIEDDYGISMETLCKSLEERGIFVMLQTQTRARIVFHHQISTSDVQY  340

Query  283  ALSRVQRAVTG--VANGS  236
             LS  Q+ + G  V NG+
Sbjct  341  ILSCFQQTLNGIKVVNGN  358



>ref|XP_008453667.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Cucumis melo]
Length=392

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +A  +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+
Sbjct  255  KDFITKAIRIRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLK  314

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETNI+F +I  +   +   LCK L E G+ ++ E   R R V+HHQIS +DVQY
Sbjct  315  VDPKSVETNIIFFEIEDDYGISMETLCKTLEERGIFMMLESQTRARIVLHHQISTSDVQY  374

Query  283  ALSRVQRAVTG--VANGS  236
             LS  ++ + G  V NG+
Sbjct  375  TLSCFKQTLNGIKVVNGN  392



>ref|XP_008453666.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Cucumis melo]
Length=400

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +A  +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+
Sbjct  263  KDFITKAIRIRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLK  322

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETNI+F +I  +   +   LCK L E G+ ++ E   R R V+HHQIS +DVQY
Sbjct  323  VDPKSVETNIIFFEIEDDYGISMETLCKTLEERGIFMMLESQTRARIVLHHQISTSDVQY  382

Query  283  ALSRVQRAVTG--VANGS  236
             LS  ++ + G  V NG+
Sbjct  383  TLSCFKQTLNGIKVVNGN  400



>ref|XP_010906814.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010906816.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=359

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +A+ +RKTLGGGMRQ+GVLCAAA V  QEN+GKLE DH+KAK  A+GL +I  L 
Sbjct  221  KDFIAKAKRLRKTLGGGMRQVGVLCAAAYVALQENIGKLEDDHRKAKIFADGLKQIKELS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D  SVETN++F  I   +  +   LC+ L  HG+L +P     +R V+H+QIS+ DV Y
Sbjct  281  IDATSVETNMIFFSIADSSLISPKRLCQVLEVHGILAMPASSTSVRLVLHYQISENDVYY  340

Query  283  ALSRVQRAV  257
            AL+ ++ AV
Sbjct  341  ALTCIKHAV  349



>ref|XP_008802138.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Phoenix 
dactylifera]
Length=359

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGGGMRQ+GVLCAAA V  QEN+ KLE DH+KAK  A+GL +I  L 
Sbjct  221  KAFIAKAKRLRKTLGGGMRQVGVLCAAAYVALQENIRKLEDDHRKAKIFADGLKQIKELS  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D  SVETN++F  I+  +  +   LC+ L E G+L +P     +R V+H+QIS+ DV Y
Sbjct  281  IDATSVETNMIFFSIVDSSLMSPKRLCQVLEERGILAMPASSTSVRLVLHYQISENDVYY  340

Query  283  ALSRVQRAVTG-VANGSGD  230
            AL+ +++ V   V NG+ +
Sbjct  341  ALTCIKQLVQQMVTNGTAE  359



>gb|ACJ83727.1| unknown [Medicago truncatula]
Length=118

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = -2

Query  592  MRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILK  413
            MRQIG++CAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+ 
Sbjct  1    MRQIGIICAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVD  60

Query  412  EANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  236
             + TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  61   GSRTTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  118



>ref|XP_006857300.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
 gb|ERN18767.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
Length=358

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +A+ +RKTLGG MRQ+G+LCAAALV  ++ V KLE DH+KAK LA+GLN + GL+
Sbjct  221  KNFITKAKRLRKTLGGAMRQVGILCAAALVALRDIVPKLEEDHQKAKILADGLNHVKGLK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ASVETN+VF +I  +  T E +  + L + G+L+LP     IR V+HHQIS +DVQY
Sbjct  281  VDLASVETNLVFFEITDKRVTAE-KFSQVLNDRGILVLPISSCSIRIVLHHQISFSDVQY  339

Query  283  ALSRVQRAV  257
             LS + +AV
Sbjct  340  TLSYITQAV  348



>gb|EPS60604.1| hypothetical protein M569_14199, partial [Genlisea aurea]
Length=322

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +ARI+RKTLGGGMRQ+GVLCAAAL+   ENV KLE DHKKAK LAEGLNKI GL 
Sbjct  221  KAFIHKARILRKTLGGGMRQVGVLCAAALIAVDENVDKLESDHKKAKILAEGLNKIKGLH  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGP  338
            VD+ASVETNIVF D+L+++  T+ +L K L  +GV  + EGP
Sbjct  281  VDLASVETNIVFFDVLEDSCITKDDLLKSLEAYGVYAMSEGP  322



>ref|XP_004976228.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Setaria 
italica]
Length=372

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+A+I+RKTLGGGMRQIGV+CAAA V  ++ VGKL  DH+KAK LAEGL KI   +
Sbjct  221  QAFIDKAKILRKTLGGGMRQIGVVCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQFK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF DI+ +   +   LC+ L +  VL +P   K +RFV+H+QISD+DV+Y
Sbjct  281  VDSASVETNMVFFDIM-DPRISPDRLCQVLEQRNVLAMPASSKSMRFVLHYQISDSDVKY  339

Query  283  ALSRVQRAVTGVANGS  236
            AL+ V++AV  +  GS
Sbjct  340  ALTCVEKAVEELLKGS  355



>ref|XP_010906817.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=335

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -2

Query  625  ARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASV  446
            A+ +RKTLGGGMRQ+GVLCAAA V  QEN+GKLE DH+KAK  A+GL +I  L +D  SV
Sbjct  203  AKRLRKTLGGGMRQVGVLCAAAYVALQENIGKLEDDHRKAKIFADGLKQIKELSIDATSV  262

Query  445  ETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  266
            ETN++F  I   +  +   LC+ L  HG+L +P     +R V+H+QIS+ DV YAL+ ++
Sbjct  263  ETNMIFFSIADSSLISPKRLCQVLEVHGILAMPASSTSVRLVLHYQISENDVYYALTCIK  322

Query  265  RAV  257
             AV
Sbjct  323  HAV  325



>gb|KHG00003.1| ltaA [Gossypium arboreum]
Length=326

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFISKARRLRKTLGGGMRQLGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGP  338
            V++A+VETNI+F DI++ +  T  +L K+L EHGVL++ EGP
Sbjct  281  VNVAAVETNIIFFDIVEGSKITAEKLYKKLEEHGVLVMLEGP  322



>gb|AAF99780.1|AC003981_30 F22O13.11 [Arabidopsis thaliana]
Length=352

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 6/129 (5%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ 
Sbjct  221  QSFIEKAKTVRKTLGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIR  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++A+VETN      +  +  T  +L K L E+G+L++     RIR VIHHQI+ +DV Y
Sbjct  281  VNVAAVETN------MDGSRLTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHY  334

Query  283  ALSRVQRAV  257
             LS  Q+A+
Sbjct  335  TLSCFQQAM  343



>gb|KHG00004.1| ltaA [Gossypium arboreum]
Length=362

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL 
Sbjct  257  KSFISKARRLRKTLGGGMRQLGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLR  316

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGP  338
            V++A+VETNI+F DI++ +  T  +L K+L EHGVL++ EGP
Sbjct  317  VNVAAVETNIIFFDIVEGSKITAEKLYKKLEEHGVLVMLEGP  358



>gb|ABR18450.1| unknown [Picea sitchensis]
Length=379

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +A+ +RKTLGGGMRQ+GVLCAA LV   + VG+L+ DH K + LAEGLN I GL 
Sbjct  237  QEFIAKAKKLRKTLGGGMRQVGVLCAAGLVALHDMVGRLKDDHHKCRILAEGLNGIDGLH  296

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +V TNIVF +I  ++     ELC+ +   GVL +P    R RFV HHQIS+ D++Y
Sbjct  297  VNLDAVHTNIVFVNITADSIPGAEELCEAMKHEGVLAIPMSHTRFRFVTHHQISEDDIRY  356

Query  283  ALS  275
             L+
Sbjct  357  TLA  359



>ref|XP_004976227.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Setaria 
italica]
Length=374

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+A+I+RKTLGGGMRQIGV+CAAA V  ++ VGKL  DH+KAK LAEGL KI   +
Sbjct  221  QAFIDKAKILRKTLGGGMRQIGVVCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQFK  280

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD ASVETN+VF DI+ +   +   LC+ L +  VL +P   K +RFV+H+QISD+DV+Y
Sbjct  281  VDSASVETNMVFFDIM-DPRISPDRLCQVLEQRNVLAMPASSKSMRFVLHYQISDSDVKY  339

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  340  ALTCVE  345



>gb|KJB44863.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=339

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 5/112 (4%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLK  280

Query  463  VDMASVETNI-----VFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRF  323
            VD+A+VETNI     ++ DI++ +  T  +L K L EHGVL++P+G  R  F
Sbjct  281  VDIAAVETNIALFQQIYVDIVEGSKITAEKLYKNLEEHGVLVMPKGLSRSVF  332



>gb|KGN66766.1| hypothetical protein Csa_1G681120 [Cucumis sativus]
Length=121

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = -2

Query  592  MRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILK  413
            MRQIG+LCAA LV  +ENV KLE DHKKAK LA GL +I GL++D  SVETNI+  +I  
Sbjct  1    MRQIGILCAAGLVAIKENVQKLEADHKKAKQLASGLFQIKGLKIDPKSVETNIILFEIED  60

Query  412  EANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  233
            +   +   LCK L E G+ ++ +   R R V HHQIS +DVQY LS  Q+ + G+   +G
Sbjct  61   DYGISMETLCKSLEERGIFVMLQTQTRARIVFHHQISTSDVQYILSCFQQTLNGIKVVNG  120

Query  232  D  230
            +
Sbjct  121  N  121



>ref|XP_010520652.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Tarenaya 
hassleriana]
Length=349

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIGV+CAAAL+   EN+ KLEGDHKKAK LAEGLN+I  + 
Sbjct  239  KSFIAKARWLRKTLGGGMRQIGVICAAALMALHENLPKLEGDHKKAKFLAEGLNRIDRVR  298

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIH  314
            VD+A+VETNI++ DI ++   T  + CK L   GV ++P+   + R+VI+
Sbjct  299  VDVAAVETNIIYIDIPEDPKFTAEDACKSLEHVGVHVIPQ--SKFRYVIY  346



>ref|XP_008802141.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Phoenix dactylifera]
Length=333

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI +AR +RKTLGGGMRQ+GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD
Sbjct  223  FITKARRLRKTLGGGMRQVGVLCAAAYVALRDNVGKLEDDHKKAKLFADGLKQIKELTVD  282

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKR  332
             +SVETN+VF DI++ ++ +   LC+ L EHGVL +P    R
Sbjct  283  TSSVETNMVFLDIVESSHISPERLCQVLEEHGVLAMPASSTR  324



>ref|NP_001077492.1| threonine aldolase [Arabidopsis thaliana]
 dbj|BAH19728.1| AT1G08630 [Arabidopsis thaliana]
 gb|AEE28324.1| threonine aldolase [Arabidopsis thaliana]
Length=344

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 14/129 (11%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DHKKAK L           
Sbjct  221  QSFIEKAKTVRKTLGGGMRQIGVLCAAALVALQENLPKLQHDHKKAKLL-----------  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
               A+VETN++F D+   +  T  +L K L E+G+L++     RIR VIHHQI+ +DV Y
Sbjct  270  ---AAVETNMIFMDMEDGSRLTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHY  326

Query  283  ALSRVQRAV  257
             LS  Q+A+
Sbjct  327  TLSCFQQAM  335



>ref|XP_004976226.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=321

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ +GKLE DH+KAK LAEGL KI  + 
Sbjct  219  KAFIDKARILRKTLGGGMRQVGVLCAAAQVAVRDTLGKLEDDHRKAKALAEGLKKIKHIT  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKR  332
            VD ASVETN+VF DI     + +  LC+ L +H VL +P   KR
Sbjct  279  VDPASVETNMVFFDITNPRISPD-NLCQVLEQHNVLAMPASSKR  321



>ref|XP_008655946.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X3 [Zea mays]
Length=191

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FID+ARI+RKTLGGGMRQ+G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  73   EAFIDKARILRKTLGGGMRQVGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFT  132

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRF  323
            VD +SVETN+VF DI+ + + +  +LC+ L +  VL +P   K   F
Sbjct  133  VDSSSVETNMVFFDIV-DPHISPSKLCQVLEQRNVLAMPASSKSRYF  178



>ref|XP_001768407.1| predicted protein [Physcomitrella patens]
 gb|EDQ66769.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RK LGGGMRQ+G+L AA LV  ++ V +L  DH  AK +AEGLN + GL 
Sbjct  230  KEFITKARRLRKALGGGMRQVGILAAAGLVAMRDMVDRLNVDHANAKLMAEGLNAVKGLR  289

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VDM+ VETNIV+ ++  ++  T  E+ +   E+GVL +  G   IR + H+QI++ DV +
Sbjct  290  VDMSIVETNIVYAEVTDDSVLTPKEIVEAWKEYGVLAMTWGRNMIRVLTHYQITEDDVLF  349

Query  283  ALSRVQRAVTGVAN  242
            ALS  +      AN
Sbjct  350  ALSFFKTTSLQAAN  363



>dbj|BAK01917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++NVGKL  DH+KAK LA+GL KI    
Sbjct  223  KAFIDQARILRKTLGGGMRQVGVLCAAAYVAVRDNVGKLADDHRKAKVLADGLKKIKQFT  282

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFV  320
            VD+ SVETN+VF DI  +   T  +LC+ L    VL +P   KR   V
Sbjct  283  VDLTSVETNMVFFDI-ADPRITSDKLCQLLERRNVLAMPGTSKRFNSV  329



>emb|CDY59150.1| BnaC08g13650D, partial [Brassica napus]
Length=447

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = -2

Query  640  SFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEV  461
            +FI++A+ +RKTLGGGMRQIGVLCAAALV  QEN+ KL+ DH KAK LAEGLN+++G+ +
Sbjct  332  TFIEKAKTLRKTLGGGMRQIGVLCAAALVALQENLPKLQFDHNKAKLLAEGLNQMTGIRI  391

Query  460  DMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIH  314
            ++A+VETN++F D+   +  T  +L K L E G+L+LP      R+V H
Sbjct  392  NVAAVETNMIFMDMEDGSKLTAEKLRKSLTECGILVLPGNSS--RYVSH  438



>ref|XP_008657658.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=210

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DHK AK LAEGL KI  + 
Sbjct  103  KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTVGKLADDHKNAKALAEGLKKIEQIT  162

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILP  347
            VD ASVETN+VF +++ +   +  +LC+ L +H VL +P
Sbjct  163  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQHNVLAMP  200



>ref|XP_008675991.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=161

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGG+RQ+GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + 
Sbjct  54   KAFIDKARILRKTLGGGIRQVGVLCAAAHVVVRDTVGKLADDHKKAKALAEGLKKIEQIT  113

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILP  347
            VD ASVETN+VF +++ +   +  +LC+ L +H VL +P
Sbjct  114  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQHNVLAMP  151



>ref|NP_001140767.1| putative threonine aldolase family protein [Zea mays]
 gb|ACF84582.1| unknown [Zea mays]
 tpg|DAA36967.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=321

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  219  KAFIDKARILRKTLGGGMRQVGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQIT  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKR  332
            VD ASVETN+VF +++ +   +  +LC+ L +  VL LP   KR
Sbjct  279  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQDNVLALPANSKR  321



>ref|WP_020877756.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans]
 gb|EPR35940.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans DSM 2059]
Length=347

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI  AR  RK LGGGMRQ GV+ AA +V   E V +L  DH  A+ LAEGL +I+G+ 
Sbjct  216  REFIAEARRNRKVLGGGMRQAGVIAAAGIVALTEMVDRLPEDHANARKLAEGLAEIAGVA  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD A V TNIV+ D+ +  +     L +R+   GV +L  GP+RIR V H+Q+S  D++ 
Sbjct  276  VDPAGVRTNIVYFDVTRP-DMDAQALARRMKASGVALLAAGPRRIRAVTHYQVSAGDIEA  334

Query  283  ALSRVQRAVTGVA  245
            ALS  +R + G A
Sbjct  335  ALSAFRRVLAGDA  347



>gb|KGN66765.1| hypothetical protein Csa_1G680120 [Cucumis sativus]
Length=331

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+
Sbjct  222  KSFISKARRVRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLK  281

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKR  332
            V+  SVETNI+F +I +++  +   LC+ + E G+L++ E   R
Sbjct  282  VNPKSVETNIIFFEIEEDSQISAKLLCESMKERGILLMQESLSR  325



>ref|XP_004170415.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=326

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+
Sbjct  224  KSFISKARRVRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLK  283

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPE  344
            V+  SVETNI+F +I +++  +   LC+ + E G+L++ E
Sbjct  284  VNPKSVETNIIFFEIEEDSQISAKLLCESMKERGILLMQE  323



>ref|XP_007030425.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
 gb|EOY10927.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
Length=319

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL 
Sbjct  221  KSFITKARRLRKTLGGGMRQVGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLR  280

Query  463  VDMASVETNIV  431
            VD+A+V+TNIV
Sbjct  281  VDVAAVQTNIV  291



>ref|XP_008453668.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Cucumis melo]
Length=382

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +A  +RKTLGGGMRQIG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+
Sbjct  263  KDFITKAIRIRKTLGGGMRQIGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLK  322

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD  SVETNI+F +I  +   +   LCK L E G+ ++ E   R +     Q+  + +  
Sbjct  323  VDPKSVETNIIFFEIEDDYGISMETLCKTLEERGIFMMLESQTRFQ-----QVMFSTLYL  377

Query  283  ALSRV  269
            ALS++
Sbjct  378  ALSKL  382



>ref|WP_011697570.1| threonine aldolase [Syntrophobacter fumaroxidans]
 gb|ABK16397.1| L-threonine aldolase [Syntrophobacter fumaroxidans MPOB]
Length=353

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI RAR  RK +GGGMRQ G+L AA +V   E V +L  DH  A+ LAEGL+ ++GL 
Sbjct  216  RDFIARARRTRKVVGGGMRQAGILAAAGIVALDEMVTRLAEDHANARALAEGLSTMTGLS  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+  V+TNIVF D+ +E + T   L  RL   GVL+   GP+R+R V H+ +S  D+ +
Sbjct  276  VDLEFVKTNIVFIDVERE-DLTAPVLAARLKPDGVLVQVTGPRRMRAVTHYGVSAEDIDF  334

Query  283  ALSRVQRAV  257
             L+  ++A+
Sbjct  335  TLTAFKKAM  343



>ref|WP_027408853.1| threonine aldolase [Anoxybacillus tepidamans]
Length=343

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI  AR  RK LGGG+RQ GVL A  ++  ++ V +L  DH  A+ LAEGL  + GL 
Sbjct  215  KSFIKEARKWRKRLGGGLRQAGVLAAPGIIALEKMVDRLAEDHANARQLAEGLAAVPGLH  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A VETNIV CDI K    +  E   RL E G+L +P     IRFV H +++   VQ 
Sbjct  275  VDVAGVETNIVLCDI-KGTGLSNKEFLTRLKEAGILAVPFDEGVIRFVTHREVTSDMVQT  333

Query  283  ALSRVQRAV  257
            A+ R+++ V
Sbjct  334  AIERIRQLV  342



>ref|XP_008671569.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=257

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ ID+ARI+RKTLGGGMR +GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + 
Sbjct  64   KASIDKARILRKTLGGGMRHVGVLCAAAHVAVRDTVGKLADDHKKAKALAEGLKKIEQIT  123

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVL  356
            VD ASVETN+VF +++ +   +  +LC+ L +H VL
Sbjct  124  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQHNVL  158



>tpg|DAA45470.1| TPA: hypothetical protein ZEAMMB73_239903 [Zea mays]
Length=488

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 2/126 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++   +ARI+RKTLGGGMRQ+G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    
Sbjct  346  ETLYAQARILRKTLGGGMRQVGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFT  405

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD +SVETN+V   +  EA    +       +     +P     +RFVIH+QI D+DVQY
Sbjct  406  VDSSSVETNMV--SVKDEARYIFLIFHNVNRKGPAYDIPLLFISVRFVIHYQILDSDVQY  463

Query  283  ALSRVQ  266
            AL+ V+
Sbjct  464  ALTCVE  469



>ref|XP_008671685.1| PREDICTED: uncharacterized protein LOC103649121 [Zea mays]
Length=419

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ ID+ARI+RKTLGGGMR +GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + 
Sbjct  64   KASIDKARILRKTLGGGMRHVGVLCAAAHVAVRDTVGKLADDHKKAKALAEGLKKIEQIT  123

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLIL  350
            VD ASVETN+VF +++ +   +  +LC+ L +H VL +
Sbjct  124  VDSASVETNMVFFEVM-DPRISPDKLCQVLEQHNVLAM  160



>ref|WP_009609982.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|EEB76295.1| Beta-eliminating lyase superfamily protein [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=346

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI+RAR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G++
Sbjct  215  KEFIERARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARLLAEGLKNIPGID  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +DM +V+TNIV  DI      T  E   +L EHGVL+       +RFV H+ I+  DV+ 
Sbjct  275  LDMETVQTNIVMTDI-SGTGMTGREFSLKLKEHGVLVNGGDDFSVRFVTHYYITKEDVKK  333

Query  283  ALSRVQRAV  257
            ALS +++ V
Sbjct  334  ALSAIEKVV  342



>ref|WP_011024735.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|AAM23563.1| Threonine aldolase [Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 gb|ERM92570.1| threonine aldolase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=346

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI+RAR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G++
Sbjct  215  KEFIERARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARLLAEGLKNIPGID  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +DM +V+TNIV  DI      T  E   +L EHGVL+       +RFV H+ I+  DV+ 
Sbjct  275  LDMETVQTNIVMTDI-SGTGMTGREFSLKLKEHGVLVNGGDDFSVRFVTHYYITKEDVKK  333

Query  283  ALSRVQRAV  257
            ALS +++ V
Sbjct  334  ALSAIEKVV  342



>ref|WP_026677955.1| threonine aldolase [Fictibacillus gelatini]
Length=342

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR  RK LGGG+RQ+GVL A  +V  ++ V +L  DH  A+  AEGL+ I G+ 
Sbjct  212  KSFIQKARKWRKRLGGGLRQVGVLAAPGIVALEKMVDRLAEDHANARQFAEGLSAIPGIT  271

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+  VETNI+ CDI +E   +  +   +L E G+L  P     IRFV H ++++  VQ 
Sbjct  272  IDVDGVETNIILCDI-RETGLSNEQFLTKLKEAGILAGPFDDGIIRFVTHREVTNEMVQT  330

Query  283  ALSRVQRAVTG  251
            A+ R+ + + G
Sbjct  331  AIERIAQIIAG  341



>ref|WP_014100459.1| threonine aldolase [Candidatus Chloracidobacterium thermophilum]
 gb|AEP12722.1| L-threonine aldolase [Candidatus Chloracidobacterium thermophilum 
B]
Length=351

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 71/125 (57%), Gaps = 1/125 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI+RAR +RK LGGGMRQ GVL AA LV  +E    L  DH  A+ LA  L ++ GL+
Sbjct  219  RDFIERARTVRKMLGGGMRQAGVLAAAGLVALEEGPAHLADDHANARWLAAELAQLPGLD  278

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+  VETNIV CD+     T   + C  L   GVL  P GP  +RFV H     +  Q 
Sbjct  279  VDLTRVETNIVMCDVTPTGMTAS-DFCAGLKSCGVLAGPAGPYTVRFVTHRDAPRSACQR  337

Query  283  ALSRV  269
            A+  +
Sbjct  338  AVEAI  342



>ref|XP_005854754.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU21599.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
Length=283

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++F ++AR +RK LGG MRQ+GVL AA LV  +  + +L  DH+ A+ LA+GL+ + GL+
Sbjct  157  RAFTEKARKLRKALGGAMRQVGVLAAAGLVALKRTLPRLAEDHENARRLAKGLSTLPGLK  216

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +VETNIV  D       +  EL + L    VL L  GP+RIR V H+ +S+ D++ 
Sbjct  217  VNVEAVETNIVMIDFEDRLPLSPPELLEELERRNVLALAVGPRRIRMVTHYDVSEGDIKK  276

Query  283  ALSRVQR  263
            A++  ++
Sbjct  277  AITVFEK  283



>ref|XP_002973664.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
 gb|EFJ25324.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
Length=358

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++A+ +RK LGG MRQ+G+L A  LV  ++ V +L  DH  A+ LAEGL  + GL+VD
Sbjct  228  FIEKAKRLRKALGGAMRQVGILAAPGLVALKDMVCRLYEDHSNARLLAEGLCGMKGLQVD  287

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            M++VETNIV  D+ K   T E ELC+ + + G+L        IR V H+ IS+ DV+Y L
Sbjct  288  MSAVETNIVNVDVTKSRFTAE-ELCRAMGKIGILSYDLTKTSIRLVTHYHISEDDVRYTL  346

Query  277  SRVQ  266
            +  Q
Sbjct  347  ACFQ  350



>ref|XP_002975719.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
 gb|EFJ23348.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
Length=358

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++A+ +RK LGG MRQ+G+L A  LV  ++ V +L  DH  A+ LAEGL  + GL+VD
Sbjct  228  FIEKAKRLRKALGGAMRQVGILAAPGLVALKDMVCRLYEDHSNARLLAEGLCGMKGLQVD  287

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            M++VETNIV  D+ K   T E ELC+ + + G+L        IR V H+ IS+ DV+Y L
Sbjct  288  MSAVETNIVNVDVTKSRFTAE-ELCRAMGKIGILSYDLTKTSIRLVTHYHISEDDVRYTL  346

Query  277  SRVQ  266
            +  Q
Sbjct  347  ACFQ  350



>ref|WP_025229058.1| threonine aldolase [Fimbriimonas ginsengisoli]
 gb|AIE87020.1| serine hydroxymethyltransferase [Fimbriimonas ginsengisoli Gsoil 
348]
Length=349

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FID+AR+ RK LGGGMRQ G+L A  +V    NV +L  DH++AK +A+ + ++ G+ V 
Sbjct  226  FIDKARVWRKRLGGGMRQAGILAACGIVSLNSNVDRLADDHRRAKEIAQAVCELPGMSVK  285

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            +  VETN+V  D   EA   E++   +LAE GVL LP GP R+R V+H  I D   + A+
Sbjct  286  LEEVETNMVMVD--TEAPAPEIQ--GKLAEKGVLCLPTGPNRLRLVLHADIDDAKTEKAI  341



>ref|WP_020265088.1| hypothetical protein [Atribacteria bacterium JGI 0000059-I14]
Length=348

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI+RAR +RK LGGGMRQ GVL AA +V  ++ + +L  DH  A+ LAE L K+ GL+
Sbjct  214  RTFIERARKIRKMLGGGMRQAGVLAAAGIVALEKMINRLTEDHAHARYLAEELLKVKGLK  273

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TN+V+CDI  +   + ++L + L   G+L+ P  P +IR V H  I   D+  
Sbjct  274  IDLNTVQTNMVYCDI-SQLKASALQLTEWLKGEGLLVSPVPPDKIRLVTHRHICREDINK  332

Query  283  ALSRVQRAV  257
            A+  ++  +
Sbjct  333  AVEIIKMVI  341



>ref|WP_037564212.1| threonine aldolase [Spirochaeta sp. JC202]
 gb|KGM38782.1| threonine aldolase [Spirochaeta sp. JC202]
Length=345

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FIDRAR  RK +GGGMRQ GVL AA +V   + V +L  DH  A+ LAEGL ++ GL 
Sbjct  216  REFIDRARRARKVVGGGMRQAGVLAAAGIVALNDMVDRLTEDHVNARKLAEGLAEMPGLA  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+A +++NIVF +++++  T E +L + L + G  +LP G  RIR V H+ IS  ++ +
Sbjct  276  IDLARIKSNIVFFEVVRDDMTAE-QLVRMLDDQGARMLPVGVGRIRAVTHYHISSENIDH  334

Query  283  AL  278
             L
Sbjct  335  TL  336



>ref|WP_027448368.1| threonine aldolase [Pontibacillus marinus]
 gb|KGX84447.1| threonine aldolase [Pontibacillus marinus BH030004 = DSM 16465]
Length=341

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI RAR  RK LGGGMRQ GV+ A  LV   E V +LE DH+ AK LAE +N ISGLE
Sbjct  213  KSFIKRARKWRKRLGGGMRQAGVIAAPGLVALNEMVDRLEEDHEHAKNLAESVNSISGLE  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   VETNIV  ++ KE          +L E GVL +P GP  IR V + ++S  D+  
Sbjct  273  VE-GKVETNIVLINV-KETGMDAEAFLAKLKEQGVLAVPFGPYTIRMVTNKEVSAEDLPE  330

Query  283  ALSRVQRAV  257
               ++++ V
Sbjct  331  VKKQLEKCV  339



>ref|WP_025322967.1| threonine aldolase [Deferrisoma camini]
Length=347

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI+RAR  RK LGGGMRQ G+L AA LV     VG+L  DH  A+ LA G+  + GL 
Sbjct  215  KAFIERARRHRKLLGGGMRQAGILAAAGLVALDTMVGRLTDDHANARALARGIASVDGLR  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ +V+TNIV  +++  A      L   L   GVL    GP++IR V H  +S  DV  
Sbjct  275  VDLGAVQTNIVLFEVVDPA-WDAASLVAALGRVGVLCSAFGPRKIRLVTHCDVSTEDVSE  333

Query  283  ALSRVQRAV  257
            AL R++  V
Sbjct  334  ALDRIETVV  342



>ref|WP_040378796.1| threonine aldolase [Dethiobacter alkaliphilus]
Length=341

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++AR  RK LGGGMRQ GVL AA LV   +++ +L  DH+ A  LAEGL KI GL VD
Sbjct  219  FIEQARRYRKLLGGGMRQAGVLAAAGLVAL-DDIAQLSDDHENAVRLAEGLAKIEGLSVD  277

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            ++ V+TN+V  +I      +  E   R+ E GV   P GP R+RFV H  ++  D+  AL
Sbjct  278  LSKVQTNMVMAEI---QELSVQEFLDRILEAGVAAGPMGPGRVRFVTHRDVTAADIDEAL  334

Query  277  SRVQRAV  257
             R+ +A+
Sbjct  335  MRIGQAL  341



>ref|WP_018706849.1| hypothetical protein [Bacillus fordii]
Length=348

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGG RQ G++ AA ++  +E +G+L+ DH  AK LAEGL +I+G++
Sbjct  214  KDFIEKARKWRKMLGGGTRQAGIVGAAGIIALEEIIGRLQEDHLHAKKLAEGLARINGID  273

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D   VETNI+   I +     + E  K+L  H +L    GP RIRFV H  I+  D+  
Sbjct  274  IDAEGVETNIIMFSIARSGLDAD-EFIKKLHGHEILANSAGPYRIRFVTHRGIATEDIDT  332

Query  283  ALSRVQR  263
            A+  ++R
Sbjct  333  AIEAIKR  339



>gb|EEG77367.1| Threonine aldolase [Dethiobacter alkaliphilus AHT 1]
Length=339

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = -2

Query  637  FIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVD  458
            FI++AR  RK LGGGMRQ GVL AA LV   +++ +L  DH+ A  LAEGL KI GL VD
Sbjct  217  FIEQARRYRKLLGGGMRQAGVLAAAGLVAL-DDIAQLSDDHENAVRLAEGLAKIEGLSVD  275

Query  457  MASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            ++ V+TN+V  +I      +  E   R+ E GV   P GP R+RFV H  ++  D+  AL
Sbjct  276  LSKVQTNMVMAEI---QELSVQEFLDRILEAGVAAGPMGPGRVRFVTHRDVTAADIDEAL  332

Query  277  SRVQRAV  257
             R+ +A+
Sbjct  333  MRIGQAL  339



>gb|EGU57937.1| L-allo-threonine aldolase [Vibrio nigripulchritudo ATCC 27043]
Length=173

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I++AR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  49   KALIEKARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  108

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  109  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  164

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  165  LVDTIKRLI  173



>dbj|GAL27114.1| low-specificity L-threonine aldolase [Vibrio variabilis]
Length=187

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI+RAR +RK +GGGMRQ G+L AA  +   E V +L  DH  AK LAEGLN ++G  
Sbjct  63   KSFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVAQLATDHANAKKLAEGLNAVAGFS  122

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF  + +  +     + ++LA  G+ I P  P  +RFV H  +S  D+  
Sbjct  123  VNADFVQTNIVFAKLDESVDIN--RIAEQLAVDGITISPSNP--VRFVTHKDVSSNDIDV  178

Query  283  ALSRVQRAV  257
             L +++  V
Sbjct  179  LLEKLKTLV  187



>ref|WP_014062139.1| threonine aldolase [Thermoanaerobacter wiegelii]
 gb|AEM77766.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter wiegelii Rt8.B1]
Length=345

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI K   T + E   +L EHG+LI       +RFV H+ IS  D++ 
Sbjct  275  LDLETVQTNIVMTDISKTGMTGK-EFALKLKEHGILINGGNDFAVRFVTHYYISKKDIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>emb|CAN82414.1| hypothetical protein VITISV_039151 [Vitis vinifera]
Length=397

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 77/130 (59%), Gaps = 25/130 (19%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI +AR +RKTLGGGMRQ+G++CAAALV  QEN+ KLEGDHKKAK LA     +S   
Sbjct  232  KSFIAKARRLRKTLGGGMRQVGIICAAALVALQENIAKLEGDHKKAKILAGNEPAVSFCS  291

Query  463  VDMASVET----------------NIVFC---------DILKEANTTEMELCKRLAEHGV  359
              + +V+                  +VFC         +I++ +N T  +LCK L EHGV
Sbjct  292  ASLEAVDMFGSYNCKCPWCCDDSGALVFCTSVMFPVYFEIVEGSNITAEKLCKYLQEHGV  351

Query  358  LILPEGPKRI  329
            L++PE   RI
Sbjct  352  LMMPESSSRI  361



>ref|WP_038146243.1| threonine aldolase, partial [Vibrio nigripulchritudo]
Length=173

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I++AR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  49   KALIEKARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  108

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  109  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  164

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  165  LVDTIKRLI  173



>ref|WP_004400281.1| MULTISPECIES: Threonine aldolase [Thermoanaerobacter]
 gb|EMT39215.1| Threonine aldolase [Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=345

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI K   T + E   +L EHG+LI       +RFV H+ IS  D++ 
Sbjct  275  LDLETVQTNIVMTDISKTGMTGK-EFALKLKEHGILINGGNDFAVRFVTHYYISKKDIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|WP_026475800.1| threonine aldolase [Alkaliphilus transvaalensis]
Length=346

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR +RK LGGGMRQ+G++ AA LV  +++   +E DH  AK LA GLN I G+ 
Sbjct  218  KDFIKKARKLRKMLGGGMRQVGIIAAAGLVALRDHSQWMEEDHLNAKKLAFGLNLIDGVR  277

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++  V TNI+  DI  E      +L  R++E G+L+ P   + IRFV H  I++ DV+ 
Sbjct  278  VNLDKVHTNILMADI-SETGFNAYDLVNRMSEKGLLVNPRNERLIRFVTHRGINNRDVEA  336

Query  283  ALSRVQ  266
            A+  V+
Sbjct  337  AIKIVK  342



>gb|EWM22625.1| threonine aldolase [Nannochloropsis gaditana]
Length=912

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++F ++AR +RK LGG MRQ+GVL AA LV  +  + +L  DH+ A+ LA+GL+ + GL+
Sbjct  321  RAFTEKARKLRKALGGAMRQVGVLAAAGLVALKRTLPRLAEDHENARRLAKGLSTLPGLK  380

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +VETNIV  D       +  EL + L    VL L  GP+RIR V H+ +S+ D++ 
Sbjct  381  VNVEAVETNIVMIDFEDRLPLSPPELLEELERRNVLALAVGPRRIRMVTHYDVSEGDIKK  440

Query  283  ALSRVQRAV  257
            A++  ++ +
Sbjct  441  AITVFEKVL  449



>ref|WP_042470320.1| threonine aldolase [Vibrio maritimus]
 dbj|GAL17387.1| low-specificity L-threonine aldolase [Vibrio maritimus]
Length=316

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            KSFI+RAR +RK +GGGMRQ G+L AA  +   E V +L  DH  AK LAEGLN ++G  
Sbjct  192  KSFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVAQLATDHANAKKLAEGLNAVAGFS  251

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF  + +  +     + ++LA+ G+ I P  P  +RFV H  +S  D+  
Sbjct  252  VNADFVQTNIVFAKLDESVDIN--RIAEQLAQDGITISPSNP--VRFVTHKDVSSNDIDV  307

Query  283  ALSRVQRAV  257
             L +++  V
Sbjct  308  LLEKLKTLV  316



>ref|WP_038227001.1| threonine aldolase [Vibrio sp. ER1A]
 gb|KFA97958.1| threonine aldolase [Vibrio sp. ER1A]
Length=334

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI+RAR +RK +GGGMRQ G+L AA  +   E V +L+ DH  AK LA GLN ISG  
Sbjct  210  KAFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVDQLKVDHANAKKLAFGLNDISGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF   L E+   ++ + + LA+ G+ I P  P  IRFV H  IS  D+ +
Sbjct  270  VNADFVQTNIVFAK-LDESVKIDV-IAESLAKEGITITPGNP--IRFVTHKDISSADIDH  325

Query  283  ALSRVQRAV  257
             L+R+++ V
Sbjct  326  LLTRLKQLV  334



>ref|WP_012269711.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 gb|ABY95633.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter pseudethanolicus ATCC 33223]
 gb|ADV80571.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter brockii subsp. finnii Ako-1]
Length=345

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI      T  EL  RL EHG+LI       +RFV H+ IS  +++ 
Sbjct  275  LDLETVQTNIVMTDI-SGTGMTGKELSLRLKEHGILINDGNDFAVRFVTHYYISKKEIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>gb|KIG16688.1| Low-specificity L-threonine aldolase [Enhygromyxa salina]
Length=348

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI  AR +R+ LGGGMRQ G++ AA +V  +  +  L  DH +A+ LAEGL +I GL 
Sbjct  217  EAFIAEARHVRRRLGGGMRQAGIIAAAGIVALETMIEPLAHDHARARALAEGLARIPGLR  276

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VDMASVETN+V+ +      +T+ ++ + LA H V+     P  IR V +    D  +  
Sbjct  277  VDMASVETNMVYVNHTATGRSTD-QIIELLARHSVIASNRPPDHIRLVTNRHHDDATITE  335

Query  283  ALSRVQRAVTGV  248
            A++RVQ A+  +
Sbjct  336  AITRVQAAINSI  347



>ref|WP_014645330.1| threonine aldolase [Halobacillus halophilus]
 emb|CCG47449.1| threonine aldolase [Halobacillus halophilus DSM 2266]
Length=339

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI +AR  RK LGGG+RQ+G++ A  LV   + V +L  DH+ AK LAEGL  I GLE
Sbjct  213  EDFIRKARKWRKRLGGGLRQVGIIAAPGLVALNDMVDRLAEDHEHAKQLAEGLGNIEGLE  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            ++  +V+TNI+  ++     T+  E  + L   GVL +P GP  +RFV H+ +S  D+  
Sbjct  273  IE-NNVDTNILLVNVEGRGKTSH-EFLEELKSQGVLAVPFGPYTVRFVTHYDVSGEDIDL  330

Query  283  ALSRVQR  263
             + RV R
Sbjct  331  VIERVHR  337



>ref|WP_029688227.1| threonine aldolase [Thermoanaerobacter sp. A7A]
Length=345

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI      T  EL  RL EHG+LI       +RFV H+ IS  +++ 
Sbjct  275  LDLETVQTNIVMTDI-SGTGMTGKELSLRLKEHGILINGGNDFAVRFVTHYYISKKEIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|WP_003867083.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 ref|YP_001661860.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 ref|YP_003903199.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
 gb|ABY91524.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 gb|EEU63053.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus CCSD1]
 gb|EFK85367.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X561]
 gb|ADN53908.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
Length=345

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI      T  EL  RL EHG+LI       +RFV H+ IS  +++ 
Sbjct  275  LDLETVQTNIVMTDI-SGTGMTGKELSLRLKEHGILINGGNDFAVRFVTHYYISKKEIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|WP_022601443.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN68404.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn118]
Length=334

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I+RAR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  210  KALIERARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  270  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  325

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  326  LVDTIKRLI  334



>ref|WP_013296780.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|ADL67801.1| Threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=345

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR  RK LGGG+RQ G+L AA +V  ++   +L  DH+ A+ LAEGLN I G++
Sbjct  215  KEFIKKARKYRKMLGGGLRQAGILAAAGIVALEKMTKRLSEDHENARLLAEGLNSIKGIK  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VDM++V+TNIV  DI      T  +L  +L ++G+ +   G   +RFV H+ I   D+  
Sbjct  275  VDMSTVQTNIVMSDI-SATGLTGAQLSSKLLDYGIKVNGAGDYNVRFVTHYYIKKDDINK  333

Query  283  ALSRVQRAV  257
             L  +   V
Sbjct  334  VLHAINTIV  342



>ref|XP_006605267.1| PREDICTED: uncharacterized protein LOC102668529 [Glycine max]
Length=127

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -2

Query  490  GLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHH  311
            GLN+I GL VD++SVETNI++ +I + + TT  +LCK L ++G+L++P    R+R V HH
Sbjct  41   GLNEIKGLRVDISSVETNIIYVEIEEGSRTTAAKLCKDLEDYGILLMPMDSSRLRIVFHH  100

Query  310  QISDTDVQYALSRVQRAVTGVANGSGD  230
            QIS TDVQYALS  Q+AV GV N +G+
Sbjct  101  QISATDVQYALSCFQQAVNGVRNENGN  127



>ref|WP_003540689.1| threonine aldolase [Desulfotomaculum nigrificans]
Length=343

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI RAR  RK LGGGMRQ G+L AA LV  + ++ +L  DH  AK LA GL ++ GL 
Sbjct  217  KDFITRARKYRKALGGGMRQAGILAAAGLVALK-SIDRLAEDHANAKRLAAGLAELPGLH  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D A V+TNIV  ++  +   T  EL  +LAE GV     GP  IR V H  ++  D++Y
Sbjct  276  IDPARVQTNIVIVEV--KGRLTAAELVNQLAERGVKCSTFGPNLIRLVTHKDVAAEDIEY  333

Query  283  ALS  275
            AL+
Sbjct  334  ALA  336



>ref|WP_003869086.1| threonine aldolase [Thermoanaerobacter ethanolicus]
 gb|EGD53170.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus JW 200]
Length=345

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI K   T + E   +L E G+LI       +RFV H+ IS  D++ 
Sbjct  275  LDLETVQTNIVMADISKTGMTGK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|WP_039929082.1| threonine aldolase [Thermoanaerobacter siderophilus]
 gb|AIS51424.1| L-allo-threonine aldolase LtaA [Thermoanaerobacter kivui]
Length=345

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI K   T + E   +L E G+LI       +RFV H+ IS  D++ 
Sbjct  275  LDLETVQTNIVMTDISKTGMTGK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|WP_022597498.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN33850.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
AM115]
 emb|CCN65534.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Pon4]
 emb|CCN43026.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
FTn2]
 emb|CCN75218.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SO65]
Length=334

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I++AR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  210  KALIEKARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  270  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  325

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  326  LIDTIKRLI  334



>ref|WP_014394185.1| threonine aldolase [Corallococcus coralloides]
 gb|AFE09262.1| L-allo-threonine aldolase [Corallococcus coralloides DSM 2259]
Length=341

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K  I  AR +RK LGGGMRQ G+L AAAL   + +V +L  DH  A+ LAEGL ++ G++
Sbjct  215  KDVIREARRLRKRLGGGMRQAGILAAAALYALEHHVERLAEDHANARRLAEGLAQVPGVK  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A VETN+VF D+++ A     E    L + GVL  P GP  IR V H  +S  D+  
Sbjct  275  VDLARVETNMVFADLVRPA----AEASALLLKQGVLANPTGPHSIRLVCHLDVSTADIDD  330

Query  283  ALSRVQRAVTG  251
            AL+R+++A  G
Sbjct  331  ALARIRKAFAG  341



>gb|EIV99346.1| threonine aldolase [Thermoanaerobacter siderophilus SR4]
Length=362

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  232  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGIN  291

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI K   T + E   +L E G+LI       +RFV H+ IS  D++ 
Sbjct  292  LDLETVQTNIVMTDISKTGMTGK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEK  350

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  351  TLDAIEKIV  359



>ref|WP_015310760.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|AGB17948.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=345

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +A+  RK LGGG+RQ G+L AA +V  ++   +L  DH+ A+ LAEGLN I G++
Sbjct  215  KEFIKKAKKYRKMLGGGLRQAGILAAAGIVALEKMTKRLSEDHENARLLAEGLNNIKGIK  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VDM++V+TNIV  DI      T  +L  +L ++G+ +   G   +RFV H+ I   D+  
Sbjct  275  VDMSTVQTNIVMSDI-SATGLTGAQLSSKLLDYGIKVNGAGDYNVRFVTHYYIKKDDINK  333

Query  283  ALSRVQRAV  257
             L  +   V
Sbjct  334  VLHAINTIV  342



>ref|WP_022561270.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 ref|YP_008641758.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCO60698.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN84480.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
BLFn1]
 emb|CCN86527.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn27]
 emb|CCN97070.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
ENn2]
 emb|CCO41573.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn135]
 emb|CCO54178.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Wn13]
Length=334

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I++AR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  210  KALIEKARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  270  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  325

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  326  LVDTIKRLI  334



>ref|WP_022592526.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN54732.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3021]
 emb|CCN61704.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3029]
 emb|CCN49783.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3020]
Length=334

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+ I++AR +RK LGG MRQ+G+L AA  +   E V +L+ DHK AK LAEGL  I G  
Sbjct  210  KALIEKARRIRKMLGGAMRQVGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    V+TNIVF  + +  +     L  +LAE G++I P  P  IRFV H  +S  DV  
Sbjct  270  VKPELVQTNIVFAKVDETIDVD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNT  325

Query  283  ALSRVQRAV  257
             +  ++R +
Sbjct  326  LVDTIKRLI  334



>ref|WP_042834178.1| threonine aldolase [Thermoanaerobacter sp. YS13]
 gb|KHO61352.1| L-threonine aldolase [Thermoanaerobacter sp. YS13]
Length=345

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK LGGGMRQ G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ 
Sbjct  215  KDFIEKARKYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKDIPGIN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+ +V+TNIV  DI      T  EL  +L E+G+LI       +RFV H+ IS  D++ 
Sbjct  275  LDLETVQTNIVMTDI-SGTGMTGKELSLKLKEYGILINGGNDFAVRFVTHYYISKKDIEK  333

Query  283  ALSRVQRAV  257
             L  +++ V
Sbjct  334  TLDAIEKIV  342



>ref|XP_008659428.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Zea mays]
Length=236

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  158  KAFIDKARILRKTLGGGMRQVGVLCAAAHVVVRDTVGKLADDHRKAKALAEGLKKIEQIT  217

Query  463  VDMASVETNI  434
            VD+ASVETN+
Sbjct  218  VDLASVETNM  227



>ref|WP_041274354.1| threonine aldolase [Desulfotomaculum reducens]
Length=339

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI+RAR  RK LGGGMRQ G+L AA LV  Q NV +L  DH  A+ LAEGL K+ GL 
Sbjct  213  RQFIERARKYRKALGGGMRQAGILAAAGLVALQ-NVDRLAEDHANARRLAEGLAKLPGLG  271

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A V+TNI+  ++ +  +  ++ +   L   G+     GP  IR V H  +S  D+ Y
Sbjct  272  VDLAKVQTNIIVVNVNQPRSAADLTMA--LNNKGIKCSTFGPSTIRMVTHINVSKEDIDY  329

Query  283  AL  278
            AL
Sbjct  330  AL  331



>gb|ABO48655.1| L-threonine aldolase [Desulfotomaculum reducens MI-1]
Length=344

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI+RAR  RK LGGGMRQ G+L AA LV  Q NV +L  DH  A+ LAEGL K+ GL 
Sbjct  218  RQFIERARKYRKALGGGMRQAGILAAAGLVALQ-NVDRLAEDHANARRLAEGLAKLPGLG  276

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+A V+TNI+  ++ +  +  ++ +   L   G+     GP  IR V H  +S  D+ Y
Sbjct  277  VDLAKVQTNIIVVNVNQPRSAADLTMA--LNNKGIKCSTFGPSTIRMVTHINVSKEDIDY  334

Query  283  AL  278
            AL
Sbjct  335  AL  336



>ref|XP_006442684.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442685.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442686.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442687.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55924.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55925.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55926.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55927.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=297

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGL  467
            K FI +AR +RKTLGGGMRQ+GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL
Sbjct  221  KEFIKKARRLRKTLGGGMRQVGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGL  280

Query  466  EVDMASVETNIV  431
             VD+ +VETNIV
Sbjct  281  RVDVDAVETNIV  292



>ref|WP_013778623.1| threonine aldolase [Tepidanaerobacter acetatoxydans]
 ref|YP_007272437.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 gb|AEE91700.1| Threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 emb|CCP26461.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
Length=344

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 72/126 (57%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI +AR  RK LGGGMRQ G L AA +V  ++   +L  DH  A+ LAEGLN I G+ 
Sbjct  215  KDFILKARKFRKMLGGGMRQAGFLAAAGIVALEKMTSRLSEDHNNARILAEGLNNIPGVN  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +DM +V+TNI+ CDI      +  E   +L E G+ +       +RFV H+ I+  D+  
Sbjct  275  IDMETVQTNIILCDI-SGLKMSANEFSAKLYEKGIRVNGGSTATVRFVTHYWITKEDINT  333

Query  283  ALSRVQ  266
             L  V+
Sbjct  334  VLEAVK  339



>ref|WP_013275483.1| threonine aldolase [Thermosediminibacter oceani]
 gb|ADL07436.1| L-threonine aldolase [Thermosediminibacter oceani DSM 16646]
Length=347

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 72/118 (61%), Gaps = 1/118 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI+RAR  RK LGGG+RQ G L AA +V  ++   +L+ DH+ A+ LAEGLN I G+ 
Sbjct  216  RDFINRARKFRKMLGGGLRQAGFLAAAGIVALEKMTERLKEDHENARLLAEGLNSIPGIS  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDV  290
            +DM +V+TNIV CDI      +  EL  RL E G+ I       +RFV H+ I   DV
Sbjct  276  IDMKTVQTNIVICDI-SGLGISGNELAGRLLEKGIKINGGSGSLVRFVTHYGIDKNDV  332



>ref|WP_008074850.1| threonine aldolase [Vibrio sinaloensis]
 gb|EGA71253.1| Threonine aldolase [Vibrio sinaloensis DSM 21326]
Length=335

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI+RAR +RK +GGGMRQ G+L AA  +   E V +L+ DH+ AK LA GL+K+ G  
Sbjct  210  KAFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVEQLKTDHENAKKLALGLSKLDGFH  269

Query  463  VDMASVETNIVFCDILKEANTTEME-LCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQ  287
            V+   V+TNIVF    K  ++ ++E + K+L+  G+ I P  P  IRFV H  IS  D+ 
Sbjct  270  VNPDFVQTNIVFA---KLDDSVDIETIAKQLSHDGITISPGNP--IRFVTHKDISSADID  324

Query  286  YALSRV  269
              L+R+
Sbjct  325  QVLARL  330



>ref|WP_008216429.1| threonine aldolase [Vibrionales bacterium SWAT-3]
 gb|EDK30742.1| L-allo-threonine aldolase [Vibrionales bacterium SWAT-3]
Length=336

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   ENV +L+ DH+ AK LA GL+K+ G  
Sbjct  210  KEYIAKARRLRKMVGGGMRQAGILAAAGKMALTENVTQLKADHENAKNLAIGLSKLEGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF  + +  +     +   L+E G+ + P  P  +RFV H  IS  D+  
Sbjct  270  VNPDFVQTNIVFAKLDESVDIN--RIAGELSEQGITMTPGNP--VRFVTHRDISAEDISR  325

Query  283  ALSRVQRAVT  254
             L+ +Q+A+T
Sbjct  326  FLNELQKALT  335



>gb|AFW86293.1| putative threonine aldolase family protein [Zea mays]
Length=325

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGGMRQ+GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + 
Sbjct  247  KAFIDKARILRKTLGGGMRQVGVLCAAAHVVVRDTVGKLADDHRKAKALAEGLKKIEQIT  306

Query  463  VDMASVETNI  434
            VD+ASVETN+
Sbjct  307  VDLASVETNM  316



>ref|WP_006069652.1| threonine aldolase [Vibrio shilonii]
 gb|EDL55592.1| L-allo-threonine aldolase [Vibrio shilonii AK1]
Length=335

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI+RAR +RK +GGGMRQ G+L AA  +   E V +L+ DH  AK LA GLN ISG  
Sbjct  210  KAFIERARRLRKMVGGGMRQAGILAAAGKLALTEQVDQLKLDHANAKKLALGLNDISGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF  + +        + + LA+ G+ I P  P  IRFV H  IS  D+  
Sbjct  270  VNADFVQTNIVFAKLDESVKID--AIAESLAKEGITITPGNP--IRFVTHKDISSDDIDT  325

Query  283  ALSRVQRAV  257
             L +V+  V
Sbjct  326  LLQKVRELV  334



>ref|WP_034132280.1| threonine aldolase [Peptococcaceae bacterium BICA1-8]
Length=339

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI RA   +K LGGG RQIG++ AA +V  +  + +LE DH +AK LA GL+++  L 
Sbjct  213  QEFISRAAKWKKMLGGGFRQIGIMAAAGIVALETMIDRLEEDHVRAKKLAHGLSELPYLS  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V    +ETNIV  +I+ E  T + E   +LAE+G++    GP ++RFV H +I+D D+  
Sbjct  273  VCSDEIETNIVIVEIISELITMK-EFLAKLAENGIMAKDIGPTKVRFVTHKEINDDDINL  331

Query  283  ALSRVQ  266
             + R+ 
Sbjct  332  VIERLS  337



>ref|WP_011196526.1| threonine aldolase [Symbiobacterium thermophilum]
 dbj|BAD41388.1| threonine aldolase [Symbiobacterium thermophilum IAM 14863]
Length=346

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI  AR  RK LGGGMRQ GVL AA LV  +  + +L  DH  A+ LAEG+  I GL 
Sbjct  215  REFIAEARRYRKLLGGGMRQAGVLAAAGLVALEMMIDRLADDHANARRLAEGIAGIPGLR  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+ +V+TN+V  +I+ E   T     + L   GVL    GP+ +R V H  ++  DV+ 
Sbjct  275  VDLETVQTNMVVVEIVDE-RWTAGAFVQALRTQGVLCNDTGPRSVRLVTHKDVTAADVEL  333

Query  283  ALSRVQRAV  257
            AL  + R V
Sbjct  334  ALDAIARTV  342



>ref|WP_018133494.1| hypothetical protein [Effusibacillus pohliae]
Length=345

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + FI+ AR  RK LGGGMRQ GV+ A A+V   E V +L  DH+ A+ LA  L ++ G +
Sbjct  215  RDFIEAARQWRKRLGGGMRQAGVIAAPAIVALTEMVDRLAEDHENARRLALALAEMKGWQ  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD   VETNIV  D+     +   E    LA+ GVL +  G   IRFV H  +S +D++ 
Sbjct  275  VDPGLVETNIVIADVAGTGRSA-TEWLDWLAKEGVLAVDFGDTLIRFVTHKDVSSSDLEE  333

Query  283  ALSRVQRAV  257
            A+ R+ R V
Sbjct  334  AIRRIHRVV  342



>ref|WP_006447171.1| threonine aldolase [Alicyclobacillus hesperidum]
 gb|EJY55439.1| O-acetylhomoserine/O-acetylserine sulfhydrylase [Alicyclobacillus 
hesperidum URH17-3-68]
Length=350

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++ IDRAR+ RK LGGG+RQ GVL A  +      V +L  DH  AK LAE L  + G+ 
Sbjct  216  RAMIDRARVWRKRLGGGLRQAGVLAAPCIWALTNMVERLAEDHAHAKVLAERLANMPGIA  275

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++ +V+TNIV  ++  E    E      LA +GVL    GP+ +RFV H  ++  DV+ 
Sbjct  276  VNLETVQTNIVLAELTHEDVMAE-PFIAELANNGVLATAFGPRTVRFVTHKDVNQADVEM  334

Query  283  ALSRVQRAV  257
            A+ R+++ +
Sbjct  335  AVDRIRQTI  343



>ref|WP_038083758.1| threonine aldolase [Tumebacillus flagellatus]
 gb|KEO85216.1| threonine aldolase [Tumebacillus flagellatus]
Length=344

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++ I++AR+ RK  GGG+RQ+GVL A AL+   +NV +L  DH  AK LAEGL +I GL 
Sbjct  213  RATIEQARVWRKRFGGGLRQVGVLAAPALLALTQNVERLAEDHANAKFLAEGLAQIPGLA  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D A+V+TNIV  +I      +E  L   L + G+L    GP+ +RFV H  IS  D+  
Sbjct  273  IDPATVDTNIVIVNIAG-LGVSETVLIDELKKSGILCGGFGPQLVRFVTHLNISKADIVS  331

Query  283  ALSRVQRAVTGVA  245
            AL  +QR V G+A
Sbjct  332  ALETIQRVVRGLA  344



>ref|WP_017025760.1| threonine aldolase [Vibrio rumoiensis]
Length=335

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI +AR +RK LGGGMRQ G+L AA  +   E + +L+ DH  A+ LA+GLN + G E
Sbjct  210  KAFITKARRIRKMLGGGMRQAGILAAAGKLALTEQIDQLKVDHANAQILAQGLNTLPGFE  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V++  V+TNIVF  + +  NT  ++  + L + G++I    P  +RFV+H+ I+  DV  
Sbjct  270  VNLEQVQTNIVFTKVAEHINTAHLQ--QNLRKDGIIISSGNP--LRFVLHNDITQDDVHT  325

Query  283  ALSRV  269
             L ++
Sbjct  326  LLEKL  330



>ref|WP_027695975.1| threonine aldolase [Vibrio litoralis]
Length=337

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI RAR +RK LGGGMRQ G+L AA  +   E V +L+ DH  AK LA  L+++ G +
Sbjct  210  KEFITRARRIRKMLGGGMRQAGILAAAGKIALTEQVNRLQTDHDNAKRLATSLSELDGFD  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +++  V+TNIVF  +    +T  M+   +L + G++I    P  +RFV+H+ +  +DV  
Sbjct  270  INVEHVQTNIVFAKLAPHIDTLAMQ--SQLKKEGIIISSGNP--LRFVLHNDVQASDVDI  325

Query  283  ALSRVQRAVTG  251
             + R++R +T 
Sbjct  326  LVERIRRFITA  336



>ref|WP_027365759.1| threonine aldolase [Desulfotomaculum alcoholivorax]
Length=342

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            + F+DRAR  RK LGGGMRQ G+L AA LV    +V +L  DH  AK LA  L  + G++
Sbjct  216  REFVDRARKYRKVLGGGMRQAGILAAAGLVALG-SVDRLAEDHIHAKMLARSLAGVPGVQ  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VD+  V+TNI+  D+     T++ E    L E GVL +  GP  +R V H  +S  DV+Y
Sbjct  275  VDLDKVQTNIIVADVSGMGMTSD-EFVSVLEERGVLAITFGPTLVRLVTHRDVSREDVEY  333

Query  283  AL  278
            A+
Sbjct  334  AI  335



>ref|WP_038559128.1| threonine aldolase [Terribacillus aidingensis]
 gb|AIF65984.1| threonine aldolase [Terribacillus aidingensis]
Length=343

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FID+AR  RK LGGGMRQ G+L A  LV  +ENV +L  DH+ AK LA+GL +I G+E
Sbjct  213  KVFIDKARKWRKRLGGGMRQAGILAAPGLVALRENVERLADDHENAKLLADGLAEIDGIE  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            + M  VETNIV  D+ +    T     + L E  VL    GP  +RFV H+ +    ++ 
Sbjct  273  I-MNKVETNIVLADV-QGTGVTADAYVQLLKEQQVLANAFGPYSVRFVTHYDVGKGAIKK  330

Query  283  ALS  275
            AL+
Sbjct  331  ALA  333



>ref|WP_017109562.1| threonine aldolase [Vibrio tasmaniensis]
Length=334

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   ENV +L+ DH  AK LA GLNK+ G  
Sbjct  210  KEYIAKARRLRKMVGGGMRQAGILAAAGKMALTENVAQLKADHDNAKNLAIGLNKLEGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   ++TNIVF  + +  +     + + L E G+ + P  P  +RFV H  IS  D+  
Sbjct  270  VNPDFIQTNIVFAKLDESVDIN--RIARELGEQGITMSPGNP--VRFVTHRDISTEDIAR  325

Query  283  ALSRVQRAV  257
             L+ +++A+
Sbjct  326  FLTELEKAL  334



>ref|WP_004740139.1| threonine aldolase [Vibrio splendidus]
 gb|EGU42310.1| Threonine aldolase [Vibrio splendidus ATCC 33789]
Length=336

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   ENV +L+ DH+ AK LA GL+K+ G  
Sbjct  210  KEYIAKARRLRKMVGGGMRQAGILAAAGKMALTENVAQLKLDHENAKNLAIGLSKLEGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   V+TNIVF  + +  +     +   L+E G+ + P  P  +RFV H  IS  D+  
Sbjct  270  VNPDFVQTNIVFAKLDESVDIN--RIAGELSEQGITMTPGNP--VRFVTHRDISAEDISR  325

Query  283  ALSRVQRAVT  254
             L+ +Q+A+T
Sbjct  326  FLNELQKALT  335



>ref|WP_017067124.1| threonine aldolase [Vibrio crassostreae]
Length=334

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   ENV +L+ DH  AK LA GLNK+ G  
Sbjct  210  KEYIAKARRLRKMVGGGMRQAGILAAAGKMALTENVAQLKADHDNAKNLAIGLNKLEGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   ++TNIVF  + +  +     + + L E G+ + P  P  +RFV H  IS  D+  
Sbjct  270  VNPDFIQTNIVFAKLDESVDIN--RIARELGEQGITMSPGNP--VRFVTHRDISTEDIAR  325

Query  283  ALSRVQRAV  257
             L+ +++A+
Sbjct  326  FLTELEKAL  334



>tpg|DAA54991.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=476

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FID+ARI+RKTLGGG+RQ+GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + 
Sbjct  330  KAFIDKARILRKTLGGGIRQVGVLCAAAHVVVRDTVGKLADDHKKAKALAEGLKKIEQIT  389

Query  463  VDMASVETNI  434
            VD ASVETN+
Sbjct  390  VDSASVETNM  399



>ref|WP_044162565.1| threonine aldolase [Salinibacillus aidingensis]
Length=339

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI RAR  RK LGGG+RQ G++ A  +V   + V +L  DHK AK LA+G ++I GL 
Sbjct  213  KDFIQRARKWRKRLGGGLRQAGIIAAPGMVALTDMVDRLAEDHKNAKNLAQGFDRIDGLN  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   VETNI+  ++ K  + T  E  +RL E G+L    GP  +R V H  ++  D++ 
Sbjct  273  VE-NDVETNIIVLNV-KGTSYTASEFVERLKERGILAGALGPDSVRLVTHLDVTSEDIET  330

Query  283  ALSRVQ  266
            AL+ ++
Sbjct  331  ALTIIK  336



>ref|WP_022934098.1| threonine aldolase [Synergistetes bacterium JGI 0000079-D21]
Length=345

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K FI++AR  RK +GGGMRQ GVL AA LV  ++N+ +L  DH+ A  LAE L +   L 
Sbjct  215  KDFIEKARHWRKVVGGGMRQAGVLAAAGLVALRDNLARLAEDHENAAVLAERLEEGDHLS  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+     TN+V+  I KE  T E EL  R    GVL  P GPKR+R V H  +S +DV+ 
Sbjct  275  VEPCPRRTNMVYFGIRKEGLTAE-ELALRCRLKGVLFNPVGPKRVRLVTHLDVSRSDVRE  333

Query  283  A  281
            A
Sbjct  334  A  334



>ref|WP_015049145.1| threonine aldolase [Simiduia agarivorans]
 gb|AFV00995.1| Low-specificity L-threonine aldolase [Simiduia agarivorans SA1 
= DSM 21679]
Length=337

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (60%), Gaps = 5/131 (4%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K+FI RAR +RK LGGGMRQ G+L  A     + NV +L  DH  A+ LAEGLN++ G  
Sbjct  211  KAFIQRARRLRKMLGGGMRQAGILAVAGQYALENNVARLAEDHANARFLAEGLNQLDGFS  270

Query  463  VDMASVETNIVFCDILKEANTTEME-LCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQ  287
             D  +V TNIVF D+   A   +M+ + + LA+  +++ P G + +R V H  I+  DV+
Sbjct  271  TDAYAVHTNIVFVDV---APAVDMQAIARELAQQNLIVSP-GYQGMRLVTHKDIARADVE  326

Query  286  YALSRVQRAVT  254
              L+ + R V 
Sbjct  327  RLLAILARLVA  337



>gb|AIE93607.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote AD1000_39_C05]
 gb|AIF05204.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote KM3_181_A09]
Length=356

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            +SFID A   RK  GGGMRQ G+L AA L    ++V +L  DH +A+ LA  +N++ G  
Sbjct  231  RSFIDLAYRWRKMFGGGMRQAGILAAAGLYALDQHVERLAEDHDRARRLAAAVNEMDGYA  290

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            VDM SV+TN+V+   +  AN    ++  +LAEHGV  L      +R VIH  I+D D++ 
Sbjct  291  VDMNSVQTNMVY---ISTANGEAQKVVDQLAEHGVDTLTIDDSTVRAVIHLHITDEDIER  347

Query  283  ALS  275
            A++
Sbjct  348  AIA  350



>ref|WP_034217358.1| threonine aldolase, partial [Armatimonadetes bacterium JGI 0000077-K19]
Length=330

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = -2

Query  634  IDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDM  455
            IDRAR +RK LGGGMRQ GVL AA L     N  +L  DH++A+ LAE L+++   EVD+
Sbjct  216  IDRARRVRKMLGGGMRQSGVLAAAGLYALDHNRRRLADDHRRARRLAETLSELPNAEVDL  275

Query  454  ASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  278
            ASV+TN+V+      A+         LA+ GVL L  G  RIR V H  + D DV+ A+
Sbjct  276  ASVQTNMVYFSTSAPAD----RWVTALAQRGVLCLALGVHRIRLVTHLDVDDEDVERAV  330



>ref|WP_017104708.1| threonine aldolase [Vibrio tasmaniensis]
Length=336

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   ENV +L+ DH  AK LA GL+K+ G  
Sbjct  210  KEYITKARRLRKMVGGGMRQAGILAAAGKMALTENVAQLKADHDNAKNLAIGLHKLEGFS  269

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   ++TNIVF  + +  +     + + L E G+ + P  P  +RFV H  IS  D+  
Sbjct  270  VNPDFIQTNIVFAKLDESVDIN--RIARELDEQGITMSPGNP--VRFVTHRDISAEDIAR  325

Query  283  ALSRVQRAVT  254
             L+ +++A+T
Sbjct  326  FLTELEKALT  335



>dbj|GAK82526.1| low-specificity L-threonine aldolase [Vibrio ponticus]
Length=173

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            K +I +AR +RK +GGGMRQ G+L AA  +   E V +L+ DH  AK LAEGL++I G  
Sbjct  49   KEYIAKARRLRKMVGGGMRQAGILAAAGKLALTEQVKQLKQDHINAKRLAEGLSQIPGFA  108

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            V+   + TNIVF  + +  +     L  +LA+ G+ + P  P  +RFV H  IS  D++ 
Sbjct  109  VNTEFIHTNIVFAKLDERIDI--QSLATKLADDGITVTPGNP--MRFVTHKDISAQDIET  164

Query  283  ALSRVQRAV  257
             L ++ R V
Sbjct  165  CLEKIARYV  173



>ref|WP_011551549.1| threonine aldolase [Myxococcus xanthus]
 gb|ABF87719.1| L-allo-threonine aldolase [Myxococcus xanthus DK 1622]
Length=341

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (64%), Gaps = 5/127 (4%)
 Frame = -2

Query  634  IDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDM  455
            I  AR +RK LGGGMRQ G+L AAAL   + +V +L  DH  A+ LA GL ++ G+EVD 
Sbjct  218  IREARRLRKRLGGGMRQAGILAAAALHALEHHVERLADDHANARRLAAGLAELPGVEVDA  277

Query  454  ASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEG-PKRIRFVIHHQISDTDVQYAL  278
            + VETN+VF +  + A    +E+  RL +HGVL  P G P+ +R V H  +S  D+  AL
Sbjct  278  SRVETNMVFAEFSRSA----LEMVARLEQHGVLTNPAGAPRTLRLVTHLDVSAADIDEAL  333

Query  277  SRVQRAV  257
             R++RAV
Sbjct  334  QRIRRAV  340



>ref|WP_019178138.1| hypothetical protein [Methanomassiliicoccus luminyensis]
Length=353

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
              FI+RAR  RK LGGGMRQ G++ A  +V   + V +L+ DH  A+ LAE L    GL+
Sbjct  215  SDFIERARKKRKMLGGGMRQAGIIAAPGIVALNKMVPRLKEDHDNARRLAEYLGMFDGLK  274

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQY  284
            +D+++V+TN+V  D+  +   T  E   R AE G+LI   GP  +RFV H+ I+  DV  
Sbjct  275  IDLSTVQTNMVLVDV-ADTGLTGQEFRDRAAEKGLLISVFGPHLVRFVTHYGITAADVDE  333

Query  283  A  281
            A
Sbjct  334  A  334



>ref|WP_019839219.1| threonine aldolase [Aeromonas sp. MDS8]
Length=339

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = -2

Query  643  KSFIDRARIMRKTLGGGMRQIGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLE  464
            ++FI RAR +RK LGGGMRQ G+L  A L   +++V +L  DH++A+ LAEGL  + G+ 
Sbjct  213  RAFIARARRLRKMLGGGMRQAGILAQAGLFALEQHVARLADDHRRARRLAEGLAALPGIT  272

Query  463  VDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDV  290
            +D+A V+TN+VF  + KE +   +   K   E G+L    G   +R V H QI+D D+
Sbjct  273  LDLAQVQTNMVFLQLAKEQSGPLLAFMK---ERGILF--SGYGEMRLVTHLQITDDDI  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375