BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042H16

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771070.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...    106   2e-23   Nicotiana sylvestris
ref|XP_009771055.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...    107   2e-23   Nicotiana sylvestris
ref|XP_011091953.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...    100   4e-21   Sesamum indicum [beniseed]
ref|XP_008388668.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  97.4    5e-20   
ref|XP_006347760.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  96.7    8e-20   Solanum tuberosum [potatoes]
gb|EYU30517.1|  hypothetical protein MIMGU_mgv1a0020012mg             94.7    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_006347759.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  96.3    1e-19   Solanum tuberosum [potatoes]
ref|XP_009364517.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  96.3    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_006347761.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  95.9    1e-19   Solanum tuberosum [potatoes]
ref|XP_007208431.1|  hypothetical protein PRUPE_ppa002075mg           95.1    2e-19   Prunus persica
ref|XP_008218250.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  95.1    3e-19   Prunus mume [ume]
ref|XP_007030601.1|  Peptide n-glycanase, putative isoform 2          94.0    5e-19   
ref|XP_007030600.1|  Peptide n-glycanase, putative isoform 1          94.0    6e-19   
gb|KJB44979.1|  hypothetical protein B456_007G283500                  93.6    8e-19   Gossypium raimondii
ref|NP_001234560.1|  putative peptide:N-glycanase                     93.2    1e-18   
gb|KHG08709.1|  Peptide-N(4)- (N-acetyl-beta-glucosaminyl)asparag...  92.8    2e-18   Gossypium arboreum [tree cotton]
ref|XP_010323674.1|  PREDICTED: putative peptide:N-glycanase isof...  92.4    2e-18   Solanum lycopersicum
ref|XP_003554688.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  90.9    7e-18   Glycine max [soybeans]
emb|CDP08522.1|  unnamed protein product                              90.5    1e-17   Coffea canephora [robusta coffee]
ref|XP_003521744.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  89.4    2e-17   Glycine max [soybeans]
ref|XP_010260774.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  89.4    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006471648.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  88.2    5e-17   
emb|CDX85417.1|  BnaC07g27280D                                        88.6    5e-17   
ref|XP_006432973.1|  hypothetical protein CICLE_v10000348mg           88.6    6e-17   
ref|XP_006471647.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  88.2    7e-17   
ref|XP_010042658.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.0    7e-17   
gb|KHN31455.1|  Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagi...  87.4    1e-16   Glycine soja [wild soybean]
gb|KDP23653.1|  hypothetical protein JCGZ_23486                       87.0    1e-16   Jatropha curcas
gb|AFK46024.1|  unknown                                               84.7    1e-16   Lotus japonicus
ref|XP_004156458.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  85.5    4e-16   
ref|XP_004139229.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  85.5    4e-16   
ref|XP_009151289.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  85.9    4e-16   Brassica rapa
ref|XP_008798712.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  85.9    4e-16   Phoenix dactylifera
ref|XP_010102304.1|  Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asp...  85.5    4e-16   Morus notabilis
ref|XP_007147159.1|  hypothetical protein PHAVU_006G100800g           85.1    8e-16   Phaseolus vulgaris [French bean]
ref|XP_006282171.1|  hypothetical protein CARUB_v10028450mg           84.7    9e-16   Capsella rubella
ref|XP_010025052.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  84.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_008455865.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  84.0    1e-15   
ref|XP_004302040.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  84.3    1e-15   Fragaria vesca subsp. vesca
gb|KGN60818.1|  hypothetical protein Csa_2G011510                     83.6    2e-15   Cucumis sativus [cucumbers]
ref|XP_009397207.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  84.0    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397208.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  83.6    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199768.1|  peptide-N(4)-(N-acetyl-beta-glucosaminyl)aspara...  83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626428.1|  Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asp...  83.2    3e-15   Medicago truncatula
gb|AAO24593.1|  At5g49570                                             83.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865742.1|  hypothetical protein ARALYDRAFT_495017           83.2    3e-15   Arabidopsis lyrata subsp. lyrata
tpg|DAA40890.1|  TPA: putative peptide N-glycanase                    82.4    4e-15   
ref|XP_010482233.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.8    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010482232.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  83.2    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004494690.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.8    4e-15   Cicer arietinum [garbanzo]
ref|XP_006395051.1|  hypothetical protein EUTSA_v10003714mg           82.8    4e-15   Eutrema salsugineum [saltwater cress]
ref|NP_001159289.1|  uncharacterized protein LOC100304380             79.7    4e-15   
emb|CDX86227.1|  BnaA06g29440D                                        82.8    4e-15   
ref|XP_006658579.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.8    5e-15   
ref|XP_010440773.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.4    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004494689.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.4    5e-15   
ref|XP_008455847.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  82.4    6e-15   Cucumis melo [Oriental melon]
gb|EEC82091.1|  hypothetical protein OsI_26093                        82.0    8e-15   Oryza sativa Indica Group [Indian rice]
gb|EEE67221.1|  hypothetical protein OsJ_24339                        81.6    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002512221.1|  peptide n-glycanase, putative                    81.3    1e-14   Ricinus communis
ref|XP_008668233.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  81.3    1e-14   
ref|XP_010025054.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  81.3    1e-14   Eucalyptus grandis [rose gum]
gb|KCW61644.1|  hypothetical protein EUGRSUZ_H04377                   80.5    2e-14   Eucalyptus grandis [rose gum]
ref|XP_011091954.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.5    2e-14   Sesamum indicum [beniseed]
ref|XP_002319053.2|  hypothetical protein POPTR_0013s03720g           80.5    3e-14   
ref|XP_010546598.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.1    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_011004274.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.1    4e-14   Populus euphratica
ref|XP_011004273.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.1    4e-14   Populus euphratica
ref|XP_011004275.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.1    4e-14   Populus euphratica
ref|XP_002462888.1|  hypothetical protein SORBIDRAFT_02g033840        80.1    4e-14   Sorghum bicolor [broomcorn]
ref|XP_011004282.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  80.1    4e-14   Populus euphratica
ref|XP_011004276.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  79.7    5e-14   Populus euphratica
ref|XP_011004271.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  79.7    5e-14   Populus euphratica
gb|KJB44981.1|  hypothetical protein B456_007G283500                  79.3    5e-14   Gossypium raimondii
ref|XP_003563069.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  78.6    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_010675069.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  78.6    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004957755.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  78.2    2e-13   
ref|XP_004957754.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  78.2    2e-13   Setaria italica
ref|XP_002278422.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  77.4    3e-13   Vitis vinifera
ref|XP_011004272.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  76.3    8e-13   Populus euphratica
ref|XP_010923840.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  75.5    1e-12   Elaeis guineensis
dbj|BAK01337.1|  predicted protein                                    74.7    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT05979.1|  Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagi...  72.8    9e-12   
gb|EMS49634.1|  Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagi...  72.8    1e-11   Triticum urartu
gb|ABR16638.1|  unknown                                               70.9    4e-11   Picea sitchensis
gb|KFK26602.1|  hypothetical protein AALP_AA8G270100                  70.5    7e-11   Arabis alpina [alpine rockcress]
ref|XP_011005718.1|  PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco...  66.2    7e-10   Populus euphratica
ref|XP_006853458.1|  hypothetical protein AMTR_s00032p00190520        65.5    3e-09   
ref|XP_002961131.1|  hypothetical protein SELMODRAFT_402772           63.9    7e-09   
ref|XP_002966880.1|  hypothetical protein SELMODRAFT_87223            63.5    1e-08   
emb|CDP08527.1|  unnamed protein product                              58.2    2e-08   Coffea canephora [robusta coffee]
ref|XP_002961130.1|  hypothetical protein SELMODRAFT_402770           62.4    2e-08   
ref|WP_042143806.1|  hypothetical protein                             52.4    5e-05   Pseudoalteromonas
ref|WP_010491675.1|  coagulation factor 5/8 type-like protein         50.1    3e-04   Paenibacillus elgii
ref|WP_041843089.1|  alpha-mannosidase                                50.1    3e-04   
gb|AGZ44993.1|  alpha-1,2-mannosidase                                 50.1    3e-04   Actinoplanes friuliensis DSM 7358
ref|WP_025851809.1|  hypothetical protein                             49.3    4e-04   Paenibacillus ehimensis
ref|WP_034244534.1|  hypothetical protein                             48.9    5e-04   
ref|WP_036682319.1|  hypothetical protein                             48.9    5e-04   Paenibacillus tyrfis



>ref|XP_009771070.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X3 [Nicotiana sylvestris]
Length=618

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDKQ +Q+FDK FQRKT+TV S  +LAN F + FLAV+
Sbjct  539  PERDPKDWVLEGSENGGSSWHLLDKQTSQMFDKRFQRKTFTVSSPGYLANAFRLRFLAVR  598

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N  FQIG I  Y   S
Sbjct  599  DANANSRFQIGSIDLYASSS  618



>ref|XP_009771055.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Nicotiana sylvestris]
Length=753

 Score =   107 bits (266),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDKQ +Q+FDK FQRKT+TV S  +LAN F + FLAV+
Sbjct  674  PERDPKDWVLEGSENGGSSWHLLDKQTSQMFDKRFQRKTFTVSSPGYLANAFRLRFLAVR  733

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N  FQIG I  Y   S
Sbjct  734  DANANSRFQIGSIDLYASSS  753



>ref|XP_011091953.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Sesamum indicum]
Length=726

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q FDK FQRKT+ VKS SFLAN F   FLAV+
Sbjct  643  PERDPIDWIIEGSEDGGSSWRILDKQTSQKFDKRFQRKTFAVKSPSFLANAFRFRFLAVR  702

Query  313  EGWENPGFQIGGIVFYGR  260
            +   N  FQIG I  Y +
Sbjct  703  DVISNSRFQIGSIDLYAK  720



>ref|XP_008388668.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Malus domestica]
Length=725

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SWH+LDKQ +Q+FD  FQRKT+ + SQ FLAN F   FLAV+
Sbjct  646  PERDPMDWVVEGSNDEGSSWHLLDKQTSQVFDSRFQRKTFQIASQGFLANAFRFRFLAVK  705

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N   Q+G I  Y R S
Sbjct  706  DVQSNSRLQLGSIDLYSRSS  725



>ref|XP_006347760.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Solanum tuberosum]
Length=725

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDK+ +Q+FDK FQRK +TV S  +L+N F   FLAVQ
Sbjct  646  PERDPKDWVLEGSENGGSSWHLLDKRTSQMFDKRFQRKAFTVSSPGYLSNAFRFRFLAVQ  705

Query  313  EGWENPGFQIGGIVFYGRGS  254
                   FQIG I  +   S
Sbjct  706  GKNATSRFQIGSIDLFAGSS  725



>gb|EYU30517.1| hypothetical protein MIMGU_mgv1a0020012mg, partial [Erythranthe 
guttata]
Length=453

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LDK+ ++ FDK +QRKTY VKSQSFLAN F   F AV+
Sbjct  368  PERDPTDWILEGSGDGGSSWHILDKRTSEKFDKRYQRKTYQVKSQSFLANAFRFRFQAVR  427

Query  313  EGWENPGFQIGGIVFYGRG  257
            +      FQIG I  Y + 
Sbjct  428  DVKSTSRFQIGSIDLYMKA  446



>ref|XP_006347759.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Solanum tuberosum]
Length=735

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDK+ +Q+FDK FQRK +TV S  +L+N F   FLAVQ
Sbjct  656  PERDPKDWVLEGSENGGSSWHLLDKRTSQMFDKRFQRKAFTVSSPGYLSNAFRFRFLAVQ  715

Query  313  EGWENPGFQIGGIVFYGRGS  254
                   FQIG I  +   S
Sbjct  716  GKNATSRFQIGSIDLFAGSS  735



>ref|XP_009364517.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Pyrus x bretschneideri]
Length=725

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SWH+LDKQ +Q+FD  FQRKT+ + SQ FLAN F   FLAV+
Sbjct  646  PERDPMDWVVEGSNDEGSSWHLLDKQTSQVFDSRFQRKTFQIASQGFLANAFRFRFLAVK  705

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N   Q+G I  Y R S
Sbjct  706  DVQSNSRLQLGSIDLYSRRS  725



>ref|XP_006347761.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X3 [Solanum tuberosum]
Length=618

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDK+ +Q+FDK FQRK +TV S  +L+N F   FLAVQ
Sbjct  539  PERDPKDWVLEGSENGGSSWHLLDKRTSQMFDKRFQRKAFTVSSPGYLSNAFRFRFLAVQ  598

Query  313  EGWENPGFQIGGIVFYGRGS  254
                   FQIG I  +   S
Sbjct  599  GKNATSRFQIGSIDLFAGSS  618



>ref|XP_007208431.1| hypothetical protein PRUPE_ppa002075mg [Prunus persica]
 gb|EMJ09630.1| hypothetical protein PRUPE_ppa002075mg [Prunus persica]
Length=720

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LDKQ +QIFD  FQRKT+ +  Q FL+NVF   FL V+
Sbjct  641  PERDPMDWVVEGSNDGESSWHLLDKQTSQIFDSRFQRKTFKISCQGFLSNVFRFRFLTVR  700

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       Q+G I  Y R S
Sbjct  701  DVLSTSRLQLGSIDLYSRSS  720



>ref|XP_008218250.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Prunus mume]
Length=720

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LDKQ +QIFD  FQRKT+ +  Q FL+NVF   FL V+
Sbjct  641  PERDPMDWVVEGSNDGESSWHLLDKQTSQIFDSRFQRKTFKISCQGFLSNVFRFRFLTVR  700

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       Q+G I  Y R S
Sbjct  701  DVQSTSRLQLGSIDLYSRSS  720



>ref|XP_007030601.1| Peptide n-glycanase, putative isoform 2 [Theobroma cacao]
 gb|EOY11103.1| Peptide n-glycanase, putative isoform 2 [Theobroma cacao]
Length=588

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWHVLDKQ +Q+F+K FQRKTY ++S  F +N F   FLA +
Sbjct  509  PERDPMDWVVEGSNDGGSSWHVLDKQTSQVFNKRFQRKTYKIRSTGFSSNTFRFRFLAAR  568

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       Q+G I  Y R S
Sbjct  569  DIQSTSRLQVGSIDLYARES  588



>ref|XP_007030600.1| Peptide n-glycanase, putative isoform 1 [Theobroma cacao]
 gb|EOY11102.1| Peptide n-glycanase, putative isoform 1 [Theobroma cacao]
Length=734

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWHVLDKQ +Q+F+K FQRKTY ++S  F +N F   FLA +
Sbjct  655  PERDPMDWVVEGSNDGGSSWHVLDKQTSQVFNKRFQRKTYKIRSTGFSSNTFRFRFLAAR  714

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       Q+G I  Y R S
Sbjct  715  DIQSTSRLQVGSIDLYARES  734



>gb|KJB44979.1| hypothetical protein B456_007G283500 [Gossypium raimondii]
Length=733

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWHVLD++ +++FDK FQRKTY VKS  FL+N+F   FLAV+
Sbjct  654  PERDPMDWVVEGSNDGGSSWHVLDERRSEMFDKRFQRKTYNVKSAGFLSNMFRFRFLAVR  713

Query  313  EGWENPGFQIGGIVFYGR  260
            +       Q+G I  Y +
Sbjct  714  DVKSTSQLQVGSIDLYAK  731



>ref|NP_001234560.1| putative peptide:N-glycanase [Solanum lycopersicum]
 gb|ADM13644.1| putative peptide:N-glycanase [Solanum lycopersicum]
Length=725

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDK+ +Q+FDK FQRK + V S  +L+N F   F+AV+
Sbjct  646  PERDPKDWVLEGSENGGSSWHLLDKRTSQMFDKRFQRKAFAVGSSGYLSNAFRFRFIAVR  705

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +      FQIG I  +   S
Sbjct  706  DKNATSRFQIGSIDLFAGSS  725



>gb|KHG08709.1| Peptide-N(4)- (N-acetyl-beta-glucosaminyl)asparagine amidase 
-like protein [Gossypium arboreum]
Length=733

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWHVLD++ +++FDK F+RKTY VKS  FL+N+F   FLAV+
Sbjct  654  PERDPMDWVVEGSNDGGLSWHVLDERRSEMFDKRFRRKTYNVKSTGFLSNMFRFRFLAVR  713

Query  313  EGWENPGFQIGGIVFYGR  260
            +       Q+G I  Y +
Sbjct  714  DVKSTSRLQVGSIDLYAK  731



>ref|XP_010323674.1| PREDICTED: putative peptide:N-glycanase isoform X1 [Solanum lycopersicum]
Length=618

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS NG  SWH+LDK+ +Q+FDK FQRK + V S  +L+N F   F+AV+
Sbjct  539  PERDPKDWVLEGSENGGSSWHLLDKRTSQMFDKRFQRKAFAVGSSGYLSNAFRFRFIAVR  598

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +      FQIG I  +   S
Sbjct  599  DKNATSRFQIGSIDLFAGSS  618



>ref|XP_003554688.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Glycine max]
Length=715

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F+  FQR+TYT+ S SF  NVF   FLAV+
Sbjct  636  PERDPMDWILEGSSDDGISWQVLDKQTSQFFEDRFQRRTYTISSASFPCNVFRFRFLAVR  695

Query  313  EGWENPGFQIGGIVFYGR  260
            +   N   QIG I  Y +
Sbjct  696  DIQSNSRLQIGSIDLYAK  713



>emb|CDP08522.1| unnamed protein product [Coffea canephora]
Length=722

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +WH+LD++ +Q+F++ FQRK + VKS   LAN F + FLAV+
Sbjct  638  PERDPLDWVLEGSQDGGLNWHILDEKTSQMFEERFQRKVFEVKSPGILANAFRLRFLAVR  697

Query  313  EGWENPGFQIGGIVFYGRG  257
            +      FQIG I FY + 
Sbjct  698  DPKATSRFQIGSIDFYSKA  716



>ref|XP_003521744.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Glycine max]
Length=720

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F+  FQR+TYT+ S +F  NVF   FLAV+
Sbjct  636  PERDPMDWILEGSSDDGISWQVLDKQTSQFFEDRFQRRTYTISSANFPCNVFRFRFLAVR  695

Query  313  EGWENPGFQIGGIVFYGR  260
            +   N   QIG I  Y +
Sbjct  696  DIQSNSRLQIGSIDLYAK  713



>ref|XP_010260774.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Nelumbo nucifera]
Length=715

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW+VLDKQ++QIF K FQRKT+ + S   L+N F   FLAV+
Sbjct  636  PERDPMDWVVEGSDDGGSSWYVLDKQMSQIFTKRFQRKTFKIGSTHRLSNAFRFRFLAVR  695

Query  313  EGWENPGFQIGGIVFYGRGS  254
               +    QIG I  + R S
Sbjct  696  NAQQTTRLQIGSIDLFARTS  715



>ref|XP_006471648.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Citrus sinensis]
Length=592

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  +GS +G  SWHVLDKQ +Q+F+  FQRKT+ +KS  FL+N F   FL V+
Sbjct  513  PERDPMDWVLDGSNDGGSSWHVLDKQTSQMFENRFQRKTFKIKSTGFLSNAFRFRFLKVR  572

Query  313  EGWENPGFQIGGIVFYG  263
            +       QIG I  Y 
Sbjct  573  DVNSTSRMQIGSIDLYA  589



>emb|CDX85417.1| BnaC07g27280D [Brassica napus]
Length=723

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +WHV+DKQ +Q+F++ FQRK+Y + S  F AN+F   FL V+
Sbjct  644  PERDPKDWVLEGSNDGGSTWHVIDKQTSQVFEERFQRKSYKITSPGFQANLFRFRFLCVR  703

Query  313  EGWENPGFQIGGIVFYGR  260
            +       Q+G I  Y R
Sbjct  704  DVNSTSRLQLGSIDLYKR  721



>ref|XP_006432973.1| hypothetical protein CICLE_v10000348mg [Citrus clementina]
 gb|ESR46213.1| hypothetical protein CICLE_v10000348mg [Citrus clementina]
Length=780

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  +GS +G  SWHVLDKQ +Q+F+  FQRKT+ +KS  FL+N F   FL V+
Sbjct  701  PERDPMDWVLDGSNDGGSSWHVLDKQTSQMFENRFQRKTFKIKSTGFLSNAFRFRFLKVR  760

Query  313  EGWENPGFQIGGIVFYG  263
            +       QIG I  Y 
Sbjct  761  DVNSTSRMQIGSIDLYA  777



>ref|XP_006471647.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Citrus sinensis]
Length=724

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  +GS +G  SWHVLDKQ +Q+F+  FQRKT+ +KS  FL+N F   FL V+
Sbjct  645  PERDPMDWVLDGSNDGGSSWHVLDKQTSQMFENRFQRKTFKIKSTGFLSNAFRFRFLKVR  704

Query  313  EGWENPGFQIGGIVFYG  263
            +       QIG I  Y 
Sbjct  705  DVNSTSRMQIGSIDLYA  721



>ref|XP_010042658.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Eucalyptus grandis]
Length=103

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP +W  +GS +G  SWHVLD+Q +Q+F+  F+R+T+ +K++   +N F   FLAV+
Sbjct  24   PERDPMNWVLQGSSDGGSSWHVLDEQTSQLFNNRFERRTFKIKTKVPPSNAFRFKFLAVR  83

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N   Q+G I  Y R S
Sbjct  84   DVQSNSRLQLGSIDLYARCS  103



>gb|KHN31455.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Glycine 
soja]
Length=720

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F+  FQR+TYT+ S +F  NVF   FLAV+
Sbjct  636  PERDPMDWILEGSSDDGISWRVLDKQTSQFFEDRFQRRTYTISSANFPCNVFRFRFLAVR  695

Query  313  EGWENPGFQIGGIVFYGR  260
                N   QIG I  Y +
Sbjct  696  YIQSNSRLQIGSIDLYAK  713



>gb|KDP23653.1| hypothetical protein JCGZ_23486 [Jatropha curcas]
Length=730

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EG+ +G  SW VLDKQ +Q+FD  FQR+++ ++S+ FL N F   FLAV+
Sbjct  647  PERDPMDWLVEGTNDGGSSWLVLDKQTSQVFDNRFQRRSFKIRSEGFLCNTFRFRFLAVR  706

Query  313  EGWENPGFQIGGIVFYGRG  257
            +       Q+G I  Y + 
Sbjct  707  DVQSTSRLQLGSIDLYAKA  725



>gb|AFK46024.1| unknown [Lotus japonicus]
Length=338

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F+  FQR+TYT+ S SF +NVF   FLAV+
Sbjct  257  PERDPMDWILEGSNDKGISWQVLDKQTSQFFEDRFQRRTYTINSASFPSNVFRFRFLAVR  316

Query  313  EGWENPGFQIGGIVFYGR  260
            +       QIG I  Y +
Sbjct  317  DINFTSRLQIGSIDLYAK  334



>ref|XP_004156458.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Cucumis sativus]
Length=611

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LD+Q  QIFD  FQR+++ V     L+N F   FLAV+
Sbjct  532  PERDPMDWIVEGSEDGGSSWHLLDEQTNQIFDNRFQRRSFFVTKTGLLSNTFRFRFLAVR  591

Query  313  EGWENPGFQIGGIVFYG  263
            +G      QIG I  Y 
Sbjct  592  DGEATSRLQIGSIDLYA  608



>ref|XP_004139229.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Cucumis sativus]
Length=611

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LD+Q  QIFD  FQR+++ V     L+N F   FLAV+
Sbjct  532  PERDPMDWIVEGSEDGGSSWHLLDEQTNQIFDNRFQRRSFFVTKTGLLSNTFRFRFLAVR  591

Query  313  EGWENPGFQIGGIVFYG  263
            +G      QIG I  Y 
Sbjct  592  DGEATSRLQIGSIDLYA  608



>ref|XP_009151289.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Brassica rapa]
Length=722

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +WHV+DKQ +Q+F++ FQRK+Y + S    AN+F   FL V+
Sbjct  643  PERDPKDWVLEGSNDGGLTWHVIDKQTSQVFEERFQRKSYKITSPGLQANLFRFRFLCVR  702

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  703  DVNSTSRLQLGSIDLY  718



>ref|XP_008798712.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Phoenix dactylifera]
Length=714

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW+VLDK+ +QIF+K FQRKT++V ++  + N F   FLAV+
Sbjct  636  PERDPVDWIVEGSDDGGSSWNVLDKRSSQIFEKRFQRKTFSVGTRC-MCNAFRFHFLAVR  694

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +      FQIG I  YG+ S
Sbjct  695  DPKATSRFQIGSIDLYGKSS  714



>ref|XP_010102304.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Morus 
notabilis]
 gb|EXB93247.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Morus 
notabilis]
Length=718

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LDKQ +Q FD  FQR+TY V S    +N F   FLAV+
Sbjct  642  PERDPMDWVLEGSDDGGSSWHILDKQTSQKFDGRFQRRTYKVASSCLPSNAFRFRFLAVR  701

Query  313  EGWENPGFQIGGIVFY  266
            +       QIG I  Y
Sbjct  702  DVHSTSRLQIGSIDLY  717



>ref|XP_007147159.1| hypothetical protein PHAVU_006G100800g [Phaseolus vulgaris]
 gb|ESW19153.1| hypothetical protein PHAVU_006G100800g [Phaseolus vulgaris]
Length=729

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F+  FQR+TY +   SF  NVF   FLAV+
Sbjct  650  PERDPMDWILEGSSDKGISWQVLDKQTSQFFEDRFQRRTYKIGCASFPCNVFRFRFLAVK  709

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       QIG I  Y + +
Sbjct  710  DVHSTSRLQIGSIDLYAKST  729



>ref|XP_006282171.1| hypothetical protein CARUB_v10028450mg [Capsella rubella]
 gb|EOA15069.1| hypothetical protein CARUB_v10028450mg [Capsella rubella]
Length=722

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ  Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  643  PERDPKDWILEGSNDGGSTWSVLDKQTCQVFEERFQRKSYKITTHGFQANLFRFRFLSVR  702

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  703  DVNSTSRLQLGSIDLY  718



>ref|XP_010025052.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Eucalyptus grandis]
 ref|XP_010025053.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Eucalyptus grandis]
 gb|KCW61645.1| hypothetical protein EUGRSUZ_H04378 [Eucalyptus grandis]
Length=726

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP +W  EGS +G  SWHVLD+Q +Q+F+  F+R+T+ +K++   +N F   FLAV+
Sbjct  647  PERDPMNWVLEGSSDGGSSWHVLDEQTSQLFNNRFERRTFKIKTKVPPSNAFRFRFLAVR  706

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N   Q+G I  Y R S
Sbjct  707  DVQSNSRLQLGSIDLYARCS  726



>ref|XP_008455865.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X2 [Cucumis melo]
Length=615

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH++D+Q  QIFD  FQR+++ V     L+N F   FLAV+
Sbjct  532  PERDPMDWIVEGSEDGGNSWHLIDEQTNQIFDNRFQRRSFFVTKTGLLSNTFRFRFLAVR  591

Query  313  EGWENPGFQIGGIVFYG  263
            +G      QIG I  Y 
Sbjct  592  DGESTSRLQIGSIDLYA  608



>ref|XP_004302040.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Fragaria vesca subsp. vesca]
Length=722

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  E S +G  SWH++DK+ +Q+FD  FQ +T+ V S+ FL+N F   FL V+
Sbjct  643  PERDPMDWVVERSNDGGSSWHLIDKRTSQLFDSRFQCRTFKVSSEGFLSNAFRFRFLRVR  702

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +   N   Q+G I  Y R S
Sbjct  703  DIQSNSRLQLGSIDLYSRSS  722



>gb|KGN60818.1| hypothetical protein Csa_2G011510 [Cucumis sativus]
Length=621

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH+LD+Q  QIFD  FQR+++ V     L+N F   FLAV+
Sbjct  532  PERDPMDWIVEGSEDGGSSWHLLDEQTNQIFDNRFQRRSFFVTKTGLLSNTFRFRFLAVR  591

Query  313  EGWENPGFQIGGI  275
            +G      QIG I
Sbjct  592  DGEATSRLQIGSI  604



>ref|XP_009397207.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Musa acuminata subsp. malaccensis]
Length=713

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW+VLD+Q +QIF++ FQRKT+ VK +  ++  F   FLA +
Sbjct  635  PERDPMDWIVEGSEDGGSSWNVLDEQNSQIFERRFQRKTFMVKKKC-MSKAFRFRFLAAR  693

Query  313  EGWENPGFQIGGIVFYGR  260
            +   N  FQIGGI  Y +
Sbjct  694  DVKANSRFQIGGIDLYAK  711



>ref|XP_009397208.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X2 [Musa acuminata subsp. malaccensis]
Length=661

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW+VLD+Q +QIF++ FQRKT+ VK +  ++  F   FLA +
Sbjct  583  PERDPMDWIVEGSEDGGSSWNVLDEQNSQIFERRFQRKTFMVKKKC-MSKAFRFRFLAAR  641

Query  313  EGWENPGFQIGGIVFYGR  260
            +   N  FQIGGI  Y +
Sbjct  642  DVKANSRFQIGGIDLYAK  659



>ref|NP_199768.1| peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Arabidopsis 
thaliana]
 sp|Q9FGY9.1|PNG1_ARATH RecName: Full=Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase; AltName: Full=Peptide:N-glycanase; Short=AtPNG1 
[Arabidopsis thaliana]
 dbj|BAB10770.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM98206.1| unknown protein [Arabidopsis thaliana]
 gb|AAO30061.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00112.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAN87017.1| transglutaminase [Arabidopsis thaliana]
 gb|AED95831.1| peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Arabidopsis 
thaliana]
Length=721

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ +Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  642  PERDPKDWILEGSNDGGSTWCVLDKQTSQVFEERFQRKSYKITTPGFQANLFRFRFLSVR  701

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  702  DVNSTSRLQLGSIDLY  717



>ref|XP_003626428.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Medicago 
truncatula]
 gb|AES82646.1| peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Medicago 
truncatula]
Length=717

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F   FQR+TY + S SF +N+F   FLAV+
Sbjct  638  PERDPMDWILEGSNDEGTSWQVLDKQTSQFFKDRFQRRTYMINSASFPSNLFRFRFLAVK  697

Query  313  EGWENPGFQIGGIVFYGR  260
            +       QIG I  Y +
Sbjct  698  DIQSTSRLQIGSIDLYAK  715



>gb|AAO24593.1| At5g49570 [Arabidopsis thaliana]
Length=721

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ +Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  642  PERDPKDWILEGSNDGGSTWCVLDKQTSQVFEERFQRKSYKITTPGFQANLFRFRFLSVR  701

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  702  DVNSTSRLQLGSIDLY  717



>ref|XP_002865742.1| hypothetical protein ARALYDRAFT_495017 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42001.1| hypothetical protein ARALYDRAFT_495017 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ +Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  642  PERDPKDWVLEGSNDGGSTWCVLDKQTSQVFEERFQRKSYKITTPGFQANLFRFRFLSVR  701

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  702  DVNSTSRLQLGSIDLY  717



>tpg|DAA40890.1| TPA: putative peptide N-glycanase [Zea mays]
Length=495

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W++LD + +++F+  F RKT+TV  + + AN F   FL V+
Sbjct  417  PERDPMDWVLEGSADGGSTWNILDARNSEMFESRFLRKTFTV-DKRYKANAFRFRFLRVR  475

Query  313  EGWENPGFQIGGIVFYGR  260
            +   NP FQIG I  YG+
Sbjct  476  DSHSNPRFQIGSIDLYGK  493



>ref|XP_010482233.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Camelina sativa]
Length=639

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ  Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  560  PERDPKDWILEGSNDGGSTWCVLDKQTCQVFEERFQRKSYKITTPRFQANLFRFRFLSVR  619

Query  313  EGWENPGFQIGGIVFY  266
            +        +GGI  Y
Sbjct  620  DVNSTSRLHLGGIDLY  635



>ref|XP_010482232.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Camelina sativa]
Length=725

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ  Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  646  PERDPKDWILEGSNDGGSTWCVLDKQTCQVFEERFQRKSYKITTPRFQANLFRFRFLSVR  705

Query  313  EGWENPGFQIGGIVFY  266
            +        +GGI  Y
Sbjct  706  DVNSTSRLHLGGIDLY  721



>ref|XP_004494690.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Cicer arietinum]
Length=716

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F   FQR+TY + S SF +N+F   F+AV+
Sbjct  637  PERDPMDWILEGSNDEGISWQVLDKQNSQFFKDRFQRRTYMINSASFPSNIFRFRFVAVK  696

Query  313  EGWENPGFQIGGIVFYGR  260
            +       QIG I  Y +
Sbjct  697  DIQSTSRLQIGSIDLYAK  714



>ref|XP_006395051.1| hypothetical protein EUTSA_v10003714mg [Eutrema salsugineum]
 gb|ESQ32337.1| hypothetical protein EUTSA_v10003714mg [Eutrema salsugineum]
Length=732

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +WHVLDKQ  Q+F++ FQRK+Y + S    AN+F   FL  +
Sbjct  653  PERDPKDWVLEGSNDGGSTWHVLDKQTNQVFEERFQRKSYKITSPGIQANIFRFRFLCGR  712

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  713  DVNSTSRLQLGSIDLY  728



>ref|NP_001159289.1| uncharacterized protein LOC100304380 [Zea mays]
 gb|ACN25697.1| unknown [Zea mays]
Length=239

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W++LD + +++F+  F RKT+TV  + + AN F   FL V+
Sbjct  161  PERDPMDWVLEGSADGGSTWNILDARNSEMFESRFLRKTFTVDKR-YKANAFRFRFLRVR  219

Query  313  EGWENPGFQIGGIVFYGR  260
            +   NP FQIG I  YG+
Sbjct  220  DSHSNPRFQIGSIDLYGK  237



>emb|CDX86227.1| BnaA06g29440D [Brassica napus]
Length=724

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +WHV+DKQ +Q+F++ FQRK+Y + S    AN+F   FL  +
Sbjct  645  PERDPKDWVLEGSNDGGSTWHVIDKQTSQVFEERFQRKSYKITSPGLQANLFRFRFLCAR  704

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  705  DVNSTSRLQLGSIDLY  720



>ref|XP_006658579.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Oryza brachyantha]
Length=835

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+ +D + + IFD  F RKT+TV  +S+  N F   FL V+
Sbjct  757  PERDPMDWVLEGSADGGSTWNTIDARSSVIFDNRFYRKTFTV-DKSYKTNAFRFRFLRVR  815

Query  313  EGWENPGFQIGGIVFYGRGS  254
            E   NP FQIG I  YG+ +
Sbjct  816  ESNGNPRFQIGSIDLYGKST  835



>ref|XP_010440773.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Camelina sativa]
Length=722

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W VLDKQ  Q+F++ FQRK+Y + +  F AN+F   FL+V+
Sbjct  643  PERDPKDWVLEGSNDGGPTWCVLDKQTCQVFEERFQRKSYKITTPGFQANLFRFRFLSVR  702

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  703  DVNSTSRLQLGSIDLY  718



>ref|XP_004494689.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Cicer arietinum]
Length=744

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   SW VLDKQ +Q F   FQR+TY + S SF +N+F   F+AV+
Sbjct  665  PERDPMDWILEGSNDEGISWQVLDKQNSQFFKDRFQRRTYMINSASFPSNIFRFRFVAVK  724

Query  313  EGWENPGFQIGGIVFYGR  260
            +       QIG I  Y +
Sbjct  725  DIQSTSRLQIGSIDLYAK  742



>ref|XP_008455847.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Cucumis melo]
 ref|XP_008455857.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Cucumis melo]
Length=624

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SWH++D+Q  QIFD  FQR+++ V     L+N F   FLAV+
Sbjct  532  PERDPMDWIVEGSEDGGNSWHLIDEQTNQIFDNRFQRRSFFVTKTGLLSNTFRFRFLAVR  591

Query  313  EGWENPGFQIGGI  275
            +G      QIG I
Sbjct  592  DGESTSRLQIGSI  604



>gb|EEC82091.1| hypothetical protein OsI_26093 [Oryza sativa Indica Group]
Length=802

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+ +D + + IFD  F RKT+TV  + + AN F   FL V+
Sbjct  724  PERDPMDWVLEGSTDGGSTWNTIDARSSVIFDSRFYRKTFTV-DKRYKANAFRFRFLRVR  782

Query  313  EGWENPGFQIGGIVFYGRGS  254
            E   NP FQIG I  YG+ +
Sbjct  783  ESNGNPRFQIGSIDLYGKST  802



>gb|EEE67221.1| hypothetical protein OsJ_24339 [Oryza sativa Japonica Group]
Length=769

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+ +D + + IFD  F RKT+TV  + + AN F   FL V+
Sbjct  691  PERDPMDWVLEGSTDGGSTWNTIDARSSVIFDSRFYRKTFTV-DKRYKANAFRFRFLRVR  749

Query  313  EGWENPGFQIGGIVFYGRGS  254
            E   NP FQIG I  YG+ +
Sbjct  750  ESNGNPRFQIGSIDLYGKST  769



>ref|XP_002512221.1| peptide n-glycanase, putative [Ricinus communis]
 gb|EEF49673.1| peptide n-glycanase, putative [Ricinus communis]
Length=719

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -3

Query  490  ERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQE  311
            ERDP DW  EGS +G  SW VLDKQ +Q+F+   QRK++ ++S++F  N F   FLAV++
Sbjct  632  ERDPMDWVVEGSADGGSSWCVLDKQTSQVFENRCQRKSFNIRSENFFCNAFRFRFLAVKD  691

Query  310  GWENPGFQIGGIVFYGRGS*Y  248
                   Q+G I  Y   S Y
Sbjct  692  VQSTSRLQLGSIDLYASSSVY  712



>ref|XP_008668233.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100304380 
isoform X1 [Zea mays]
Length=725

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W++LD + +++F+  F RKT+TV  + + AN F   FL V+
Sbjct  647  PERDPMDWVLEGSADGGSTWNILDARNSEMFESRFLRKTFTV-DKRYKANAFRFRFLRVR  705

Query  313  EGWENPGFQIGGIVFYGR  260
            +   NP FQIG I  YG+
Sbjct  706  DSHSNPRFQIGSIDLYGK  723



>ref|XP_010025054.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Eucalyptus grandis]
 gb|KCW61643.1| hypothetical protein EUGRSUZ_H04377 [Eucalyptus grandis]
Length=710

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP +W  EGS +G  SWH+LD+Q +Q+F+  F+R+T+ +K++   +N F   FLAV+
Sbjct  631  PERDPMNWVLEGSSDGGSSWHILDEQTSQLFNNRFERRTFKIKTKVPPSNAFRFRFLAVR  690

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  691  DVQSNSRLQLGSIDLYA  707



>gb|KCW61644.1| hypothetical protein EUGRSUZ_H04377 [Eucalyptus grandis]
Length=604

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP +W  EGS +G  SWH+LD+Q +Q+F+  F+R+T+ +K++   +N F   FLAV+
Sbjct  525  PERDPMNWVLEGSSDGGSSWHILDEQTSQLFNNRFERRTFKIKTKVPPSNAFRFRFLAVR  584

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  585  DVQSNSRLQLGSIDLYA  601



>ref|XP_011091954.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X2 [Sesamum indicum]
Length=695

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVF  338
            PERDP DW  EGS +G  SW +LDKQ +Q FDK FQRKT+ VKS SFLAN F
Sbjct  643  PERDPIDWIIEGSEDGGSSWRILDKQTSQKFDKRFQRKTFAVKSPSFLANAF  694



>ref|XP_002319053.2| hypothetical protein POPTR_0013s03720g [Populus trichocarpa]
 gb|EEE94976.2| hypothetical protein POPTR_0013s03720g [Populus trichocarpa]
Length=757

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  678  PERDPMDWVVEGSDDGGSSWRILDKQTSQMFKNRFQRKSFKINSDSVPCNTFRFQFLAAR  737

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  738  DVQSNSRLQLGSIDLYA  754



>ref|XP_010546598.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Tarenaya hassleriana]
Length=730

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS-FLANVFGISFLAV  317
            PERDPKDW  EGS +G  +W VLD+Q +Q+F+  FQR +Y +K  + F AN+F   FLAV
Sbjct  652  PERDPKDWILEGSSDGGSTWRVLDEQTSQVFEARFQRNSYRIKPTTVFQANLFRFRFLAV  711

Query  316  QEGWENPGFQIGGIVFY  266
            ++       Q+G I  Y
Sbjct  712  RDVSSTSRLQLGSIDLY  728



>ref|XP_011004274.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Populus euphratica]
Length=757

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  678  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNAFRFQFLAAR  737

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  738  DVQSNSRLQLGSIDLYA  754



>ref|XP_011004273.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Populus euphratica]
Length=759

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  680  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNAFRFQFLAAR  739

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  740  DVQSNSRLQLGSIDLYA  756



>ref|XP_011004275.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X3 [Populus euphratica]
Length=737

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  658  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNAFRFQFLAAR  717

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  718  DVQSNSRLQLGSIDLYA  734



>ref|XP_002462888.1| hypothetical protein SORBIDRAFT_02g033840 [Sorghum bicolor]
 gb|EER99409.1| hypothetical protein SORBIDRAFT_02g033840 [Sorghum bicolor]
Length=727

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   +W++LD + +++F+  F RKT+TV  + + AN F   FL V+
Sbjct  649  PERDPMDWVLEGSTDAGSTWNLLDARNSEMFESRFLRKTFTV-DKRYKANAFRFRFLRVR  707

Query  313  EGWENPGFQIGGIVFYGR  260
            E   NP FQIG I  YG+
Sbjct  708  ESHSNPRFQIGSIDLYGK  725



>ref|XP_011004282.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Populus euphratica]
Length=893

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  814  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNAFRFQFLAAR  873

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  874  DVQSNSRLQLGSIDLYA  890



>ref|XP_011004276.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X4 [Populus euphratica]
Length=611

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  532  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNAFRFQFLAAR  591

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  592  DVQSNSRLQLGSIDLYA  608



>ref|XP_011004271.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Populus euphratica]
Length=759

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S   N F   FLA +
Sbjct  680  PERDPMDWIVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCNTFRFQFLAAR  739

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  740  DVQSNSRLQLGSIDLYA  756



>gb|KJB44981.1| hypothetical protein B456_007G283500 [Gossypium raimondii]
Length=706

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVF  338
            PERDP DW  EGS +G  SWHVLD++ +++FDK FQRKTY VKS  FL+N+F
Sbjct  654  PERDPMDWVVEGSNDGGSSWHVLDERRSEMFDKRFQRKTYNVKSAGFLSNMF  705



>ref|XP_003563069.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Brachypodium distachyon]
Length=719

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+ +D++ + +FD  F RKT+TV  +   AN F   FL  +
Sbjct  641  PERDPMDWILEGSTDGGSTWNTIDERSSVLFDSRFCRKTFTVDKRC-KANAFRFRFLRAR  699

Query  313  EGWENPGFQIGGIVFYGR  260
            E   NP FQIG I  YG+
Sbjct  700  ESTANPRFQIGSIDLYGK  717



>ref|XP_010675069.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Beta vulgaris subsp. vulgaris]
Length=735

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW+ LD+Q +Q FD  FQRK Y ++S    +N F  +FL+V+
Sbjct  647  PERDPMDWIVEGSSDGGSSWYALDRQTSQKFDSRFQRKLYRIESCKTQSNAFRFTFLSVR  706

Query  313  EGWENPGFQIGGIVFYG  263
            +       QIG I  Y 
Sbjct  707  DVKSTSRLQIGSIDLYA  723



>ref|XP_004957755.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X2 [Setaria italica]
Length=719

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+++D + +++F+  F RKT+TV  +   A+ F   FL V+
Sbjct  641  PERDPMDWVLEGSTDGGSTWNIIDTRSSEMFEGRFFRKTFTVDKRC-KADTFRFKFLLVR  699

Query  313  EGWENPGFQIGGIVFYGR  260
            E   NP FQIG I  YG+
Sbjct  700  ESHSNPRFQIGSIDLYGK  717



>ref|XP_004957754.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like isoform X1 [Setaria italica]
Length=730

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  +W+++D + +++F+  F RKT+TV  +   A+ F   FL V+
Sbjct  652  PERDPMDWVLEGSTDGGSTWNIIDTRSSEMFEGRFFRKTFTVDKRC-KADTFRFKFLLVR  710

Query  313  EGWENPGFQIGGIVFYGR  260
            E   NP FQIG I  YG+
Sbjct  711  ESHSNPRFQIGSIDLYGK  728



>ref|XP_002278422.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase [Vitis vinifera]
 emb|CBI34186.3| unnamed protein product [Vitis vinifera]
Length=726

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW VLD+Q +Q F+  FQRKT+ + S    +N F   FL V+
Sbjct  647  PERDPMDWVVEGSNDGGSSWRVLDEQFSQRFETRFQRKTFKINSVGLSSNAFRFRFLKVR  706

Query  313  EGWENPGFQIGGIVFYGRGS  254
            +       Q+G I  Y R S
Sbjct  707  DVEATSRLQLGSIDLYARSS  726



>ref|XP_011004272.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Populus euphratica]
Length=690

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK++ + S S     F   FLA +
Sbjct  611  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSFKINSDSVPCITFRFQFLAAR  670

Query  313  EGWENPGFQIGGIVFYG  263
            +   N   Q+G I  Y 
Sbjct  671  DVQSNSRLQLGSIDLYA  687



>ref|XP_010923840.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase isoform X1 [Elaeis guineensis]
Length=714

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  490  ERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQE  311
            ERDP DW  EGS +G  SW +LDK+ +Q F+K FQRKT+ V ++    N F   FL V++
Sbjct  637  ERDPMDWIVEGSDDGGSSWSILDKRSSQTFEKRFQRKTFRVGTRR-TCNAFRFHFLVVKD  695

Query  310  GWENPGFQIGGIVFYGRGS  254
                  FQIG I  YG+ S
Sbjct  696  PEATSRFQIGSIDLYGKSS  714



>dbj|BAK01337.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=777

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS     +W+ +D + + IF   F RK++TV  +   ANV    FL V+
Sbjct  697  PERDPMDWVLEGSTGQGSTWNTIDARSSVIFSSRFCRKSFTVDKRR-KANVLRFRFLRVR  755

Query  313  EGWENPGFQIGGIVFYGR  260
            E   NP FQIG I FYG+
Sbjct  756  ESSANPRFQIGSIDFYGK  773



>gb|EMT05979.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Aegilops 
tauschii]
Length=773

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   +W+ +D + + IF   F RK++TV  + + ANV    FL  +
Sbjct  693  PERDPMDWVLEGSTDQGSTWNTIDARSSVIFGSRFCRKSFTV-DKRYKANVLRFRFLRGR  751

Query  313  EGWENPGFQIGGIVFYG  263
            E   NP FQIG I FYG
Sbjct  752  ESSANPRFQIGSIDFYG  768



>gb|EMS49634.1| Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Triticum 
urartu]
Length=811

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDP DW  EGS +   +W+ +D + + IF   F RK++TV  + + ANV    FL  +
Sbjct  731  PERDPMDWVLEGSTDQGSTWNTIDARSSVIFGSRFCRKSFTV-DKRYKANVLRFRFLRGR  789

Query  313  EGWENPGFQIGGIVFYG  263
            E   NP FQIG I FYG
Sbjct  790  ESSANPRFQIGSIDFYG  806



>gb|ABR16638.1| unknown [Picea sitchensis]
Length=657

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  +W++LD Q +Q F+  F RKT+ +  +  + N F   FL+V+
Sbjct  573  PERDPKDWVLEGSSDGGQTWYILDSQKSQFFEMRFMRKTFIITQEKQMCNAFRFRFLSVR  632

Query  313  EGWENPGFQIGGIVFYG  263
            +       Q+  I  Y 
Sbjct  633  DTNATSRLQVSCIDLYA  649



>gb|KFK26602.1| hypothetical protein AALP_AA8G270100 [Arabis alpina]
Length=727

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPKDW  EGS +G  SW VLDKQ  Q+F++ FQRK+Y + S  F AN+F   FLAV+
Sbjct  645  PERDPKDWVLEGSSDGGSSWSVLDKQTGQVFEERFQRKSYKIISPGFQANLFRFRFLAVR  704

Query  313  EGWENPGFQIGGIVFY  266
            +       Q+G I  Y
Sbjct  705  DVNSTSRLQLGSIDMY  720



>ref|XP_011005718.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine 
amidase-like [Populus euphratica]
Length=374

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVF  338
            PERDP DW  EGS +G  SW +LDKQ +Q+F   FQRK+Y + S S   N F
Sbjct  285  PERDPMDWVVEGSHDGGSSWRILDKQTSQMFKDRFQRKSYKINSDSVPCNTF  336



>ref|XP_006853458.1| hypothetical protein AMTR_s00032p00190520 [Amborella trichopoda]
 gb|ERN14925.1| hypothetical protein AMTR_s00032p00190520 [Amborella trichopoda]
Length=1089

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVF  338
            PERDPKDW  EGS +G  +W VLD Q +Q FD  F RKTY V+ +  ++N F
Sbjct  631  PERDPKDWIVEGSDDGGCTWVVLDTQHSQFFDSRFMRKTYRVELERRMSNAF  682



>ref|XP_002961131.1| hypothetical protein SELMODRAFT_402772 [Selaginella moellendorffii]
 gb|EFJ38670.1| hypothetical protein SELMODRAFT_402772 [Selaginella moellendorffii]
Length=567

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS-FLANVFGISFLAV  317
            PERDP DW  EGS +G  +W +LDK+  ++F + ++R+ + V  +S F  +V  + F AV
Sbjct  488  PERDPSDWMLEGSCDGGKTWQLLDKRSGELFQERYERRCFIVAKESQFPCSVLRLQFAAV  547

Query  316  QEGWENPGFQIGGIVFY  266
            +E  +    Q+  I FY
Sbjct  548  RETVKTSRLQLSSIDFY  564



>ref|XP_002966880.1| hypothetical protein SELMODRAFT_87223, partial [Selaginella moellendorffii]
 gb|EFJ31479.1| hypothetical protein SELMODRAFT_87223, partial [Selaginella moellendorffii]
Length=577

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS-FLANVFGISFLAV  317
            PERDP DW  EGS +G  +W +LDK+  ++F + ++R+ + V  +S F  +V  + F AV
Sbjct  498  PERDPLDWMLEGSCDGGKTWQLLDKRSGELFQERYERRCFIVAKESQFPCSVLRLQFAAV  557

Query  316  QEGWENPGFQIGGIVFY  266
            +E  +    Q+  I FY
Sbjct  558  RETVKTSRLQLSSIDFY  574



>emb|CDP08527.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  469  FFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQE  311
             F GSP+G  +WH+LD++ +Q F + FQRK   VKS   LAN F + F AV++
Sbjct  16   IFNGSPDGGLNWHILDEKTSQTFKERFQRKVLEVKSPGILANAFRLRFAAVRD  68



>ref|XP_002961130.1| hypothetical protein SELMODRAFT_402770 [Selaginella moellendorffii]
 gb|EFJ38669.1| hypothetical protein SELMODRAFT_402770 [Selaginella moellendorffii]
Length=607

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS-FLANVFGISFLAV  317
            PERDP DW  EGS +G  +W +LDK+  ++F + ++R+ + V  +S F  +V  + F AV
Sbjct  528  PERDPLDWMLEGSCDGGKTWQLLDKRSGELFQECYERRCFIVAKESQFPCSVLRLQFAAV  587

Query  316  QEGWENPGFQIGGIVFY  266
            +E  +    Q+  + FY
Sbjct  588  RETVKTSRLQLSSMSFY  604



>ref|WP_042143806.1| hypothetical protein [Pseudoalteromonas sp. '520P1 No. 412']
Length=874

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQ  359
            P RDP+DW  +GS N A +W V+D Q  Q+FD+ +Q KTY + ++
Sbjct  97   PTRDPQDWRLQGS-NDALNWQVIDSQTAQVFDQRYQTKTYMISNR  140



>ref|WP_010491675.1| coagulation factor 5/8 type-like protein [Paenibacillus elgii]
Length=528

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS  356
            PERDPKDW  +GS NG   W VLD +  + FD  FQ KTY   +Q+
Sbjct  99   PERDPKDWTLKGSNNGT-DWTVLDTRQNESFDSRFQTKTYNFSNQT  143



>ref|WP_041843089.1| alpha-mannosidase [Actinoplanes friuliensis]
Length=1409

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTV  368
            PERDP+DW  +GS +G  +W  +D Q  Q F + FQ KTYTV
Sbjct  121  PERDPRDWTLQGSTDGE-TWTTVDTQTGQTFTERFQTKTYTV  161



>gb|AGZ44993.1| alpha-1,2-mannosidase [Actinoplanes friuliensis DSM 7358]
Length=1410

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTV  368
            PERDP+DW  +GS +G  +W  +D Q  Q F + FQ KTYTV
Sbjct  122  PERDPRDWTLQGSTDGE-TWTTVDTQTGQTFTERFQTKTYTV  162



>ref|WP_025851809.1| hypothetical protein [Paenibacillus ehimensis]
Length=527

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLA  347
            PERDPKDW  +GS NG   W VLD +  + FD  FQ KTY+  +Q+  A
Sbjct  99   PERDPKDWTLKGSNNGT-DWTVLDSRQNENFDWRFQTKTYSFSNQTAYA  146



>ref|WP_034244534.1| hypothetical protein, partial [Aquimarina sp. 22II-S11-z7]
Length=356

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 53/110 (48%), Gaps = 10/110 (9%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQSFLANVFGISFLAVQ  314
            PERDPK W  +GS NG+ SW  +D++  Q F    Q++T+ V + S   N + +S     
Sbjct  39   PERDPKSWTLQGSTNGS-SWETIDQRSNQDFQNRNQKRTFQVSTSSSY-NYYRLSMR---  93

Query  313  EGWENPG--FQIGGIVFYGRGS*YFGGESSKHGLFPVSKFK*RGFPKSLI  170
                N G   Q+  +  +G+G+   GG  S    F   + + R F  S I
Sbjct  94   ---NNSGTILQVSELELFGKGNTTGGGSCSWGSDFLTPRVEFRDFDGSTI  140



>ref|WP_036682319.1| hypothetical protein [Paenibacillus sp. MSt1]
 gb|KEQ25743.1| hypothetical protein ET33_03255 [Paenibacillus sp. MSt1]
Length=523

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -3

Query  493  PERDPKDWFFEGSPNGAFSWHVLDKQITQIFDKGFQRKTYTVKSQS  356
            PERDPKDW  +GS NG   W VLD +  + FD  +Q KTY + +Q+
Sbjct  99   PERDPKDWTLKGSNNGT-DWTVLDTRQNESFDWRYQTKTYNIPNQT  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190