BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042E17

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    198   7e-60   Nicotiana tomentosiformis
ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    197   1e-59   Nicotiana sylvestris
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    196   9e-59   Sesamum indicum [beniseed]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    189   2e-56   Nicotiana tomentosiformis
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                189   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    189   5e-56   Sesamum indicum [beniseed]
emb|CDP14208.1|  unnamed protein product                                189   6e-56   Coffea canephora [robusta coffee]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    188   6e-56   Nicotiana sylvestris
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                187   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...    181   2e-53   Solanum tuberosum [potatoes]
emb|CBI30075.3|  unnamed protein product                                180   2e-53   Vitis vinifera
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...    181   7e-53   Solanum lycopersicum
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    180   9e-53   Vitis vinifera
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    180   1e-52   Solanum lycopersicum
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...    179   3e-52   Solanum tuberosum [potatoes]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg             169   2e-48   Prunus persica
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    168   6e-48   Nicotiana tomentosiformis
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...    168   6e-48   Prunus mume [ume]
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    167   1e-47   Nicotiana sylvestris
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    166   3e-47   Nelumbo nucifera [Indian lotus]
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         157   4e-44   Jatropha curcas
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...    154   2e-43   
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...    154   1e-42   Fragaria vesca subsp. vesca
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    154   1e-42   
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...    154   6e-42   
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...    152   7e-42   Phoenix dactylifera
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    154   1e-41   
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...    150   4e-41   Elaeis guineensis
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative           149   6e-41   Ricinus communis
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg             148   2e-40   Citrus clementina [clementine]
gb|KJB16379.1|  hypothetical protein B456_002G227200                    147   4e-40   Gossypium raimondii
gb|KJB35924.1|  hypothetical protein B456_006G133800                    147   5e-40   Gossypium raimondii
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...    147   5e-40   
ref|XP_008800223.1|  PREDICTED: calmodulin-like                         147   6e-40   Phoenix dactylifera
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...    147   8e-40   Citrus sinensis [apfelsine]
emb|CDY14768.1|  BnaC04g47650D                                          146   1e-39   Brassica napus [oilseed rape]
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...    145   2e-39   Solanum tuberosum [potatoes]
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...    145   3e-39   Brassica rapa
emb|CDY06925.1|  BnaA04g23900D                                          142   3e-38   
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3               142   4e-38   Elaeis guineensis
ref|XP_002308908.1|  Calmodulin-like family protein                     141   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                  141   1e-37   Medicago truncatula
ref|NP_001265939.1|  Hop-interacting protein THI026                     140   2e-37   Solanum lycopersicum
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                   140   2e-37   Citrus sinensis [apfelsine]
ref|XP_002323262.1|  Calmodulin-like family protein                     139   5e-37   Populus trichocarpa [western balsam poplar]
gb|AFK42347.1|  unknown                                                 139   7e-37   Medicago truncatula
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...    139   8e-37   Elaeis guineensis
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...    138   1e-36   Populus euphratica
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...    137   2e-36   Elaeis guineensis
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...    137   2e-36   Phoenix dactylifera
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                   137   3e-36   Citrus sinensis [apfelsine]
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...    137   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...    137   7e-36   
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...    135   3e-35   Cicer arietinum [garbanzo]
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...    133   3e-35   
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...    133   3e-35   
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...    134   4e-35   Populus euphratica
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...    134   6e-35   Camelina sativa [gold-of-pleasure]
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                    132   1e-34   Arabis alpina [alpine rockcress]
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457             133   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...    132   1e-34   Phoenix dactylifera
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg             132   3e-34   Capsella rubella
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194             132   3e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...    132   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...    132   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...    132   5e-34   Nelumbo nucifera [Indian lotus]
emb|CDY23852.1|  BnaC04g01850D                                          131   5e-34   Brassica napus [oilseed rape]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...    131   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg             130   1e-33   Eutrema salsugineum [saltwater cress]
ref|NP_187630.1|  putative calcium-binding protein CML36                130   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48190.1|  calmodulin like protein                                130   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61257.1|  calmodulin-like protein                                 129   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181672.1|  putative calcium-binding protein CML35                129   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...    129   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...    127   2e-32   Eucalyptus grandis [rose gum]
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg             127   2e-32   Capsella rubella
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...    126   3e-32   Cucumis melo [Oriental melon]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...    127   4e-32   Glycine max [soybeans]
ref|XP_010102734.1|  putative calcium-binding protein CML36             127   4e-32   
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...    125   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...    125   8e-32   Brassica rapa
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...    126   8e-32   Camelina sativa [gold-of-pleasure]
emb|CDX79938.1|  BnaA05g02180D                                          125   1e-31   
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...    125   1e-31   Glycine max [soybeans]
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg             125   1e-31   Eutrema salsugineum [saltwater cress]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                    125   1e-31   Arabis alpina [alpine rockcress]
emb|CDY00910.1|  BnaC05g42900D                                          125   1e-31   
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...    124   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...    122   8e-31   Cucumis sativus [cucumbers]
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g             122   1e-30   Phaseolus vulgaris [French bean]
gb|AGV22098.1|  calmodulin-like protein                                 122   2e-30   Brassica juncea [brown mustard]
emb|CDY60169.1|  BnaAnng16630D                                          121   4e-30   Brassica napus [oilseed rape]
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...    117   1e-28   Eucalyptus grandis [rose gum]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...    118   1e-28   Brassica rapa
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg             115   3e-28   
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...    115   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...    115   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...    114   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292              106   6e-25   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501              106   7e-25   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like      106   1e-24   Eucalyptus grandis [rose gum]
gb|ABK24059.1|  unknown                                                 106   4e-24   Picea sitchensis
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...    104   9e-24   Cicer arietinum [garbanzo]
ref|XP_006843397.1|  hypothetical protein AMTR_s00053p00122010          104   1e-23   Amborella trichopoda
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...    102   1e-23   Solanum lycopersicum
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg                103   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...    102   2e-23   Nicotiana tomentosiformis
gb|KHN40730.1|  Putative calcium-binding protein CML25                  101   4e-23   Glycine soja [wild soybean]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like      101   5e-23   Solanum tuberosum [potatoes]
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...    100   8e-23   Solanum tuberosum [potatoes]
ref|XP_003637661.1|  Calcium-binding pollen allergen                    101   9e-23   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...    101   1e-22   Solanum lycopersicum
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...    100   1e-22   Glycine max [soybeans]
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...    100   2e-22   Sesamum indicum [beniseed]
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...  99.4    2e-22   Solanum tuberosum [potatoes]
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         99.0    3e-22   Solanum lycopersicum
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...    100   3e-22   Malus domestica [apple tree]
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  99.0    4e-22   Sesamum indicum [beniseed]
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...  98.6    4e-22   Sesamum indicum [beniseed]
gb|AFK34900.1|  unknown                                               99.8    4e-22   Lotus japonicus
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  98.2    4e-22   Glycine max [soybeans]
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...  98.2    5e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  98.6    7e-22   
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  98.2    8e-22   Nicotiana sylvestris
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...  98.6    9e-22   Fragaria vesca subsp. vesca
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...    100   1e-21   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  97.8    1e-21   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   Cucumis melo [Oriental melon]
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    97.4    1e-21   Nicotiana sylvestris
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           96.7    2e-21   Phaseolus vulgaris [French bean]
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  96.7    2e-21   Glycine max [soybeans]
ref|XP_009411743.1|  PREDICTED: probable calcium-binding protein ...  98.2    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  97.8    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...  97.1    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS62655.1|  hypothetical protein M569_12136                       97.1    3e-21   Genlisea aurea
ref|XP_006662725.1|  PREDICTED: probable calcium-binding protein ...  97.1    3e-21   Oryza brachyantha
emb|CBX25281.1|  hypothetical_protein                                 97.1    3e-21   Oryza brachyantha
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  96.3    3e-21   Nicotiana tomentosiformis
emb|CBX25368.1|  hypothetical_protein                                 95.1    5e-21   Oryza brachyantha
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135            95.1    6e-21   
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                   95.9    6e-21   Eucalyptus grandis [rose gum]
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  96.3    6e-21   Phoenix dactylifera
ref|XP_010104706.1|  putative calcium-binding protein CML25           96.3    7e-21   Morus notabilis
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  95.5    8e-21   Elaeis guineensis
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  95.9    1e-20   Sesamum indicum [beniseed]
ref|XP_007033045.1|  Calmodulin like 23, putative                     94.7    1e-20   
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   94.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  94.7    1e-20   Vitis vinifera
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198            94.4    1e-20   
ref|XP_006663807.1|  PREDICTED: probable calcium-binding protein ...  94.7    2e-20   Oryza brachyantha
dbj|BAJ92507.1|  predicted protein                                    94.7    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHM99973.1|  Putative calcium-binding protein CML25                94.0    2e-20   Glycine soja [wild soybean]
ref|XP_006646679.1|  PREDICTED: probable calcium-binding protein ...  93.2    3e-20   Oryza brachyantha
emb|CDY40786.1|  BnaAnng06490D                                        94.0    4e-20   Brassica napus [oilseed rape]
emb|CDP16307.1|  unnamed protein product                              94.4    4e-20   Coffea canephora [robusta coffee]
gb|AAM67124.1|  calmodulin-related protein                            93.6    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  94.4    4e-20   Eucalyptus grandis [rose gum]
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  94.0    4e-20   
ref|NP_564874.1|  calmodulin like 23                                  93.2    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             94.4    5e-20   Eucalyptus grandis [rose gum]
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...  94.0    6e-20   
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              92.8    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           93.6    6e-20   Prunus persica
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  93.6    6e-20   Cucumis melo [Oriental melon]
ref|XP_003616365.1|  Polcalcin Nic t                                  92.4    7e-20   Medicago truncatula
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g           92.4    7e-20   Phaseolus vulgaris [French bean]
gb|KJB08532.1|  hypothetical protein B456_001G087100                  92.4    7e-20   Gossypium raimondii
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...  92.8    8e-20   Elaeis guineensis
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  92.4    9e-20   Malus domestica [apple tree]
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...  92.8    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB50384.1|  hypothetical protein B456_008G168100                  93.2    9e-20   Gossypium raimondii
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg           93.2    9e-20   Eutrema salsugineum [saltwater cress]
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              92.8    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...  93.2    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...  92.8    1e-19   
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...  92.8    1e-19   
gb|KCW58109.1|  hypothetical protein EUGRSUZ_H00832                   92.0    1e-19   Eucalyptus grandis [rose gum]
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  92.8    1e-19   Cucumis sativus [cucumbers]
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...  92.0    1e-19   Cucumis sativus [cucumbers]
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...  92.4    1e-19   Elaeis guineensis
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  93.6    1e-19   
ref|NP_173866.1|  putative calcium-binding protein CML25              92.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045400.1|  Os01g0949500                                     92.4    1e-19   
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           91.7    1e-19   Citrus clementina [clementine]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        92.4    2e-19   Sorghum bicolor [broomcorn]
ref|XP_011467223.1|  PREDICTED: calcium-binding protein CML24-like    91.3    2e-19   Fragaria vesca subsp. vesca
gb|ABA95773.1|  EF hand family protein, expressed                     92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EPS63975.1|  hypothetical protein M569_10810                       92.0    2e-19   Genlisea aurea
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836           92.4    2e-19   
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  92.0    2e-19   Prunus mume [ume]
ref|XP_007045260.1|  Polcalcin Jun o, putative                        92.4    2e-19   
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...  92.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...  92.0    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDM86427.1|  unnamed protein product                              92.0    3e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  92.0    3e-19   Phoenix dactylifera
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...  92.0    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  91.7    3e-19   Cicer arietinum [garbanzo]
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...  90.5    3e-19   Cicer arietinum [garbanzo]
ref|XP_006301789.1|  hypothetical protein CARUB_v10022253mg           90.9    3e-19   Capsella rubella
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742           90.9    3e-19   
ref|XP_010026030.1|  PREDICTED: probable calcium-binding protein ...  92.8    3e-19   
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...  90.9    4e-19   Cucumis melo [Oriental melon]
emb|CDM86445.1|  unnamed protein product                              91.7    4e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...  90.1    4e-19   Glycine max [soybeans]
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...  91.7    4e-19   Solanum tuberosum [potatoes]
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...  91.7    4e-19   Elaeis guineensis
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like    90.1    4e-19   Cicer arietinum [garbanzo]
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg           91.3    4e-19   Capsella rubella
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...  90.1    4e-19   
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           90.5    5e-19   Prunus persica
gb|AFG44138.1|  hypothetical protein 0_990_01                         89.4    5e-19   Pinus taeda
gb|KDP23917.1|  hypothetical protein JCGZ_27077                       90.5    5e-19   Jatropha curcas
gb|EEC67650.1|  hypothetical protein OsI_35060                        93.6    5e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...  91.7    5e-19   Vitis vinifera
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  90.1    5e-19   Pyrus x bretschneideri [bai li]
gb|KJB15360.1|  hypothetical protein B456_002G172400                  91.3    5e-19   Gossypium raimondii
gb|AAZ20284.1|  calcium-binding pollen allergen                       90.5    6e-19   Arachis hypogaea [goober]
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  90.1    6e-19   Malus domestica [apple tree]
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  90.1    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...  91.3    7e-19   Nelumbo nucifera [Indian lotus]
gb|EMS57533.1|  putative calcium-binding protein CML36                90.5    7e-19   Triticum urartu
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...  89.7    8e-19   Nicotiana sylvestris
gb|ABK26821.1|  unknown                                               90.9    8e-19   Picea sitchensis
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...  89.7    8e-19   Nicotiana tomentosiformis
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  90.1    9e-19   Eucalyptus grandis [rose gum]
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  89.7    9e-19   Prunus mume [ume]
gb|ABK26031.1|  unknown                                               90.5    1e-18   Picea sitchensis
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...  90.5    1e-18   Malus domestica [apple tree]
ref|XP_002525994.1|  Polcalcin Jun o, putative                        90.1    1e-18   Ricinus communis
ref|XP_010109033.1|  putative calcium-binding protein CML23           89.4    1e-18   Morus notabilis
dbj|BAJ88405.1|  predicted protein                                    90.1    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004977499.1|  PREDICTED: probable calcium-binding protein ...  89.7    1e-18   Setaria italica
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...  89.7    1e-18   Glycine max [soybeans]
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...  90.1    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...  89.7    2e-18   Elaeis guineensis
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       89.0    2e-18   Solanum lycopersicum
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       89.0    2e-18   Sesamum indicum [beniseed]
gb|AEW07415.1|  hypothetical protein 0_990_01                         88.2    2e-18   Pinus radiata
ref|XP_010511464.1|  PREDICTED: probable calcium-binding protein ...  89.0    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010097572.1|  putative calcium-binding protein CML27           89.4    2e-18   Morus notabilis
ref|XP_010032678.1|  PREDICTED: calcium-binding protein CML24         88.6    2e-18   
gb|AFK37714.1|  unknown                                               88.2    2e-18   Medicago truncatula
gb|AFG44142.1|  hypothetical protein 0_990_01                         87.8    2e-18   Pinus taeda
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    88.6    2e-18   Populus euphratica
emb|CDX84967.1|  BnaC05g20880D                                        89.4    2e-18   
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-18   Brassica rapa
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  88.6    2e-18   
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...  89.4    2e-18   Brassica rapa
emb|CBX25462.1|  hypothetical_protein                                 89.4    3e-18   Oryza glaberrima
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           88.6    3e-18   
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                  89.4    3e-18   Arabis alpina [alpine rockcress]
ref|NP_173259.1|  putative calcium-binding protein CML27              88.6    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KCW52116.1|  hypothetical protein EUGRSUZ_J01551                   88.6    3e-18   Eucalyptus grandis [rose gum]
gb|ABA91429.1|  EF hand family protein, expressed                     89.0    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           89.0    3e-18   Phaseolus vulgaris [French bean]
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...  88.2    3e-18   
gb|KEH41232.1|  EF hand calcium-binding family protein                87.8    4e-18   Medicago truncatula
gb|KEH41241.1|  EF hand calcium-binding family protein                87.8    4e-18   Medicago truncatula
gb|EAY79890.1|  hypothetical protein OsI_35052                        89.0    4e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001241810.1|  polcalcin Jun o 2                                89.0    4e-18   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234           88.2    4e-18   Arabidopsis lyrata subsp. lyrata
ref|NP_001150713.1|  LOC100284346                                     89.0    4e-18   Zea mays [maize]
ref|XP_006655263.1|  PREDICTED: probable calcium-binding protein ...  88.2    4e-18   
gb|ADC80752.1|  calmodulin 24-like protein                            86.7    5e-18   Tachigali melinonii
ref|XP_003630938.1|  Calcium-binding pollen allergen                  88.6    5e-18   
ref|XP_002532464.1|  Calcium-binding allergen Ole e, putative         87.8    5e-18   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...  87.8    6e-18   Fragaria vesca subsp. vesca
gb|AET05414.2|  EF hand calcium-binding family protein                88.2    6e-18   Medicago truncatula
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...  88.6    6e-18   Setaria italica
ref|XP_004978639.1|  PREDICTED: probable calcium-binding protein ...  88.2    6e-18   Setaria italica
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  88.6    6e-18   Sesamum indicum [beniseed]
emb|CDY24421.1|  BnaCnng04880D                                        89.4    6e-18   Brassica napus [oilseed rape]
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1             87.8    6e-18   
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       87.0    7e-18   Sesamum indicum [beniseed]
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      87.4    7e-18   Vitis vinifera
ref|NP_001152603.1|  polcalcin Jun o 2                                88.2    7e-18   
ref|XP_002442683.1|  hypothetical protein SORBIDRAFT_08g001200        88.6    7e-18   Sorghum bicolor [broomcorn]
gb|ACF84808.1|  unknown                                               87.8    7e-18   
gb|ACG44451.1|  polcalcin Jun o 2                                     88.2    7e-18   
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11            87.0    8e-18   
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       87.0    8e-18   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  87.4    8e-18   
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          87.8    8e-18   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              87.0    8e-18   
ref|XP_002305867.1|  putative calmodulin-related family protein       87.0    8e-18   
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like               87.0    8e-18   
gb|KEH26932.1|  EF hand calcium-binding family protein                87.4    8e-18   
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       87.0    8e-18   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg           87.4    9e-18   
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg           87.0    1e-17   
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                 87.8    1e-17   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           87.8    1e-17   
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...  87.8    1e-17   
emb|CDP19328.1|  unnamed protein product                              86.7    1e-17   
gb|ADC80730.1|  calmodulin 24-like protein                            85.5    1e-17   
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg           87.4    1e-17   
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  86.7    1e-17   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                  86.7    2e-17   
gb|EPS69688.1|  hypothetical protein M569_05080                       85.9    2e-17   
emb|CDY19196.1|  BnaC05g13970D                                        86.7    2e-17   
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 86.3    2e-17   
gb|ADC80731.1|  calmodulin 24-like protein                            85.1    2e-17   
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11            85.9    2e-17   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...  86.3    2e-17   
gb|KJB30167.1|  hypothetical protein B456_005G131800                  86.3    2e-17   
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4             87.0    2e-17   
gb|KHN17940.1|  Putative calcium-binding protein CML27                85.9    2e-17   
ref|XP_001779680.1|  predicted protein                                86.7    2e-17   
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg              85.9    2e-17   
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...  86.7    2e-17   
ref|XP_003565059.1|  PREDICTED: probable calcium-binding protein ...  86.7    2e-17   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     85.9    2e-17   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     86.3    2e-17   
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11            85.5    2e-17   
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...  85.9    3e-17   
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...  86.3    3e-17   
ref|XP_003631098.1|  SLR1/LCR-like protein                            85.9    3e-17   
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...  86.3    3e-17   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  85.5    3e-17   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  85.9    3e-17   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  86.3    4e-17   
ref|XP_003577074.1|  PREDICTED: probable calcium-binding protein ...  86.3    4e-17   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       85.5    4e-17   
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       85.5    4e-17   
ref|XP_011034524.1|  PREDICTED: probable calcium-binding protein ...  86.3    4e-17   
emb|CDY70127.1|  BnaA06g38470D                                        85.5    4e-17   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  85.5    4e-17   
ref|NP_001152624.1|  LOC100286265                                     85.9    4e-17   
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...  85.9    4e-17   
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           84.7    5e-17   
ref|NP_001066111.2|  Os12g0138000                                     83.2    5e-17   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...  85.5    5e-17   
ref|XP_002317881.2|  calcium binding family protein                   85.1    5e-17   
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...  85.5    5e-17   
ref|NP_001065715.1|  Os11g0141400                                     83.2    6e-17   
ref|XP_005717351.1|  Calmodulin                                       84.7    6e-17   
gb|EMT07142.1|  Putative calcium-binding protein CML10                85.5    6e-17   
gb|AFK83800.1|  calmodulin                                            84.7    6e-17   
gb|KJB60897.1|  hypothetical protein B456_009G330300                  85.5    6e-17   
emb|CDX96729.1|  BnaA08g22720D                                        85.1    7e-17   
ref|XP_008809157.1|  PREDICTED: probable calcium-binding protein ...  84.7    7e-17   
ref|XP_001768532.1|  predicted protein                                85.1    7e-17   
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991            84.0    8e-17   
gb|EYU41429.1|  hypothetical protein MIMGU_mgv1a021942mg              84.3    8e-17   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  84.7    8e-17   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  84.3    8e-17   
gb|EAY97840.1|  hypothetical protein OsI_19761                        85.1    8e-17   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  84.3    9e-17   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  84.7    9e-17   
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g           84.7    9e-17   
ref|NP_001146874.1|  polcalcin Jun o 2                                84.7    1e-16   
ref|XP_009105203.1|  PREDICTED: calcium-binding protein CML24         84.0    1e-16   
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...  84.3    1e-16   
ref|XP_007034908.1|  Calmodulin-like 11 isoform 2                     83.2    1e-16   
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711           84.7    1e-16   
gb|AFW81600.1|  polcalcin Jun o 2                                     84.7    1e-16   
ref|XP_010498205.1|  PREDICTED: probable calcium-binding protein ...  84.3    1e-16   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  84.3    1e-16   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  84.3    1e-16   
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           84.0    1e-16   
ref|NP_001055397.1|  Os05g0380900                                     84.7    1e-16   
ref|XP_009604908.1|  PREDICTED: probable calcium-binding protein ...  84.7    1e-16   
ref|XP_001785095.1|  predicted protein                                83.6    1e-16   
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       83.6    1e-16   
ref|XP_008364032.1|  PREDICTED: calmodulin-like                       83.6    1e-16   
ref|XP_010098458.1|  Calmodulin-like protein 1                        83.6    1e-16   
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            83.6    1e-16   
ref|XP_001785090.1|  predicted protein                                84.3    1e-16   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            83.6    2e-16   
emb|CDY55679.1|  BnaC06g43540D                                        83.6    2e-16   
ref|XP_010498204.1|  PREDICTED: probable calcium-binding protein ...  84.3    2e-16   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  83.2    2e-16   
ref|XP_002520954.1|  calmodulin, putative                             83.2    2e-16   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11            83.2    2e-16   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      83.6    2e-16   
ref|XP_006409534.1|  hypothetical protein EUTSA_v10022869mg           84.0    2e-16   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  84.0    2e-16   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           83.6    2e-16   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-16   
ref|XP_007139465.1|  hypothetical protein PHAVU_008G031800g           84.0    2e-16   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             83.2    2e-16   
gb|KJB53034.1|  hypothetical protein B456_008G289600                  83.2    2e-16   
ref|NP_001237902.1|  calmodulin                                       83.2    2e-16   
pdb|2L1W|A  Chain A, The Solution Structure Of Soybean Calmodulin...  83.2    2e-16   
ref|XP_006643684.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-16   
ref|XP_002441014.1|  hypothetical protein SORBIDRAFT_09g018860        84.0    2e-16   
gb|KJB30717.1|  hypothetical protein B456_005G156600                  83.6    2e-16   
emb|CDO98355.1|  unnamed protein product                              84.3    2e-16   
gb|KJB42986.1|  hypothetical protein B456_007G178400                  82.8    2e-16   
ref|XP_008453475.1|  PREDICTED: probable calcium-binding protein ...  83.6    2e-16   
ref|NP_001159038.1|  polcalcin Jun o 2                                81.6    3e-16   
ref|XP_007036791.1|  Calcium-binding EF-hand family protein           83.2    3e-16   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...  82.8    3e-16   
ref|XP_007162475.1|  hypothetical protein PHAVU_001G155400g           82.8    3e-16   
gb|EAY97018.1|  hypothetical protein OsI_18939                        83.6    3e-16   
gb|ADD38579.1|  Calmodulin                                            82.8    3e-16   
gb|KDP23657.1|  hypothetical protein JCGZ_23490                       82.4    3e-16   
ref|XP_011470552.1|  PREDICTED: calcium-binding protein CML24         82.4    3e-16   
ref|XP_006383316.1|  putative calmodulin-related family protein       82.8    4e-16   
ref|XP_009799079.1|  PREDICTED: probable calcium-binding protein ...  82.8    4e-16   
gb|EYU26972.1|  hypothetical protein MIMGU_mgv1a019086mg              82.4    4e-16   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11            82.4    4e-16   
gb|ACO12252.1|  Calmodulin                                            82.4    4e-16   
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             82.4    4e-16   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       82.4    4e-16   
ref|XP_008232680.1|  PREDICTED: calmodulin-like                       83.6    4e-16   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           82.4    4e-16   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            82.0    4e-16   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  82.8    4e-16   
ref|XP_011021404.1|  PREDICTED: calcium-binding protein CML24-like    82.4    5e-16   
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...  83.2    5e-16   
emb|CAC34625.1|  putative calmodulin-related protein                  82.4    5e-16   
ref|NP_001041950.2|  Os01g0135700                                     82.8    5e-16   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  82.8    5e-16   
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3             82.0    5e-16   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             82.0    5e-16   
ref|XP_009383649.1|  PREDICTED: probable calcium-binding protein ...  82.4    5e-16   
gb|KDO48937.1|  hypothetical protein CISIN_1g040628mg                 81.3    5e-16   
gb|EYU40667.1|  hypothetical protein MIMGU_mgv1a015381mg              82.0    5e-16   
ref|NP_001147546.1|  calmodulin-related protein 2, touch-induced      82.0    5e-16   
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...  82.8    6e-16   
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   82.4    6e-16   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      82.4    6e-16   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  82.4    6e-16   
emb|CAC43238.1|  calcium binding protein                              82.4    6e-16   
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   81.6    7e-16   
ref|XP_010107731.1|  Calmodulin-like protein 11                       82.0    7e-16   
ref|XP_003537323.1|  PREDICTED: calmodulin-like protein 1-like        82.4    7e-16   
ref|XP_009799072.1|  PREDICTED: probable calcium-binding protein ...  82.8    7e-16   
ref|XP_002322096.1|  calcium binding family protein                   82.0    7e-16   
emb|CDX83860.1|  BnaC08g17850D                                        82.0    7e-16   
ref|XP_011039125.1|  PREDICTED: probable calcium-binding protein ...  81.6    8e-16   
gb|EYU40893.1|  hypothetical protein MIMGU_mgv1a018394mg              80.9    8e-16   
gb|KJB24793.1|  hypothetical protein B456_004G160800                  82.4    8e-16   
ref|XP_006851533.1|  hypothetical protein AMTR_s00040p00172050        82.4    8e-16   
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg           82.4    8e-16   
ref|XP_002320065.2|  hypothetical protein POPTR_0014s06640g           82.4    8e-16   
ref|XP_007034907.1|  Calmodulin 8 isoform 1                           81.6    9e-16   
ref|XP_004137340.1|  PREDICTED: probable calcium-binding protein ...  82.0    9e-16   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   81.3    9e-16   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  81.6    9e-16   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  81.6    9e-16   
ref|XP_002448960.1|  hypothetical protein SORBIDRAFT_05g002460        82.0    9e-16   
gb|KDO85857.1|  hypothetical protein CISIN_1g047502mg                 81.3    9e-16   
gb|KHN05043.1|  Calmodulin-like protein 11                            81.3    9e-16   
gb|KFK39574.1|  hypothetical protein AALP_AA3G262000                  80.9    1e-15   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             81.3    1e-15   
emb|CDO97169.1|  unnamed protein product                              82.0    1e-15   
ref|XP_009386769.1|  PREDICTED: calmodulin-like                       81.3    1e-15   
ref|XP_007163958.1|  hypothetical protein PHAVU_L002000g              81.6    1e-15   
gb|KJB38241.1|  hypothetical protein B456_006G243600                  81.3    1e-15   
gb|EMS57491.1|  putative calcium-binding protein CML18                82.8    1e-15   
emb|CDO99124.1|  unnamed protein product                              81.3    1e-15   
ref|XP_010467315.1|  PREDICTED: calmodulin-like protein 1 isoform X1  82.0    1e-15   
ref|XP_010517286.1|  PREDICTED: calmodulin-like protein 1             82.0    1e-15   
ref|XP_006299618.1|  hypothetical protein CARUB_v10015796mg           82.0    1e-15   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  82.0    1e-15   
gb|ADC80734.1|  calmodulin 24-like protein                            80.1    1e-15   
gb|KEQ93845.1|  hypothetical protein AUEXF2481DRAFT_6419              81.3    1e-15   
ref|XP_008218258.1|  PREDICTED: calmodulin-like                       80.9    1e-15   
gb|KEQ79382.1|  putative calmodulin                                   80.9    2e-15   
ref|XP_008235348.1|  PREDICTED: calmodulin-like protein 11            80.5    2e-15   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  81.3    2e-15   
ref|NP_001236170.1|  uncharacterized protein LOC100500308             80.9    2e-15   
emb|CDY10686.1|  BnaA05g16760D                                        80.9    2e-15   
ref|XP_008364688.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  81.3    2e-15   
ref|XP_006432946.1|  hypothetical protein CICLE_v10002774mg           80.9    2e-15   
gb|KHN04934.1|  Calmodulin-like protein 8                             80.5    2e-15   
ref|XP_010916442.1|  PREDICTED: probable calcium-binding protein ...  81.3    2e-15   
ref|XP_005704341.1|  calmodulin isoform 1                             80.9    2e-15   
ref|XP_006390534.1|  hypothetical protein EUTSA_v10019258mg           80.9    2e-15   
ref|XP_003524630.2|  PREDICTED: calmodulin-like protein 1-like        81.6    2e-15   
ref|XP_009398373.1|  PREDICTED: calmodulin-like isoform X2            80.5    2e-15   
ref|XP_008224219.1|  PREDICTED: calmodulin-like protein 11 isofor...  80.5    2e-15   
ref|XP_007223678.1|  hypothetical protein PRUPE_ppa012907mg           80.5    2e-15   
dbj|BAK01430.1|  predicted protein                                    80.9    2e-15   
gb|KJB38242.1|  hypothetical protein B456_006G243600                  80.5    2e-15   
gb|AAB03218.1|  calmodulin-like myosin-light chain                    80.5    2e-15   
ref|XP_006445234.1|  hypothetical protein CICLE_v10022392mg           81.3    2e-15   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  80.9    2e-15   
ref|XP_008673745.1|  PREDICTED: probable calcium-binding protein ...  81.3    2e-15   
gb|KEQ67258.1|  putative calmodulin                                   80.5    2e-15   
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...  82.4    2e-15   
ref|XP_006302928.1|  hypothetical protein CARUB_v10021066mg           80.9    2e-15   
ref|XP_011032625.1|  PREDICTED: calmodulin-like protein 11            80.5    2e-15   
ref|XP_010467316.1|  PREDICTED: calmodulin-like protein 1 isoform X2  81.3    2e-15   
sp|P14533.1|CABO_DORPE  RecName: Full=Squidulin; AltName: Full=Op...  80.5    2e-15   
ref|XP_006432945.1|  hypothetical protein CICLE_v10003695mg           80.5    2e-15   
ref|XP_010671432.1|  PREDICTED: calcium-binding allergen Ole e 8-...  80.9    2e-15   
ref|XP_006298722.1|  hypothetical protein CARUB_v10014817mg           80.5    2e-15   
ref|XP_003550069.1|  PREDICTED: calmodulin-like protein 1-like        80.9    2e-15   
ref|XP_004296596.1|  PREDICTED: calmodulin-like protein 11 isofor...  80.1    2e-15   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       80.1    2e-15   
ref|XP_004968030.1|  PREDICTED: probable calcium-binding protein ...  81.3    2e-15   
ref|XP_007200520.1|  hypothetical protein PRUPE_ppa012929mg           80.1    2e-15   
gb|KDP40249.1|  hypothetical protein JCGZ_02247                       80.1    2e-15   
ref|XP_006383679.1|  hypothetical protein POPTR_0005s23720g           80.1    2e-15   
gb|ACU18644.1|  unknown                                               80.9    2e-15   



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  +SSAF PPSCD ELRD FDFF
Sbjct  102  EAILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAISSAFGPPSCDGELRDVFDFF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+AE+LFNVF+TIGD RCTLEDCRRMI GVD NGDGFVCF+DFC MME
Sbjct  162  DADHDGKITAEKLFNVFRTIGDGRCTLEDCRRMIRGVDKNGDGFVCFDDFCLMME  216



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  + SAF PPSCD ELRDAFDFF
Sbjct  102  EAILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAIRSAFGPPSCDGELRDAFDFF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDG I+AEELFNVF+TIGD RCTLEDCRRMI GVD NGDGFVCFEDFC MME
Sbjct  162  DADHDGMITAEELFNVFRTIGDGRCTLEDCRRMIRGVDKNGDGFVCFEDFCFMME  216



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL ++GAEPP++EEL+LMLS+VDRDGDGCI+LEEF  + SAFAPP+CD ELRD FDFF
Sbjct  102  EALLCRLGAEPPNQEELQLMLSDVDRDGDGCITLEEFYAIGSAFAPPTCDMELRDTFDFF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+AEELFNVFKTIGDS+CTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  162  DSDRDGKITAEELFNVFKTIGDSQCTLEDCRRMISGVDTNGDGFVCFEDFSRMME  216



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+L++VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFF
Sbjct  92   EAILTRVGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+AEELFNVF+TIGD RCTL+DCRRMI GVD NGDGFVCFEDFC MME
Sbjct  152  DADHDGKITAEELFNVFRTIGDGRCTLDDCRRMIRGVDKNGDGFVCFEDFCLMME  206



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E LLS++GAEPPS+EEL+LM+SEVDRDGDGCISLEEF  + SAFAPP+CD ELR  FDFF
Sbjct  84   EGLLSRLGAEPPSQEELKLMVSEVDRDGDGCISLEEFYAIGSAFAPPTCDGELRSTFDFF  143

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+AEELF VF+TIGD+RCTLEDCRRMI GVD NGDGFVCFEDF  MM+
Sbjct  144  DSDRDGKITAEELFRVFETIGDARCTLEDCRRMIKGVDRNGDGFVCFEDFSLMMD  198



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E LL ++G EPP +EEL+LML+EVDRDGDGCISLEEF  + SAFAPP+ D ELRDAFDFF
Sbjct  102  EGLLCRLGPEPPCQEELKLMLTEVDRDGDGCISLEEFYAIGSAFAPPARDGELRDAFDFF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+AEEL NVFKTIGD+RCTLEDCRRMI GV+ NGDGFVCFEDF RMME
Sbjct  162  DSDRDGKITAEELLNVFKTIGDARCTLEDCRRMIRGVNRNGDGFVCFEDFSRMME  216



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS+VGAEPPS EEL ++LSEVDRDGDGCISLEEF  + SAF PPSCDSE+RDAFDFF
Sbjct  120  EALLSRVGAEPPSAEELNMLLSEVDRDGDGCISLEEFEAIGSAFGPPSCDSEMRDAFDFF  179

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DTDHDG+I+AEEL+NVF+ IGD +CTL++C+RMI GV  NG GFVCFEDF RMM
Sbjct  180  DTDHDGRITAEELYNVFRVIGDGQCTLDECQRMISGVGKNGVGFVCFEDFSRMM  233



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+L++VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFF
Sbjct  92   EAILTRVGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D +HDGKI+AEELFNVF+TIGD RCTLEDCR MI GVD NGDGFVCFEDFC MME
Sbjct  152  DANHDGKITAEELFNVFRTIGDGRCTLEDCRHMIRGVDKNGDGFVCFEDFCLMME  206



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E LL  +GA+PPSREELRLMLSEVDRDGDGCI+LEEF  + SAFAPP+CD+E+R+ FDFF
Sbjct  105  EDLLCGLGADPPSREELRLMLSEVDRDGDGCITLEEFHSIGSAFAPPTCDTEMRETFDFF  164

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+AEELF VF+TIGD++CTLEDCRRMI GVD NGDGFVCFEDF  MM+
Sbjct  165  DSDRDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVDRNGDGFVCFEDFSLMMD  219



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L++VG++PP+ EEL  +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD
Sbjct  89   AILTRVGSDPPTEEELVQLLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFD  148

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             +HDGKI+AEELFNVF+TIGD RCTLE+CRRMI GVD NGDGFVCFEDF  MME
Sbjct  149  ANHDGKITAEELFNVFRTIGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMME  202



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF P +CD+ELRDAF FF
Sbjct  59   EALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFGP-ACDTELRDAFCFF  117

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD DGKI+AEEL  VF  IGD RCTLEDC+RMI GVD NGDGFVCFEDF RMME
Sbjct  118  DTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMME  172



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L++VG++PP+ EEL  +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD
Sbjct  123  AILTRVGSDPPTEEELVQLLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFD  182

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             +HDGKI+AEELFNVF+TIGD RCTLE+CRRMI GVD NGDGFVCFEDF  MME
Sbjct  183  ANHDGKITAEELFNVFRTIGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMME  236



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF P +CD+ELRDAF FF
Sbjct  106  EALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFGP-ACDTELRDAFCFF  164

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD DGKI+AEEL  VF  IGD RCTLEDC+RMI GVD NGDGFVCFEDF RMME
Sbjct  165  DTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMME  219



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS+VG EPPS+EEL L+L EVD DGDGCISL+EF  +SSAF PP+CDSELRDAFDFF
Sbjct  90   EAILSRVGTEPPSKEELMLLLEEVDVDGDGCISLQEFGAISSAFGPPACDSELRDAFDFF  149

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+A+ELF+VF+ IGDSRCTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  150  DADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCIMME  204



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS+VG EPPS+EEL L+L EVD +GDGCISL+EF  +SSAF PP+CDSELRDAFDFF
Sbjct  92   EAILSRVGTEPPSKEELMLLLEEVDVNGDGCISLQEFGAISSAFGPPACDSELRDAFDFF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+A+ELF+VF+ IGDSRCTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  152  DADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCVMME  206



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS++GA+PPS+EE+ LMLSEVDR+G+G ISLE           P+ DSELRDAF+ F
Sbjct  112  EALLSRLGADPPSQEEVMLMLSEVDREGNGSISLEALLSRVGPVCGPAADSELRDAFEVF  171

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+DHDGKISAEEL NVF  IGD RCTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  172  DSDHDGKISAEELLNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMME  226



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   168 bits (425),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 7/122 (6%)
 Frame = -1

Query  621  EALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS------EL  463
            EA+LS+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF      +      E+
Sbjct  101  EAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELTEATTAEDGGDEM  160

Query  462  RDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRM  283
            RDAFDFFDTDHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD NGDGFVCFEDFC M
Sbjct  161  RDAFDFFDTDHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLM  220

Query  282  ME  277
            ME
Sbjct  221  ME  222



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score =   168 bits (425),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS++GA+PPS+EE+ LMLSEVDR+G+G I+L+           P+ DSELRDAF  F
Sbjct  112  EALLSRLGADPPSQEEVMLMLSEVDREGNGSITLDALLNRVGPVCGPAADSELRDAFKVF  171

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+DHDGKISAEELFNVF  IGD RCTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  172  DSDHDGKISAEELFNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMME  226



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 7/122 (6%)
 Frame = -1

Query  621  EALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS------CDSEL  463
            EA+LS+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF  P          E+
Sbjct  101  EAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELPEEMTAEDGGDEM  160

Query  462  RDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRM  283
            RDAFDFFD DHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD NGDGFVCFEDFC M
Sbjct  161  RDAFDFFDADHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLM  220

Query  282  ME  277
            ME
Sbjct  221  ME  222



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E LLS++G EPPS+EE+ LML+E+D+DGDGCISLEEF  +SS+  P +  S+LR+AF+ F
Sbjct  102  EGLLSRIGGEPPSKEEMLLMLTEIDQDGDGCISLEEFEAISSSLVPAAL-SDLREAFNVF  160

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DGKISAEEL  VF  IGD RCTLEDCRRMI  VD NGDGFVCFEDF RMME
Sbjct  161  DADRDGKISAEELLGVFSAIGDDRCTLEDCRRMIRSVDTNGDGFVCFEDFSRMME  215



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS++GAEPPS+EE+  MLSEVD  GDGCIS+E       +   P+ D ELR AF+FF
Sbjct  102  EALLSRLGAEPPSQEEVATMLSEVDHVGDGCISVEALMNRIGSACEPAGDDELRVAFEFF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DGKI+AEELF V+K IGD RCT EDC RMI  VD NGDGFVCFEDFCRMME
Sbjct  162  DADQDGKITAEELFGVYKAIGDERCTFEDCMRMIASVDKNGDGFVCFEDFCRMME  216



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFD  448
            EALLS+V  +PPSREE+ LMLSEV  DG GCISL+     V+  A   P+C+ ELR+ FD
Sbjct  58   EALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTLMTQVVVPACDEPACEPELRETFD  117

Query  447  FFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             FDTDHDGKI+AEEL   FK TIGD RCTLEDCRRMI  VD NGDGFVCFEDF RMME
Sbjct  118  IFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIASVDKNGDGFVCFEDFARMME  175



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 93/119 (78%), Gaps = 7/119 (6%)
 Frame = -1

Query  621  EALLSQV-GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP---PSCDSELRDA  454
            EALL ++ GAEPP++EE+ +MLSEVD DGDGCI LE    L   F P   P+ DSELR+A
Sbjct  92   EALLKRLLGAEPPTQEEVAMMLSEVDGDGDGCIPLE---ALLHRFGPGCEPAADSELREA  148

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+ FDTDHDGKISAEEL +VF  IGD RCTLE+CRRMI  VD NGDGFVCF+DF RMM+
Sbjct  149  FEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDFARMMD  207



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS++G +PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+  
Sbjct  103  EALLSRLGNDPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVX  162

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD+DGKISAEEL  VF  IGD RCTLE+CRRMI GVD +GDGFVCFE+F  MME
Sbjct  163  DTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMME  217



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL Q+G  PPS+EE+ LMLSEVDRDG G I+LE         + P  DSELRDAF+ F
Sbjct  164  EALLCQLGNNPPSQEEVTLMLSEVDRDGSGSITLEALLNQVGPVSGPPADSELRDAFEVF  223

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD+DGKISAEEL  VF  IGD RCTLE+CRRMI  VD NGDGFVCFE+F  MME
Sbjct  224  DTDNDGKISAEELLRVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFEEFVHMME  278



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = -1

Query  621  EALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDF  445
            +A+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  ++LR+AF  
Sbjct  99   QAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GADLREAFAV  157

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+
Sbjct  158  FDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMD  213



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL ++G  PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+ F
Sbjct  174  EALLCRLGNAPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVF  233

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD+DGKISAEEL  VF  IGD RCTLE+CRRMI GVD +GDGFVCFE+F  MME
Sbjct  234  DTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMME  288



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = -1

Query  621  EALLSQVGA-EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDF  445
            EA+L ++G  +PP+ EE+  M++EVDRDGDGCISLEEF  + +AF PP+  +ELR+AF  
Sbjct  101  EAVLRRLGGVDPPTEEEVASMVAEVDRDGDGCISLEEFGAIGTAFGPPA-GAELREAFAV  159

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD + DGKISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFVCF+DF RMM+
Sbjct  160  FDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDFVRMMD  215



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            E+LL ++GAE    EE+  MLSEVDRDGDGCIS+E   S +      P+ D ELR AF+F
Sbjct  97   ESLLIRLGAE----EEVATMLSEVDRDGDGCISVEALMSRIGGPACEPAGDDELRVAFEF  152

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FDTDHDGKI+AEEL  V+K IGD RCTL+DCRRMI GVD NGDGFVCFEDF RMME
Sbjct  153  FDTDHDGKITAEELMGVYKAIGDERCTLDDCRRMIAGVDKNGDGFVCFEDFARMME  208



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            EALL ++GA+PP++EE++ MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDF
Sbjct  103  EALLIRLGADPPTQEEVKSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDF  162

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD DHDGKI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  163  FDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  218



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 87/116 (75%), Gaps = 4/116 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALLS+   +PPS+EE+  ML EVD DGDGCISLE    L +  A P+C+ ELR+ FD F
Sbjct  108  EALLSKFARQPPSQEEISSMLGEVDGDGDGCISLE---TLINQVAGPACEPELRETFDIF  164

Query  441  DTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTDHDGKI+AEEL   +K  +GD RCTLEDCR MI  VD NGDGFVCF+DF RMME
Sbjct  165  DTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDFSRMME  220



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFD  448
            EALL +V  +PPSR E+ LMLSEVD DGDG I+LE     V+  A   P+C+ ELR+ FD
Sbjct  109  EALLGKVARQPPSRIEVSLMLSEVDGDGDGYINLETLMNQVVGPACDEPACEPELRETFD  168

Query  447  FFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             FDTDHDGKI+AEEL   FK  IGD RCTLEDCRRMI  VD N DGFVCFEDF RMME
Sbjct  169  IFDTDHDGKITAEELMAFFKDKIGDERCTLEDCRRMIASVDKNEDGFVCFEDFSRMME  226



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL ++G +P SREE+ LMLSEVDRDG+G ISLE         + P+ DSELRDAF+ F
Sbjct  106  EALLCRLGNDPQSREEVTLMLSEVDRDGNGSISLEAVLNRVGPVSGPAADSELRDAFEVF  165

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD+DGKISAEEL + F+ IGD  CTLE+C RMI G D NGDGFVCFE+F  MME
Sbjct  166  DTDNDGKISAEELLSFFRAIGDEGCTLEECGRMIAGADKNGDGFVCFEEFAHMME  220



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  621  EALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDF  445
            EA+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  +ELR+ F  
Sbjct  110  EAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GAELREVFAV  168

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF  +GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+
Sbjct  169  FDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMD  224



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            EALL ++GA+PP++EE+  MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDF
Sbjct  103  EALLIRLGADPPTQEEVSSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDF  162

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD DHDGKI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  163  FDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  218



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            ALLS++  EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ 
Sbjct  95   ALLSRLSPEPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREV  151

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+FFD DHDG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  152  FEFFDVDHDGRISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 6/121 (5%)
 Frame = -1

Query  621  EALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCD---SELR  460
            EA+LS+VG + PP+ EEL L+L E+D++GDGCISLE F  ++SAF   PPS      E+R
Sbjct  93   EAILSRVGGKSPPTEEELVLLLDELDKNGDGCISLENFETITSAFEPTPPSAAEDAGEMR  152

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DAFDFFD DHDGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD NGDGFVCFEDFC MM
Sbjct  153  DAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDFCLMM  212

Query  279  E  277
            E
Sbjct  213  E  213



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            ALLS +  EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ 
Sbjct  93   ALLSGLSPEPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREV  149

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+FFD DHDG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  150  FEFFDLDHDGRISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  208



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDF  445
            ALLS++  EPPS+EE+ LML EVD  GDGCISLEE +  V  S+        E+R+ F+F
Sbjct  95   ALLSRLSPEPPSQEEVTLMLQEVDGGGDGCISLEELASRVAGSSSDSDESSVEMREVFEF  154

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD DHDG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  155  FDVDHDGRISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = -1

Query  621  EALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDF  445
            EA+L  +G A+PP+ EE+  M++EVD DGDGCISLEEF  + SAF PP+   +LR+AF  
Sbjct  101  EAVLRGLGGADPPTEEEVASMVAEVDLDGDGCISLEEFGAIGSAFGPPA-GGDLREAFAV  159

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF T+GD   TLEDCRRMI  VD +GDGFVCFEDF RMM+
Sbjct  160  FDADGDGKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDFVRMMD  215



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL+++GAEPPS EE+ ++L EVD      IS+E  +        P+ D ELRDAF FF
Sbjct  101  EALLTRLGAEPPSSEEMAVILGEVDH-----ISVEALASRLGTACEPAGDDELRDAFVFF  155

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+A+EL NV+K  GD +CTLEDCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  156  DSDRDGKITADELLNVYKAFGDEKCTLEDCRRMIAVVDKNGDGFVCFEDFCRMME  210



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF----SVLSSAFAPPSCDSELRDA  454
            EA+L+++GA PP+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+A
Sbjct  95   EAVLTRLGARPPTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREA  154

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+ FDTD DG+ISAEEL  VF+ IGD RCTLE+C+RMI GVD NGDGFVCF++F  MM+
Sbjct  155  FEVFDTDRDGRISAEELLRVFRAIGDERCTLEECKRMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 6/121 (5%)
 Frame = -1

Query  621  EALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCDS---ELR  460
            EA+LS+VG + PPS EEL L+L E+D +GDGCISLE F  ++SAF   P S      E+R
Sbjct  91   EAILSRVGGKSPPSEEELVLLLDELDENGDGCISLENFETITSAFESTPTSAAGDAGEMR  150

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DAFDFFD DHDGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD NGDGFVCF+DFC MM
Sbjct  151  DAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFDDFCLMM  210

Query  279  E  277
            E
Sbjct  211  E  211



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 8/115 (7%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL ++GA+PP++EE++ MLSEVDR+GDG +         ++   P+C+ EL++ FDFF
Sbjct  103  EALLIRLGADPPTQEEVKSMLSEVDREGDGRVG--------NSSCEPACEPELKETFDFF  154

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  155  DADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  209



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL+++GAEPPS +E+ +ML EVD      IS+EE +    +   P+   ELRDAF FF
Sbjct  104  EALLTRLGAEPPSSQEMAVMLGEVD-----LISVEELASRLGSACEPAGGDELRDAFVFF  158

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+AEEL NV+K  GD +CTLEDC+ MI  VD NGDGFVCFEDFCRMME
Sbjct  159  DSDRDGKITAEELLNVYKAFGDEKCTLEDCKGMIAVVDKNGDGFVCFEDFCRMME  213



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF----SVLSSAFAPPSCDSELRDA  454
            EA+L+++GA PP+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+A
Sbjct  95   EAVLTRLGARPPTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREA  154

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+ FDTD DG+ISAEEL  VF+ IGD RC LE+C+RMI GVD NGDGFVCF++F  MM+
Sbjct  155  FEVFDTDRDGRISAEELLRVFRAIGDERCALEECKRMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E +L ++G +PP+ EE+  ML+E DR GDG I LEE   L SAF PP    ELR+ F  F
Sbjct  99   EVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVALGSAFGPPVV-PELRETFAVF  157

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG ISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVCFEDF RMM+
Sbjct  158  DGDGDGMISAEELLAMFVTLGDKRCTLEDCRRMIGVVDSDGDGFVCFEDFVRMMD  212



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL+++GAEPPS EE+ ++L EVD      IS+E  +        P+ + ELRDAF FF
Sbjct  96   EALLTRLGAEPPSSEEMAVILGEVDH-----ISVEALASRLGTACEPAGNDELRDAFVFF  150

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DGKI+A+EL NV+K  GD +CTL+DCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  151  DSDRDGKITADELLNVYKAFGDEKCTLDDCRRMIAVVDKNGDGFVCFEDFCRMME  205



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E +L ++G +PP+ EE+  ML+E DR G+G I L+E   L SAF PP    EL+  F  F
Sbjct  93   EVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQEIVALGSAFGPPVA-PELQQTFAVF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVCFEDF RMM 
Sbjct  152  DVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVCFEDFVRMMH  206



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E +L ++G +PP+ EE+  ML+E DR GDG I L+E   L SAF PP    ELR+ F  F
Sbjct  93   EVVLQRLGPDPPTEEEVAAMLAEADRGGDGSIRLQEIVALGSAFGPP-VAPELRETFAVF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD++ DGFVCFEDF RMM 
Sbjct  152  DVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDCDGFVCFEDFVRMMH  206



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 12/115 (10%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL ++GA+PP++EE++ MLSEVDR+GDG I LE               S L++ FDFF
Sbjct  103  EALLIRLGADPPTQEEVKSMLSEVDREGDGYIPLEALI------------SRLKETFDFF  150

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDGKI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  151  DADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  205



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC--DSELRDAFD  448
            EA+L ++  + P+ EE+  M++E+DRDGDGCISL+EF+ L  A A  +   +SELR+AF 
Sbjct  104  EAVLRRLVPDAPTAEEVASMVAEMDRDGDGCISLDEFAALGPALAASAGGGESELREAFA  163

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             FD D DGKISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFV FEDF RMM+
Sbjct  164  VFDADGDGKISAEELLGVFATLGDCGCTLEDCRRMIGGVDADGDGFVGFEDFVRMMD  220



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 18/115 (16%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            +ALL  +GAEPPS EE+++M+ E+DR G                  P+C SELRD F+ F
Sbjct  134  KALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PACHSELRDTFEIF  175

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDG+I+AEELF+VF  +GD  CTLEDCRRMI GVD NGDGFVCF+DF RMM+
Sbjct  176  DADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVCFDDFARMMD  230



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E +L+++GA     EE+ +ML+EVD DG GCIS+E         + P+ + ELR+AF+ F
Sbjct  100  ELVLTRLGARA---EEIAIMLTEVDGDGRGCISVEAIMNRVGTGSDPNPEEELREAFEVF  156

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD DG+ISAEEL  VFK IGD RCTLE+CRRMI GVD N DGFVCFEDF RMME
Sbjct  157  DTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDKNRDGFVCFEDFSRMME  211



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 18/115 (16%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            +ALL  +GAEPPS EE+++M+ E+DR G                  P+C SELRD F+ F
Sbjct  67   KALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PTCHSELRDTFEIF  108

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDG+I+AEELF+VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF RMM+
Sbjct  109  DADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFVRMMD  163



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 18/115 (16%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            +ALL  +GAEPPS EE+++M+ E+DR G                  P+C SELRD F+ F
Sbjct  68   KALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PTCHSELRDTFEIF  109

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D DHDG+I+AEELF+VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF RMM+
Sbjct  110  DADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFVRMMD  164



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL+++GAEPPS EE+ +ML E D      +S+E  +    +   P+ D ELRDAF FF
Sbjct  104  EALLTRLGAEPPSSEEMAVMLGERDH-----VSVEALASRLGSACEPAGDDELRDAFVFF  158

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D+D DG+I+AEEL NV+K  GD +CTLEDC  MI  VD NGDGFVCFEDFCRMME
Sbjct  159  DSDRDGRITAEELLNVYKAFGDEKCTLEDCAGMIAVVDKNGDGFVCFEDFCRMME  213



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGD--GCISLEEF-SVLSSAFAPPSCDSE-LRDAF  451
            ALLS++  EPPS+EE+ LML EVD D D  GCISLE+  S ++      S ++E LR+ F
Sbjct  97   ALLSRLSPEPPSQEEVSLMLKEVDGDNDDGGCISLEDLASRVAGTSGQGSVETEELREVF  156

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            ++FD D +GKISAEEL  VF  IGD RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  157  EYFDADRNGKISAEELHRVFGVIGDERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  214



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E+LLS++G EP + EE+ +M+ EVDRDGDG I LEE +    +  P    +EL++ F+FF
Sbjct  79   ESLLSKLGPEPLTEEEIDVMIKEVDRDGDGTIRLEELASRVVSLDPCRDSTELKETFEFF  138

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG ISAEEL  VF+TIGD RCTL+DC+RMI  VD +G+GFVCF +F RMM+
Sbjct  139  DADRDGMISAEELLRVFETIGDERCTLDDCKRMIADVDVDGNGFVCFTEFSRMMD  193



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            AL+S++  EPPS+EE+ LML EVD    GCISLEE   L+S  A  S +      ELR+ 
Sbjct  93   ALISRLSPEPPSQEEVSLMLREVDGGDGGCISLEE---LASRVAGTSGEGSVETEELREV  149

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F+ FD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMM
Sbjct  150  FEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFEDFCRMM  207



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E +L ++G +PP+ EE+  ML+E DR GDG I LEE   L S   PP    ELR+ F  F
Sbjct  89   EVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVELGSVVGPPVV-PELRETFAVF  147

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DGKISAEEL  +F T+GD +CTLEDCRRMI  VD++GDGFVCF+DF RMM+
Sbjct  148  DADGDGKISAEELLAMFVTLGDEQCTLEDCRRMIGVVDSDGDGFVCFQDFVRMMD  202



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 85/120 (71%), Gaps = 9/120 (8%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDG-CISLEEFSVLSSAFAPPSCDS-----ELRD  457
            ALLS++  EPPS+EE+ LML EVD D DG  I LEE   L+S  A  S +      ELR+
Sbjct  93   ALLSRLSPEPPSQEEVSLMLKEVDGDDDGDSIRLEE---LASRVAGTSGEGSVETEELRE  149

Query  456  AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             F+FFD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  150  VFEFFDADRNGKISAEELHRVFGVIGDERCTLEECIRMIATVDRNGDGFVCFEDFCRMME  209



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E+LLS++G EP + EE+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FF
Sbjct  89   ESLLSRLGPEPLTEEEINVMIKEVDGDGDGTIRLEELASRVVSLDPARDSTELKETFEFF  148

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG ISA+EL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  149  DADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  203



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            EALLS++G +P S+EE+ +ML ++DRDGDG I LE   S + SA       +ELR+ F+F
Sbjct  97   EALLSRLGPDPLSQEEIDVMLGDLDRDGDGAIRLEALASRVVSAGDLSRHSAELRETFEF  156

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DG ISAEEL  VF +IGD +CTLEDCRRMI  VD +GDGFVCF +F RMME
Sbjct  157  FDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDEDGDGFVCFGEFSRMME  212



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDF  445
            ALLS++  +PPS+EE+ +ML  VD   DGCISLEE +  V  S+ A      ELR+ F F
Sbjct  106  ALLSRLSPDPPSQEEVSMMLRVVDGGDDGCISLEELANRVAGSSAAGSMEAGELREVFGF  165

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DG+ISAEEL  VF  IGD RCTLE+C+RMI  VD NGDG+VCF+DF RMME
Sbjct  166  FDADRDGRISAEELHRVFAVIGDERCTLEECQRMIATVDGNGDGYVCFDDFSRMME  221



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSE--VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFD  448
            E +LS++GA+ PS E   +++    VDRDGDGCI+L+E    S AF P    SELRDAFD
Sbjct  102  ENILSRLGADTPSEEMQMMLMELMEVDRDGDGCINLKETGATSPAFGPYDG-SELRDAFD  160

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FFD   DGKISA+EL  VF  +GD RCT+EDCR MI GVD +GDGFVCFEDF RMME
Sbjct  161  FFDAGRDGKISADELHRVFTALGDDRCTIEDCRLMIGGVDTDGDGFVCFEDFLRMME  217



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 5/117 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFD  448
            ALLS++  EPPS+EE+ +ML EVD   DGCISLEE  S ++ + +   C    E+R+ F+
Sbjct  89   ALLSRLSPEPPSQEEVSMMLREVD--ADGCISLEELASRVAGSTSGEGCVETEEMREVFE  146

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FFD D DG+ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DFCRMME
Sbjct  147  FFDADRDGRISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFCRMME  203



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC-DSELRDAFDF  445
            EA+L ++  +PP+ EE+  M++EVDRDGDGCISL+EF  L +        +SELRDAF  
Sbjct  105  EAVLRRLVPDPPTAEEVASMVAEVDRDGDGCISLDEFGALGALLGGGRGGESELRDAFAV  164

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF T+GD  CTL+DCRRMI GVD +GDGFV F+DF RMM+
Sbjct  165  FDADGDGKISAEELLGVFATLGDGGCTLDDCRRMIGGVDTDGDGFVGFDDFVRMMD  220



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDR-DGDGCISLEEFS--VLSSAFAPPSCDSE-LRDAF  451
            ALLS++  +PPS+EE+ LML EVD  +  GCISLEE +  V  S+    S ++E +R+ F
Sbjct  103  ALLSRLSPDPPSQEEVSLMLREVDGGEESGCISLEELASRVAGSSSGEGSVETEEMREVF  162

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            +FFD D DGKISAEEL+ VF  IGD RCT+++CRRMI  V  NGDGFVCFEDF RMME
Sbjct  163  EFFDADRDGKISAEELYRVFGVIGDERCTIDECRRMIATVGRNGDGFVCFEDFSRMME  220



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E+LLS++G +P + EE+ +ML EVD DGDG I LEE +    +  P    +EL++ F+FF
Sbjct  92   ESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFF  151

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG ISA+EL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  152  DADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  206



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            AL+S++  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ 
Sbjct  92   ALISRLSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREV  148

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F+ FD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  149  FEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  206



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            AL+S++  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ 
Sbjct  93   ALISRLSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREV  149

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F+ FD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  150  FEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDA  454
            AL+S++  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ 
Sbjct  93   ALISRLSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREV  149

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F+ FD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  150  FEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS---VLSSAFAPPSCDSELRDAFD  448
            A+L ++  EPPS EE+R+ML EVD  GDGCISLEE +     +SA        ELR+ F+
Sbjct  100  AVLRRLSPEPPSEEEVRMMLREVD-GGDGCISLEELASRVAGTSATGSSVEKGELREVFE  158

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FFD D DG+ISAEEL  VF  IGD RCTL++CRRMI  VD  GDGFV F+DF RMME
Sbjct  159  FFDADRDGRISAEELLRVFGVIGDDRCTLDECRRMIATVDMKGDGFVRFDDFSRMME  215



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 8/119 (7%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSELRDA  454
            EALLS++G    SR+E+ +MLSEV   G+G    +S+EE  S +  A  P   D+ELR+ 
Sbjct  107  EALLSRLG----SRDEVAVMLSEVGCHGEGEDAAVSIEELLSRVGPACGPACDDAELRET  162

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+FFD DHDGKI+AEEL  VF   GD RCTLE+CRRMI  VD NGDGFVCFEDF RMME
Sbjct  163  FEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDFTRMME  221



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E+LLS++G +P + +E+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FF
Sbjct  95   ESLLSRLGPDPLTEDEISVMIQEVDCDGDGAIRLEELASRLVSSDPSRDSAELKETFEFF  154

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG ISAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  155  DADRDGLISAEELLRVFSTIGDDRCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  209



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS++ +E    EE+ +MLSEVD  GDG I LEE      +    + +SELR+ F+FF
Sbjct  80   EAILSRIASE----EEVAMMLSEVDSGGDGFIRLEELMARVGS-GEAAGESELRETFEFF  134

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG+I+AEEL  VF++IGD +CTLEDCRRMI  VD NGDGFVCF +F RMME
Sbjct  135  DADQDGRITAEELHGVFRSIGDEQCTLEDCRRMIRDVDENGDGFVCFAEFVRMME  189



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EALL+ +GA P   +++ +ML EVD  GDG       S + S   P S   EL++AF+ F
Sbjct  102  EALLTCLGASP-CPDDVAVMLGEVD--GDGITVERLMSYVGSGLKPGSDPDELKEAFEVF  158

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD DG+ISAEEL  VFK IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMME
Sbjct  159  DTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMME  213



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = -1

Query  621  EALLSQ---VGAEPPSREELRLMLSEVDR-DGDGCISLEEF--SVLSSAFAPPSCDSELR  460
            EALLS+   VG+   S + +  MLSEVD  DG+GCIS+E     V S+A   P+ DSELR
Sbjct  106  EALLSRLGGVGSISESEDFVASMLSEVDGGDGEGCISVEALMSRVGSAAACEPAGDSELR  165

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +AFDFFDTD DG+I+A+EL + F  IGD RCTL+DCRRMI GV  +G+GFVCFEDF RMM
Sbjct  166  EAFDFFDTDRDGRITADELHSFFTAIGDERCTLQDCRRMIDGVGRSGEGFVCFEDFSRMM  225

Query  279  E  277
            E
Sbjct  226  E  226



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  606  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDH  430
            +V A   S EE+  M+ ++D DGDGCISLEE   + SA  P   D + L+DAF FFD + 
Sbjct  96   RVNAPSLSEEEVAEMIKDIDTDGDGCISLEELEAVGSALDPTGADEDDLKDAFGFFDVNK  155

Query  429  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DGKIS EEL   F  +GD RCTLE+CRRMI GVD N DGFVCF+DF RMM
Sbjct  156  DGKISPEELHAGFVALGDERCTLEECRRMIEGVDKNKDGFVCFQDFSRMM  205



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFD  448
            ALLS++  EPPS EE+ +ML EVD   DGCISLEE  S ++   +   C    E+R+ F+
Sbjct  89   ALLSRLSPEPPSPEEVSMMLREVD--ADGCISLEELASRVAGTSSGEGCIETEEMREVFE  146

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FFD D DG+ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  147  FFDADRDGRISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSE-LRDA  454
            ALLS++  EPPS+EE+ LML EVD DGD    CISLE+  S ++      S ++E LR+ 
Sbjct  94   ALLSKLSPEPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREV  153

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F++FD D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  154  FEYFDADRNGKISAEELHRVFGVIGDERCTLEECVRMIATVDRNGDGFVCFEDFCRMME  212



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFD  448
            ALLS++  EPPS EE+ +ML EVD   DGCISLEE  S ++   +   C    E+R+ F+
Sbjct  89   ALLSRLSPEPPSPEEVSMMLREVD--ADGCISLEELASRVAGTSSGEGCIETEEMREVFE  146

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FFD D DG+ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  147  FFDADRDGRISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            E+LL+++GA P S  ++ LML EVD DG    SL   S + S     S   EL++AF+ F
Sbjct  105  ESLLTRLGASP-SPGDVALMLGEVDGDGITVESL--MSYVGSGLETGSDPDELKEAFEVF  161

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            DTD DG+ISAEEL  VFK IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMM+
Sbjct  162  DTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMMD  216



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 4/116 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDF  445
            +LLS++G +PPS EE+ +ML EVD DG+G I +EE +  V+SS  +  S  +EL++ F+F
Sbjct  95   SLLSRLGPDPPSEEEIDVMLREVDCDGEGTIRIEELASRVVSSDQSRDS--TELKETFEF  152

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DG ISAEEL  VF  IGD RCTLEDC+RMI  VD++G+GFVCF +F RMM+
Sbjct  153  FDADRDGFISAEELLRVFSAIGDERCTLEDCKRMIAAVDDDGNGFVCFSEFSRMMD  208



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDG--DGCISLEEFS-VLSSAFAPPSCDSELRDAFDF  445
            L+S++  EPPS EE+ LML EVD DG  DGCISLE+ +  +  A +    + E+R+ F++
Sbjct  99   LISKLSPEPPSHEEVSLMLREVD-DGEEDGCISLEDLANRVVVASSGDGSEEEMREVFEY  157

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DG+ISAEEL+ VF  IGD RCTL++CRRMI  VD NGDGFVCF DF  MME
Sbjct  158  FDVDRDGRISAEELYRVFGVIGDERCTLDECRRMIATVDKNGDGFVCFHDFSCMME  213



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 6/121 (5%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS----VLSSAFAPPS--CDSELR  460
            E+LL+++G +PP+ EE+ +ML EVD DGDG I LEE +    V+SS     S     EL+
Sbjct  95   ESLLTRLGPDPPTEEEIDVMLKEVDCDGDGTIRLEELASRCVVVSSEDDNKSRGGSDELK  154

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            + F+FFD D DGKISAEEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM
Sbjct  155  ETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFAEFSRMM  214

Query  279  E  277
            +
Sbjct  215  D  215



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSE-LRDA  454
            ALLS++  EPPS+EE+ LML EVD DGD    CISLE+  S ++      S ++E LR+ 
Sbjct  94   ALLSRLSPEPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREV  153

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F++FD D +GKISAEEL  VF  IGD RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  154  FEYFDADRNGKISAEELHRVFGVIGDERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  212



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EA+LS++ +E    EE+ +ML EVD  GDG I LEE      +    + +SE+R+ F+FF
Sbjct  80   EAILSRIASE----EEVAMMLREVDSGGDGFIRLEELMARVGS-GEAAGESEMRETFEFF  134

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D D DG+I+AEEL  VF++IGD RCTLEDC RMI  VD NGDGFVCF +F RMME
Sbjct  135  DADQDGRITAEELHGVFRSIGDERCTLEDCGRMIRDVDENGDGFVCFAEFVRMME  189



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            EA+L+++GA      ++ LMLSEV+    GCI++E   + + S     S   EL++AF  
Sbjct  102  EAVLTRLGAS-----DVALMLSEVEGGAGGCITVEALMNHIGSGPESGSDPEELKEAFAV  156

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FDTD DG+ISAEEL  VF+ IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMME
Sbjct  157  FDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMME  212



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            E+LL+++G +PP+ EE+ +ML EVD DGDG + LEE  S             EL++ F+F
Sbjct  90   ESLLTRLGPDPPTEEEIDVMLREVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEF  149

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  150  FDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  205



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            E+LL+++G +PP+ EE+ +ML EV+ DGDG + LEE  S             EL++ F+F
Sbjct  90   ESLLTRLGPDPPTEEEIDVMLKEVNCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEF  149

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  150  FDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  205



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 8/123 (7%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAF----APPSCDSE  466
            EALLS++GAEP S +E  LML EV   D  G   + +E+  S + SA     A   CD E
Sbjct  99   EALLSRLGAEPLSADEKALMLREVGCADEGGAAGVRIEDLVSRVGSAGGDEEADAGCDVE  158

Query  465  LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCR  286
            +R  F+FFD + DG+I+AEEL   F+ +GD RCTL +CRRMI  VD NGDGFVCFEDF R
Sbjct  159  MRRTFEFFDRNGDGRITAEELLGAFEAMGDGRCTLGECRRMIAEVDRNGDGFVCFEDFSR  218

Query  285  MME  277
            MM+
Sbjct  219  MMQ  221



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDF  445
            E+LL+++G +P + EE+ +ML EVD DGDG + LEE  S             EL++ F+F
Sbjct  127  ESLLTRLGPDPLTEEEIDVMLKEVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEF  186

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            FD D DGKISAEEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  187  FDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  242



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV----LSSAFAPPSCDSELRDA  454
            EALL+Q+G  PP+++E+ +ML EVDRDG G IS++  +       S+ +     +EL++ 
Sbjct  78   EALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDTLATRVVSSVSSDSSHGSSTELKET  137

Query  453  FDFFDTDHDGKISAEELFNVFKT-IGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            F+ FD+D +G ISAEEL  VF   IGD RCTLE+C RMI  VD +GDGFV F +F RMM+
Sbjct  138  FELFDSDRNGLISAEELLRVFAAAIGDDRCTLEECSRMIAAVDEDGDGFVSFNEFSRMMD  197



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGD-GCISLEEFSVLSSAFAPPSCDS-ELRDAFD  448
            E+LL+++G +P + +E+ +M+ EV  +GD G I LEE +        PS DS E+++ F+
Sbjct  98   ESLLTRLGPDPLTEDEINVMIKEVGCEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFE  157

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            FFD D DG ISAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  158  FFDADRDGLISAEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  213



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAF  451
            E+LLS++G +P + +E+ +M+ EV  +   DG I LEE +        PS DS EL++ F
Sbjct  99   ESLLSRLGPDPLTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAELKETF  158

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +FFD D DG ISAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  159  EFFDADRDGLISAEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  215



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 11/114 (10%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            ALL+++  EPPS++E+ +ML    R+ DG ++        ++ A      ELR+ F+FFD
Sbjct  106  ALLTRLSPEPPSQDEVSMML----READGGVA-------GTSAAGSVEAEELREVFEFFD  154

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
             D DG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDF RMME
Sbjct  155  ADRDGRISAEELLRVFGVIGDDRCTLEECLRMIATVDVNGDGFVCFEDFSRMME  208



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAF  451
            E+LL+++G +P + +E+ +M+ EV  +   DG I LEE +        PS DS E+++ F
Sbjct  100  ESLLTRLGPDPLTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAEMKETF  159

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +FFD D DG ISAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  160  EFFDADRDGLISAEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  216



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF---APPSCDSELRDAFD  448
             +L  +G E PS E+LR M+ EVD DGDG +  +EF  L++     A  +   EL+ AF 
Sbjct  35   GVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFVHLNTEILGDALAASVEELKAAFY  93

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             FDTD +G ISAEEL+ V   +G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  94   VFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = -1

Query  483  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVC  304
            P    EL  AF +FD + DGKIS  EL  V K++G++    ED R M+  VD +GDGFV 
Sbjct  7    PRHIQELEHAFRYFDANGDGKISVAELGGVLKSLGENPSE-EDLRTMVREVDADGDGFVD  65

Query  303  FEDFCRM  283
            F++F  +
Sbjct  66   FDEFVHL  72



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF---APPSCDSELRDAFD  448
             +L  +G E PS E+LR M+ EVD DGDG +  +EF  L++     A  +   EL+ AF 
Sbjct  35   GVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFVHLNTEILGDALAASVEELKAAFY  93

Query  447  FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             FDTD +G ISAEEL+ V   +G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  94   VFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = -1

Query  483  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVC  304
            P    EL  AF +FD + DGKIS  EL  V K++G++    ED R M+  VD +GDGFV 
Sbjct  7    PRHIQELEHAFRYFDANGDGKISVAELGGVLKSLGENPSE-EDLRTMVREVDADGDGFVD  65

Query  303  FEDFCRM  283
            F++F  +
Sbjct  66   FDEFVHL  72



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDF  445
            +LS +G+ P +REE +  ++E+D+DGDG I L+EF+  +L      P C + ELRDAFD 
Sbjct  62   VLSALGSSPTTREEAQAAMAEIDKDGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDL  121

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +G IS  EL  V K +G  +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  122  YDLDGNGVISVSELHAVMKKLG-QKCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  175



>gb|ABK24059.1| unknown [Picea sitchensis]
 gb|ABK24534.1| unknown [Picea sitchensis]
Length=260

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP-----------PSCDSELRDAFDFFD  439
            S EEL LM+   D+DGDG I L+EF  L++A A            P+ D +L DAF  FD
Sbjct  145  SEEELALMVQAADKDGDGSIDLDEFISLNTAAADAAEFSASAGVFPATD-DLHDAFRIFD  203

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D DGKISA+EL  V  ++GD+ CT++DCR+MI GVD NGDG+V F+DF  MM
Sbjct  204  ADKDGKISAQELHRVLTSLGDAECTIDDCRQMIRGVDKNGDGYVDFQDFSTMM  256



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EEL  M+ EVD DGDG I+LEEF  L++    P      L+DAF  FD D +G 
Sbjct  78   GQPATEEELNNMIREVDADGDGHINLEEFIELNTKDVNPNEIIENLKDAFSIFDIDGNGS  137

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL NV  +IGD +C+L +C++MI GVD +GDG + FE+F RMM
Sbjct  138  ITAEELHNVMVSIGD-KCSLAECKKMIRGVDKDGDGMIDFEEFKRMM  183



>ref|XP_006843397.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
 gb|ERN05072.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
Length=229

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +   +G EPPS EELR     V  D +G ISLE+ +   +  +     SEL +AF  FD 
Sbjct  115  VFRALGVEPPSYEELR----NVATDDEGRISLEDLARFGAPASAEEPVSELMEAFGVFDR  170

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DG+ISAEEL  V   +GD+ CT+ DC RMI G D++GDGFVCF+DF RMM
Sbjct  171  DGDGRISAEELQGVLSALGDAECTVGDCHRMIRGFDSDGDGFVCFQDFARMM  222



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 9/117 (8%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP---SCDSELRDAF  451
            + +L+ +G +    E  R+ML EVD DGDG I LEEF+    AF  P   S   +LRDAF
Sbjct  32   DGVLNALGTKTTPDEAKRMML-EVDTDGDGFIDLEEFA----AFHCPVEGSNSKDLRDAF  86

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +D D +GKISA EL +V K IG+ +C+L+DCRRMI  VD++GDG V FE+F +MM
Sbjct  87   DLYDKDKNGKISASELHSVMKGIGE-KCSLKDCRRMISSVDDDGDGSVNFEEFKKMM  142


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = -1

Query  471  SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
             E+   F  +DT+ DGKIS  EL  V   +G ++ T ++ +RM+L VD +GDGF+  E+F
Sbjct  9    KEVEKVFRKYDTNGDGKISLSELDGVLNALG-TKTTPDEAKRMMLEVDTDGDGFIDLEEF  67

Query  291  C  289
             
Sbjct  68   A  68



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGK  421
              P + EELR M+ EVD DGDG I L EF  L++           LRDAF+ FD D +G 
Sbjct  69   GHPATEEELRTMIQEVDSDGDGFIDLREFIELNTNGIGQDEVIENLRDAFEVFDMDKNGS  128

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            ISAEEL NV K++G+  CTL +CR+MI GVD +G+G +CF++F  MM
Sbjct  129  ISAEELHNVLKSLGE-ECTLAECRKMISGVDADGNGTICFDEFKVMM  174



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFF  442
             +L+ +G +    E  R+ML EVD DGDG I L+EF+       +P + + +LR+AF+ +
Sbjct  43   GILNALGTKTTPDEAKRMML-EVDTDGDGFIDLKEFAAFHCPVESPNTVNKDLREAFNLY  101

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +GKISA EL +V K IG+ +C+L+DCRRMI  VD++GDG V FE+F +MM
Sbjct  102  DKDKNGKISAAELHSVMKGIGE-KCSLKDCRRMISSVDDDGDGSVNFEEFKKMM  154



>gb|KHN40730.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=143

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EEL+ ++ EVD DGDG I+LEEF+ L++    P      L+DAF  FD D +G 
Sbjct  32   GQPATEEELKKLIREVDSDGDGHINLEEFTELNTKDVDPDEVLENLKDAFSIFDLDGNGS  91

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL  V  ++GD+ C++E+CR+MI GVD NGDG + F++F  MM
Sbjct  92   ITAEELKMVMASLGDA-CSIEECRKMIAGVDGNGDGMINFDEFQIMM  137



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L+ +G++    E  R+ML EVD DGDG I L+EF+         S + ELR+AFD +D
Sbjct  43   AILNALGSKTSPDEVKRIML-EVDTDGDGFIDLKEFAAFYCPGGADSDNKELREAFDLYD  101

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  102  KDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISKVDVDGDGCVNFEEFKKMM  153



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 76/115 (66%), Gaps = 9/115 (8%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP---SCDSELRDAFDF  445
            +L  +G +    E  R+ML EVD DGDG I LEEF+    AF  P   S   +LRDAFD 
Sbjct  34   VLKALGTKTTPDEAKRMML-EVDTDGDGFIDLEEFA----AFHCPVEGSNSKDLRDAFDL  88

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +GKISA EL +V K IG+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  89   YDKDKNGKISAAELHSVMKGIGE-KCSLKDCRRMISSVDVDGDGSVNFEEFKKMM  142


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  471  SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
             E+   F  FDT+ DGKIS  EL  V K +G ++ T ++ +RM+L VD +GDGF+  E+F
Sbjct  9    KEVEKVFRKFDTNGDGKISLLELDEVLKALG-TKTTPDEAKRMMLEVDTDGDGFIDLEEF  67

Query  291  C  289
             
Sbjct  68   A  68



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EEL  M+ EVD DGDG I+LEEF  L++    P      L+DAF  FD D +G 
Sbjct  75   GQPATEEELDNMIREVDADGDGHINLEEFIELNTKDIDPNEILENLKDAFSVFDIDKNGS  134

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            ISAEEL NV  ++GD +C+L +C++MI GVD++GDG + FE+F +MM
Sbjct  135  ISAEELHNVMVSLGD-QCSLAECQKMIGGVDSDGDGMIDFEEFKKMM  180



>ref|XP_004241666.2| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=197

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS-VLSSAFAPPSCDSELRDAFDFF  442
             +L  +G++  S EE+  M++E+D D DGCI+L+EF+    +  +      EL++AFD +
Sbjct  83   GVLKALGSDT-SPEEVARMMAEIDTDKDGCINLDEFADFCKNDESVDGGAKELKEAFDLY  141

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DH+G+ISA EL  +   +G + CTL+DC RMI  VD NGDG+VCFE+F +MM
Sbjct  142  DQDHNGRISATELHQILNRLGQN-CTLQDCTRMITSVDANGDGYVCFEEFKKMM  194



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EEL+ ++ EVD DGDG I+LEEF+ L++    P      L+DAF  FD D +G 
Sbjct  71   GQPATEEELKKLIREVDSDGDGHINLEEFTELNTKDVDPDEVLENLKDAFSIFDLDGNGS  130

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL  V  ++GD+ C++E+CR+MI GVD NGDG + F++F  MM
Sbjct  131  ITAEELKMVMASLGDA-CSIEECRKMIAGVDGNGDGMINFDEFQIMM  176



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP--SCDSELRDAFDF  445
             +L  +G+E  S +E+  M+ E+D D DG I+L+EF+   SA A P  S + ELR+AF+ 
Sbjct  43   GVLKALGSES-SPDEVARMMGEIDTDKDGNINLQEFAAFCSAEADPYHSAEKELREAFEL  101

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D +HDGKISA EL      +G+  C++EDC  MI  +D NGDG+V FE+F +MM
Sbjct  102  YDQNHDGKISAAELQKTLLRLGE-HCSIEDCAGMIKPIDANGDGYVSFEEFKKMM  155



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS-VLSSAFAPPSCDSELRDAFDFF  442
             +L  +G++  S EE+  M++E+D D DGCI+++EF+    +  +      EL++AFD +
Sbjct  40   GVLKALGSDT-SPEEVARMMAEIDTDKDGCINIDEFADFCKNDDSVDGGAKELKEAFDLY  98

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DH+G+ISA EL  +   +G   CT++DC RMI  VD NGDG+VCFE+F +MM
Sbjct  99   DQDHNGRISATELHQILNRLG-QNCTIQDCTRMITSVDANGDGYVCFEEFKKMM  151



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L+ +G++    E  R+ML EVD DGDG I L+EF+           + ELR+AFD +D
Sbjct  43   AILNALGSKTSPDEVNRIML-EVDTDGDGFIDLKEFAAFYCPRGADGDNKELREAFDLYD  101

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  102  KDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISKVDVDGDGCVNFEEFKKMM  153



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFF  442
            A++S +G +P S EEL  M+SEVD DGDG I+ +EF  L++     +   E L+DAF  +
Sbjct  79   AIMSSLG-QPSSDEELNSMISEVDSDGDGFINFKEFVELNTKGVDSAEALENLKDAFSVY  137

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL+ V +++GD  C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  138  DIDGNGSISAEELYEVLRSLGD-ECSIDECRQMIGGVDSDGDGMISFEEFKVMM  190



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS----CDSELRDA  454
            EAL S+  A+  +R     M+ E+D D DG ISLEEF+V  SA + PS     + ELR+A
Sbjct  46   EALGSETSADEVAR-----MMEEIDTDKDGFISLEEFAVFCSADSDPSGGGNSEKELREA  100

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            FD +D DHDG+IS  EL  +   +G+ RC++ DC  MI  VD++GDGFV F++F +MM
Sbjct  101  FDLYDQDHDGQISKTELHLILTRLGE-RCSVNDCSEMIRSVDSDGDGFVSFDEFRKMM  157



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L+ +G+  P  E  R+M SE+D DGDG I L EF          S + EL++AFD +D
Sbjct  38   AILNGLGSATPGDEVARIM-SELDTDGDGFIDLNEFKAFHCGGGEDS-NKELKEAFDLYD  95

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +GKISA EL +V +++G+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  96   KDKNGKISASELHSVLRSLGE-KCSLKDCRRMISSVDVDGDGCVNFEEFKKMM  147



>gb|AFK34900.1| unknown [Lotus japonicus]
Length=196

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  421
             +  ++EEL  M+ EVD DGDG ISLEEF  L++    P      LRDAF  FD D +G 
Sbjct  80   GQSATKEELDNMIREVDSDGDGYISLEEFIELNTKDIDPNEILENLRDAFSVFDIDGNGS  139

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL NV  ++GD  C+LE+C++MI GVD++GDG + FE+F  MM
Sbjct  140  ITAEELHNVMASLGD-ECSLEECQKMIGGVDSDGDGMIDFEEFRTMM  185


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            EL   F+ FD + DGKIS+ EL ++  ++G S  T E+   MI  VD++GDG++  E+F 
Sbjct  51   ELEKVFEKFDVNRDGKISSSELGSIMGSLGQS-ATKEELDNMIREVDSDGDGYISLEEFI  109

Query  288  RM  283
             +
Sbjct  110  EL  111



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFD  439
            +LS +G++    EEL+ M+ E+D++GDG I L+EF+           DS ELRDAFD +D
Sbjct  28   MLSALGSKTTD-EELKRMIEELDQNGDGFIDLKEFADFHCNGGAGKDDSKELRDAFDLYD  86

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G ISA+EL +V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  87   VDKNGLISAKELHHVLRNLGE-KCSLSDCRRMISNVDGDGDGNVNFEEFKKMM  138



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDF  445
            ++LL  +G+E  S EE++ M+ E+D+DGDG + L EFS   +     +  + EL +AF  
Sbjct  28   KSLLQALGSET-STEEVKKMMEEMDKDGDGFVDLLEFSEFHAGSGGNAGSTKELEEAFRL  86

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +GKISA EL++V K++G+ +C+L+DC++MI  VD +GDG V FE+F +MM
Sbjct  87   YDKDGNGKISARELYDVLKSLGE-KCSLKDCKKMISSVDADGDGHVDFEEFKKMM  140



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
             +P + EEL+ M+ EVD DGDG I L+EF  L++       DS+     L+DAF  +D D
Sbjct  66   GQPATEEELQNMIKEVDADGDGYIDLDEFIELNT----KGVDSDEVLENLKDAFSVYDID  121

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             +G I+AEEL  V K++GD  C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  122  GNGSITAEELHEVLKSLGDD-CSLADCRKMITGVDKNGDGMISFDEFKVMM  171



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFF  442
             +L+ +G +    E  R+M+ EVD DGDG I L+EF+       +P + + +LRDAF+ +
Sbjct  43   GILNALGTKTTPDEAKRMMI-EVDTDGDGFIDLKEFAAFHCPVESPNTVNKDLRDAFNLY  101

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +GKISA EL +V K IG+ +C+L+DCRRMI  VD++ DG V FE+F +MM
Sbjct  102  DKDKNGKISAAELHSVMKGIGE-KCSLKDCRRMISSVDDDCDGSVNFEEFKKMM  154


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            E++  F  FDT+ DGKIS  EL  +   +G ++ T ++ +RM++ VD +GDGF+  ++F 
Sbjct  20   EVKKVFKKFDTNGDGKISLSELGGILNALG-TKTTPDEAKRMMIEVDTDGDGFIDLKEFA  78



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++  +G  P + +ELR M+ EVD DGDG I + EF  L++           LRDAF  +
Sbjct  60   AIMGSLG-HPATEDELRSMILEVDADGDGFIDINEFVELNTKGIDSAEALQNLRDAFSVY  118

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEELF V K++GD  C+L +CR+MI GVD +GDG + FE+F  MM
Sbjct  119  DKDGNGSISAEELFEVLKSLGD-ECSLAECRKMIGGVDADGDGMINFEEFKVMM  171


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -1

Query  501  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  322
            S +FA  +  +EL   F+ FD + DGKIS+ EL  +  ++G    T ++ R MIL VD +
Sbjct  26   SPSFATRAQIAELEQVFNKFDVNGDGKISSSELGAIMGSLGHP-ATEDELRSMILEVDAD  84

Query  321  GDGFVCFEDFCRM  283
            GDGF+   +F  +
Sbjct  85   GDGFIDINEFVEL  97



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++S +G +P S EEL  M+SEVD DGDG I+ +EF  L++    P      L+DAF  +
Sbjct  146  AIMSSLG-QPASDEELNGMISEVDSDGDGFINFKEFVELNTKGIDPDEALENLKDAFSVY  204

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G IS EEL+ V +++GD  C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  205  DIDGNGSISVEELYKVLRSLGD-ECSMDECRKMIGGVDSDGDGMINFEEFKVMM  257



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EEL+ M+ EVD DGDG I L+EF  L++           L+DAF  +D D +G 
Sbjct  48   GQPATEEELQNMIKEVDADGDGYIDLDEFIELNTKGVDSDEVLENLKDAFSVYDIDGNGS  107

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL  V K++GD  C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  108  ITAEELHEVLKSLGDD-CSLADCRKMITGVDKNGDGMISFDEFKVMM  153



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS-CDSELRDAFDFFDTDHDGK  421
             +P + EEL  M+ EVD DGDG I L+EF  L++     +     L+DAF  +D D +G 
Sbjct  66   GQPATEEELHNMIKEVDADGDGYIDLDEFIELNTKGVDSNEVLENLKDAFSVYDIDGNGS  125

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+AEEL  V K++GD  C+L DCR+MI GVD NGDG + F++F  MM
Sbjct  126  ITAEELHEVLKSLGDD-CSLADCRKMITGVDKNGDGMISFDEFKVMM  171



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCD--SELRDAFDF  445
            A+L+ +G+     E  R+ML EVD DGDG I L+EF+         + D   ELR+AFD 
Sbjct  43   AILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFAAFHCPGGETNGDDSKELREAFDL  101

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  102  YDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISSVDVDGDGCVNFEEFKKMM  155



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +L  +G+   ++EEL+ ++ E+D++GDG I L+EF+      A      ELRDAFD +D 
Sbjct  28   MLGTLGS-KTTKEELKRIMEELDQNGDGYIDLKEFADFHCNDAGNDESKELRDAFDLYDV  86

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA+EL +V   +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  87   DKNGLISAKELHDVLSKLGE-KCSLSDCRRMISNVDADGDGSVNFEEFKKMM  137


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  474  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  295
            D E+R  F+ FD + DGKIS  EL ++  T+G S+ T E+ +R++  +D NGDG++  ++
Sbjct  2    DDEVRQIFNKFDKNGDGKISITELRDMLGTLG-SKTTKEELKRIMEELDQNGDGYIDLKE  60

Query  294  FC  289
            F 
Sbjct  61   FA  62



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFD  439
            +L+ +G++    EEL+ M+ E+D++GDG I L+EF+           DS ELRDAFD +D
Sbjct  28   MLAALGSKTTD-EELKRMMEELDQNGDGFIDLKEFADFHCNGGAGKDDSKELRDAFDLYD  86

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G ISA+EL +V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  87   VDKNGLISAKELHDVLRNLGE-KCSLSDCRRMISNVDADGDGNVNFEEFKKMM  138



>ref|XP_009411743.1| PREDICTED: probable calcium-binding protein CML36 [Musa acuminata 
subsp. malaccensis]
Length=202

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFD--  448
            EA+L ++G +P + EE   + +EV   GDGCI++EE   L +    P+      +  +  
Sbjct  82   EAVLRRLGPDPLTAEEAASVAAEVGLAGDGCITVEELEALGAKLQLPAAAEAEAELREAF  141

Query  447  -FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
              FD D DG+ISAEEL  VF T+GD  CTLEDCR MI GVD +GDGFVCF+DF RMM+
Sbjct  142  AVFDADGDGRISAEELLGVFVTLGDDGCTLEDCRCMIQGVDTDGDGFVCFDDFARMMD  199



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFF  442
            A++S +G +  S EEL  M+SEVD DGDG I+ +EF  L++     +   E L+DAF  +
Sbjct  74   AIMSSLG-QASSDEELNSMISEVDSDGDGFINFKEFVELNTKGVDSAEALENLKDAFSVY  132

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL+ V +++GD  C++++CR+MI GVD++GDG + FE+F  MM
Sbjct  133  DIDGNGSISAEELYEVLRSLGD-ECSIDECRKMIGGVDSDGDGMISFEEFKVMM  185



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A+L  +  +PPS EEL  M+ E D DGDG IS  EF  L++  AP + + +LR AF  FD
Sbjct  60   AVLEILSGQPPSEEELGRMMREADVDGDGFISFAEFVDLNT--APAALEEDLRLAFAVFD  117

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D  G ISA+EL ++   IG+   +L  CRRMI GVD +GDG V FE+F  MM
Sbjct  118  LDRSGSISADELAHILGGIGEG-ASLAQCRRMIDGVDRDGDGLVSFEEFKAMM  169



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = -1

Query  579  EELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEEL  403
            EE+R+M+ EVD DGDG I L EF  L++A          LR AFD FD D +G ISAEEL
Sbjct  70   EEIRIMIQEVDSDGDGFIDLREFIDLNTADVDNDEALENLRRAFDVFDIDRNGAISAEEL  129

Query  402  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
              V +++G+  CT+EDCR+MI GVD +G+G +CF++F  MM
Sbjct  130  RQVLRSLGEE-CTIEDCRKMISGVDADGNGTICFDEFQVMM  169


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = -1

Query  480  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  301
              + EL   F  FD + DGKIS EEL  +  ++G S  T E+ R MI  VD++GDGF+  
Sbjct  31   QAEEELEQVFKKFDANGDGKISGEELGKIIASLGHS-VTDEEIRIMIQEVDSDGDGFIDL  89

Query  300  EDFC  289
             +F 
Sbjct  90   REFI  93



>ref|XP_006662725.1| PREDICTED: probable calcium-binding protein CML36-like [Oryza 
brachyantha]
Length=184

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 6/102 (6%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S EEL  ML+  +   DG + LEE      A A P+ + EL++ F  FD D DG+ISAEE
Sbjct  84   SDEELAEMLAAAEEYEDGLV-LEEI-----ATAAPADEGELKETFAVFDADGDGRISAEE  137

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD+ C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  138  LRAVLASLGDALCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  179



>emb|CBX25281.1| hypothetical_protein [Oryza brachyantha]
Length=184

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 6/102 (6%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S EEL  ML+  +   DG + LEE      A A P+ + EL++ F  FD D DG+ISAEE
Sbjct  84   SDEELAEMLAAAEEYEDGLV-LEEI-----ATAAPADEGELKETFAVFDADGDGRISAEE  137

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD+ C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  138  LRAVLASLGDALCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  179



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCD--SELRDAFDF  445
            A+L+ +G+     E  R+ML EVD DGDG I L+EF+           D   ELR+AFD 
Sbjct  43   AILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFAAFHCPGGGTDGDDSKELREAFDL  101

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD +GDG V FE+F +MM
Sbjct  102  YDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISSVDVDGDGCVNFEEFKKMM  155



>emb|CBX25368.1| hypothetical_protein [Oryza brachyantha]
Length=127

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S EEL  ML+  + +G   + LEE      A A P+ + EL++ F  FD D DG+ISAEE
Sbjct  28   SDEELAEMLAAAEDEGG--LVLEEI-----AAAAPADEGELKETFAVFDADGDGRISAEE  80

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD+ C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  81   LRAVLASLGDALCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  122



>ref|XP_002962635.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
 gb|EFJ36098.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
Length=140

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -1

Query  591  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  412
            PP+ EEL  M+ EVD DGDG ISL+EF  L       +  +EL+ AF  FD D +G ISA
Sbjct  36   PPTEEELHKMVEEVDADGDGFISLDEF--LHFHAQSTASVAELKAAFYVFDLDRNGFISA  93

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +EL  V   +G+   T+EDC RMI GVD+NGDG V FE+F  MM
Sbjct  94   DELHRVLVGLGEVNLTMEDCGRMIRGVDSNGDGRVDFEEFKLMM  137



>gb|KCW69357.1| hypothetical protein EUGRSUZ_F02840 [Eucalyptus grandis]
Length=171

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  582  REELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISA  412
            REE +  ++E+D+DGDG I L+EF+  +L      P C + ELRDAFD +D D +G IS 
Sbjct  60   REEAQAAMAEIDKDGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISV  119

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             EL  V K +G  +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  120  SELHAVMKKLG-QKCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  162



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +++++G  P    EL +M+ E D DGDG I+L EF  ++ A      +++LR+AF  FD 
Sbjct  62   MMAKLGRPPADDHELEMMMKEADADGDGFINLAEFKDINRA-GEGVQEADLREAFAVFDE  120

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DHDGKISA EL  V K +G+   T + CR+MI GVD +GDG V F++F  MM
Sbjct  121  DHDGKISASELRGVLKGLGEEVTTAQ-CRKMIRGVDRDGDGMVSFQEFKVMM  171



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDA  454
            A++  +G +P   EELR M+ EVD DGDG I L+EF  L++       DS+     L+DA
Sbjct  67   AIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLKEFIELNTK----GVDSDEVLENLKDA  121

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F  +D D +G ISAEEL+ V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  122  FSVYDIDKNGSISAEELYEVLRSLGD-ECSIAECRKMISGVDCDGDGTISFEEFKVMM  178



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -1

Query  612  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  433
            ++++G  P +  EL +M+ E D DGDG ISL EF  ++ A      + +L++AF  FD D
Sbjct  55   MAKLGHHPANDHELEMMMKEADADGDGFISLAEFKDINGA-GEGVEEVDLKEAFAVFDED  113

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             DGKISA+EL NV K +G+ + T E C+ MI GVD +GDG V F++F  MM
Sbjct  114  RDGKISAKELQNVLKGLGE-QVTTEQCQEMIRGVDRDGDGMVSFQEFKVMM  163



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFF  442
            ++L  VG +P + EELR+M+ EVD DGDG I L+EF  L++           L+DAF  F
Sbjct  71   SILGSVG-QPATEEELRIMIQEVDADGDGFIDLQEFIALNTTDVGHEEVMENLKDAFKVF  129

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G I+AEEL +V +++G+  CTL +C +MI GVD++G G + F++F  MM
Sbjct  130  DIDKNGYITAEELQDVLQSLGE-ECTLAECEKMISGVDSDGSGTINFDEFKVMM  182


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = -1

Query  501  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  322
            SS       + EL   F  FD + DGKISA EL ++  ++G    T E+ R MI  VD +
Sbjct  37   SSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVGQP-ATEEELRIMIQEVDAD  95

Query  321  GDGFVCFEDFCRM  283
            GDGF+  ++F  +
Sbjct  96   GDGFIDLQEFIAL  108



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCD------SELR  460
            +++LS +G+ PPS +E+  ++S +D+DG+G + L+EF          + D       EL+
Sbjct  32   KSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDLDEFIAFHGTNINGNGDDSQCGNKELK  90

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DAFD +D D +G ISA EL  V K +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  91   DAFDMYDLDKNGLISANELHAVLKRLGE-KCSLSDCRRMISQVDKDGDGNVNFEEFKKMM  149



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 11/113 (10%)
 Frame = -1

Query  612  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  433
            L  VGA   + EE R+M+ E+DRDGDG + L+EF V     A  S D +L DAF  FD +
Sbjct  34   LGHVGA-AAADEEARVMVKEIDRDGDGRVDLDEFLV-----AVLSGDDDLMDAFLIFDAN  87

Query  432  HDGKISAEELFNVFKTIGDSRC--TLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             DG ISA+EL  V + +   RC  ++EDCRRMI GVD +GDGFV FE+F  MM
Sbjct  88   KDGLISAKELQRVLQGV---RCEASIEDCRRMIRGVDTDGDGFVNFEEFRSMM  137



>ref|XP_002274476.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
 emb|CAN68471.1| hypothetical protein VITISV_028194 [Vitis vinifera]
Length=150

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -1

Query  606  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  427
            Q      S +EL  ++SE+D DGDG I L+EF+    A       +ELRDAFD +D D +
Sbjct  40   QALGSTTSPDELTRIMSEIDTDGDGFIDLKEFADFHRATDSNGGLTELRDAFDMYDRDKN  99

Query  426  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            G ISA EL  VFK++G+ + TL+DC RMI  VD +GDG V FE+F +MM
Sbjct  100  GLISASELHAVFKSLGE-KVTLKDCSRMISSVDADGDGCVNFEEFKKMM  147



>ref|XP_002980456.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
 gb|EFJ18716.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
Length=140

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -1

Query  591  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  412
            PP+ EEL  M+ EVD DGDG ISL+EF  L       +  +EL+ AF  FD D +G ISA
Sbjct  36   PPTEEELLKMVEEVDADGDGFISLDEF--LHFHAQSTASVAELKAAFYVFDLDRNGFISA  93

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +EL  V   +G+   T+EDC RMI GVD+NGDG V FE+F  MM
Sbjct  94   DELHRVLVGLGEVNLTMEDCGRMIRGVDSNGDGRVDFEEFKLMM  137



>ref|XP_006663807.1| PREDICTED: probable calcium-binding protein CML36-like [Oryza 
brachyantha]
Length=181

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S EEL  ML+  + +G   + LEE      A A P+ + EL++ F  FD D DG+ISAEE
Sbjct  82   SDEELAEMLAAAEDEGG--LVLEEI-----AAAAPADEGELKETFAVFDADGDGRISAEE  134

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD+ C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  135  LRAVLASLGDALCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  176



>dbj|BAJ92507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  474  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  295
            + ELRD F  FD D DG+ISAEEL  V  T+GD RC++EDCRRMI GVD++GDGFVCF++
Sbjct  115  EGELRDTFAVFDADGDGRISAEELRAVLATLGDERCSVEDCRRMIGGVDSDGDGFVCFDE  174

Query  294  FCRMM  280
            F RMM
Sbjct  175  FTRMM  179



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EE++ M+ EVD +GDG I+L EF  L++    P      L+DAF  FD D +G 
Sbjct  37   GQPATEEEVKRMIQEVDANGDGHINLGEFLELNTKGVDPDEVLENLKDAFSIFDVDGNGL  96

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+A+EL  V  ++GD+ C++++C++MI GVD NGDG + FE+F  MM
Sbjct  97   ITAQELNMVMASLGDA-CSIDECQKMIAGVDGNGDGMINFEEFQLMM  142



>ref|XP_006646679.1| PREDICTED: probable calcium-binding protein CML10-like, partial 
[Oryza brachyantha]
Length=128

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFA--PPSCDSELRDAFDF  445
            AL   +G    + +EL  M++E D DGDG ISL+EF+ L++       + + +LR AF  
Sbjct  6    ALFESLG-HAATDDELARMMAEADADGDGFISLDEFAALNATANGDAAAVEEDLRHAFRV  64

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            FD D +G ISA EL  V   +G+ + T++ CRRMI GVD NGDG + FE+F  MM
Sbjct  65   FDADGNGTISAAELARVLHGLGE-KATVQQCRRMIEGVDQNGDGLISFEEFKVMM  118



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFF  442
            A+++ +G E P  EEL+  ++E+D+ GDG I+LEEF  + +           L+DAF  +
Sbjct  57   AIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFVELFTKGMDQNDVLENLKDAFSVY  115

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  116  DIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGVDKDGDGTIDFEEFKVMM  168



>emb|CDP16307.1| unnamed protein product [Coffea canephora]
Length=189

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 2/105 (2%)
 Frame = -1

Query  591  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKIS  415
            P + EEL  +++E D DGDG I L+EF  L++           L+DAF  FD D +G IS
Sbjct  73   PTTDEELHKLMNEADSDGDGFIDLQEFIELNTKDIDSDEVMENLKDAFSVFDIDKNGSIS  132

Query  414  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            A+EL NV K++G+  C+L +CR+MI GVD +GDG +CFE+F  MM
Sbjct  133  ADELQNVLKSLGE-ECSLAECRKMICGVDADGDGMICFEEFKVMM  176



>gb|AAM67124.1| calmodulin-related protein [Arabidopsis thaliana]
Length=157

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = -1

Query  603  VGAEPP--SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRD---AFDFFD  439
            +GA  P  S+EE + M+ E D DG+G I L+EF  L       S +S +RD   AFD +D
Sbjct  40   IGALSPNASQEETKAMMKEFDLDGNGFIDLDEFVALFQISDQSSNNSAIRDLKEAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G+ISA EL +V K +G+ +C+++DC+RMI  VD++GDG V FE+F +MM
Sbjct  100  LDRNGRISANELHSVMKNLGE-KCSIQDCQRMISKVDSDGDGCVDFEEFKKMM  151



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFF  442
            +++S +G  P + EEL  M+ EVD DGDG I  +EF  L++    P+   E LRDAF  +
Sbjct  66   SIMSSLG-HPETEEELAKMVREVDSDGDGFIDFDEFVELNTKGVDPAEAMENLRDAFSVY  124

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D DG I+AEEL  V +++G+   +L +CR+MI GVD++GDG + FE+F  MM
Sbjct  125  DIDGDGSITAEELHKVMRSLGEEN-SLAECRKMIGGVDSDGDGMISFEEFKVMM  177



>ref|XP_009414956.1| PREDICTED: probable calcium-binding protein CML15 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +L  +G + PS EEL  M+ E D DGDG ISL EF  L+++  P + + +LR AF  FD 
Sbjct  54   VLESLGGQRPSEEELGRMMREADADGDGFISLAEFVELNTS-PPAAVEEDLRLAFAVFDL  112

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D  G ISA+E+  V + IG+   ++  CRRMI GVD +GDG + FE+F  MM
Sbjct  113  DRSGAISADEIARVLRGIGEG-ASVAQCRRMIDGVDLDGDGLISFEEFKAMM  163


 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -1

Query  501  SSAFAPPSCD-SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDN  325
            S A  P + D   L   F+ FD++ DGKIS+ EL +V +++G  R + E+  RM+   D 
Sbjct  18   SHAAIPSAADPGNLERVFNKFDSNGDGKISSAELADVLESLGGQRPSEEELGRMMREADA  77

Query  324  NGDGFVCFEDFCRM  283
            +GDGF+   +F  +
Sbjct  78   DGDGFISLAEFVEL  91



>ref|NP_564874.1| calmodulin like 23 [Arabidopsis thaliana]
 sp|Q9C8Y1.1|CML23_ARATH RecName: Full=Probable calcium-binding protein CML23; AltName: 
Full=Calmodulin-like protein 23 [Arabidopsis thaliana]
 gb|AAG52166.1|AC020665_11 calmodulin-related protein; 72976-72503 [Arabidopsis thaliana]
 gb|AAL36209.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AAM51400.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AEE34504.1| calmodulin like 23 [Arabidopsis thaliana]
Length=157

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = -1

Query  603  VGAEPP--SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRD---AFDFFD  439
            +GA  P  S+EE + M+ E D DG+G I L+EF  L       S +S +RD   AFD +D
Sbjct  40   IGALSPNASQEETKAMMKEFDLDGNGFIDLDEFVALFQISDQSSNNSAIRDLKEAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G+ISA EL +V K +G+ +C+++DC+RMI  VD++GDG V FE+F +MM
Sbjct  100  LDRNGRISANELHSVMKNLGE-KCSIQDCQRMINKVDSDGDGCVDFEEFKKMM  151



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 11/113 (10%)
 Frame = -1

Query  612  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  433
            L  VGA   + EE R+M+ E+DRDGDG + L+EF V     A  S D +L DAF  FD +
Sbjct  94   LGHVGA-AAADEEARVMVKEIDRDGDGRVDLDEFLV-----AVLSGDDDLMDAFLIFDAN  147

Query  432  HDGKISAEELFNVFKTIGDSRC--TLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             DG ISA+EL  V + +   RC  ++EDCRRMI GVD +GDGFV FE+F  MM
Sbjct  148  KDGLISAKELQRVLQGV---RCEASIEDCRRMIRGVDTDGDGFVNFEEFRSMM  197



>ref|XP_006574101.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=195

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGK  421
             +P + EE++ M+ EVD +GDG I+L EF  L++    P      L+DAF  FD D +G 
Sbjct  80   GQPATEEEVKRMIQEVDANGDGHINLGEFLELNTKGVDPDEVLENLKDAFSIFDVDGNGL  139

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            I+A+EL  V  ++GD+ C++++C++MI GVD NGDG + FE+F  MM
Sbjct  140  ITAQELNMVMASLGDA-CSIDECQKMIAGVDGNGDGMINFEEFQLMM  185



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            AL  Q   E P+ EE++ M++E D DGDG +  EEF ++ S+    +   E++DAF  FD
Sbjct  34   ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFEEFLIVMSSKMKENVVEEIKDAFKVFD  93

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D DG ISA EL NV   +G+ R T E+  +MI  VD +GDG V ++DF +MM
Sbjct  94   RDQDGFISAIELRNVMINMGE-RLTEEEAEQMINEVDLDGDGLVSYDDFVKMM  145



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVL-SSAFAPPSCDSELRDAFDFF  442
            A++S +G +P + EEL  M+ EVD DGDG I  +EF  L ++          L+DAF  +
Sbjct  63   AIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEFVELNTNGVDQAEALENLKDAFSVY  121

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL+ V +++GD  C++ +C++MI  VD++GDG + FE+F  MM
Sbjct  122  DIDGNGSISAEELYKVLRSLGD-ECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  471  SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
            +EL   F  FD + DGKIS+ EL  +  ++G      E+   MIL VD++GDGF+ F++F
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLGQP-ANEEELSHMILEVDSDGDGFIDFKEF  97

Query  291  CRM  283
              +
Sbjct  98   VEL  100



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFF  442
            ++++ +G    + EEL  M+ E D DGDG I+L EF  L++    P      LR+AF  +
Sbjct  65   SIMTSLG-HNATEEELGKMIEEFDADGDGFINLHEFVELNTKEIDPEELLENLREAFSVY  123

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  124  DIDGNGSISAEELHKVLRSLGDD-CSVADCRQMISGVDSNGDGMISFEEFKVMM  176



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +L  +G+E  S EE++ M+ E+D++GDG I L+EF+            SELRDAFD +D 
Sbjct  28   MLLTLGSETTS-EEVKRMMEELDQNGDGFIDLKEFADFHCTEPGKDESSELRDAFDLYDL  86

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA EL  V   +G+ +C+L DC++MI  VD +GDG V FE+F +MM
Sbjct  87   DKNGLISANELHAVLMKLGE-KCSLNDCKKMISNVDVDGDGNVNFEEFKKMM  137


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  474  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  295
            D E+R  F  FD + DGKIS  EL  +  T+G S  T E+ +RM+  +D NGDGF+  ++
Sbjct  2    DDEVRKIFSKFDKNGDGKISRSELKEMLLTLG-SETTSEEVKRMMEELDQNGDGFIDLKE  60

Query  294  FC  289
            F 
Sbjct  61   FA  62



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            L++ +G++  + EE+R M++E+DR+GDG I L+EF              ELR+AF+ +D 
Sbjct  28   LMAALGSKTTT-EEVRRMMAELDRNGDGYIDLKEFGEFHCGGGGGD-GKELREAFELYDL  85

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA+EL +V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  86   DKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVDADGDGNVNFEEFKKMM  136



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF-----APPSC-DSELR  460
            +++L+ +G+ P S E  R+M SE+D+DG+G + L+EF                C + EL+
Sbjct  32   KSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDLDEFVAFQQTNINDDDGEAQCGNKELK  90

Query  459  DAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            DAFD +D D +G ISA EL  V K +G+ +C+L DCRRMI  VD +GDG V F++F +MM
Sbjct  91   DAFDMYDLDKNGLISANELHAVLKRLGE-KCSLSDCRRMISQVDKDGDGNVNFDEFKKMM  149



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            ++  +G+E  S EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D 
Sbjct  42   VMRALGSEV-SDEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EEELRDAFAMYDL  98

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DG+ISA+EL  V K +G+ +C++ DC RMI  VD++GDG V FE+F  MM
Sbjct  99   DRDGQISAKELHLVLKQLGE-KCSVHDCSRMIRSVDSDGDGSVNFEEFKMMM  149



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
             +   +G+E  S EE++ +++E D+DGDG I +EEF+ + +  +      ELRDAFD +D
Sbjct  44   GVFGDLGSETASLEEVQRIMAEFDKDGDGHIDIEEFAEIINGGSTK----ELRDAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS  EL  V K +G  +C+L+DC +MI  VD +GDG V F +F +MM
Sbjct  100  LDKNGLISTSELHEVLKRLG-QKCSLKDCAKMISSVDVDGDGHVNFAEFKKMM  151


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            EL+  FD FD + DG+IS +EL  VF  +G    +LE+ +R++   D +GDG +  E+F 
Sbjct  21   ELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDGDGHIDIEEFA  80

Query  288  RMM  280
             ++
Sbjct  81   EII  83



>ref|XP_009413607.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+L  +G++P S +E+R M++E+D D DG + L+EF+            ++EL+DAF  +
Sbjct  49   AVLRALGSDP-SPDEIRDMIAEMDADRDGFVDLQEFAAFHRCGVGRGGAEAELKDAFRMY  107

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D DG IS +EL  V +++G+ +CTLEDC RMI  VD++GDG V FE+F  MM
Sbjct  108  DLDSDGLISVDELLRVMRSLGE-KCTLEDCARMIRSVDSDGDGSVSFEEFKTMM  160



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDA  454
            +++  +G +P S EE++ M+ E D DGDG I+ EEF  L++       DS+     L+DA
Sbjct  73   SIMGSLGQQP-SDEEVQKMIKEFDADGDGFINFEEFVELNTK----GVDSKEVLENLKDA  127

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F  +D D +G ISAEEL  V K++GD  C++ +CR+MI GVDN+G+G + FE+F  MM
Sbjct  128  FSVYDLDGNGSISAEELHKVLKSLGDD-CSITECRKMISGVDNDGNGMIDFEEFKVMM  184



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  EEL+  ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  73   AIMANLGHEVPE-EELQKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  131

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  132  DIDGNGSISAEELHEVLRSLGDD-CSIAECRKMIGGVDKDGDGTIDFEEFKVMM  184



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP--SCDSELRDAFDF  445
             +L+ +G+   S +E+  M+ E+D D DG I+L+EF+   S  + P  S + ELR+AF  
Sbjct  43   GVLNALGS-GTSADEVARMMEEIDTDKDGHINLQEFAAFCSGDSDPYNSAEKELREAFQL  101

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D DH+GKISA EL  +   +G+  C+ +DC  MI  VD++GDGFV F++F +MM
Sbjct  102  YDQDHNGKISAAELHQILTRLGE-HCSEQDCAGMIRTVDSDGDGFVSFDEFRKMM  155



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAF  451
            +L  +G++  S EE+  M+SE+D DGDG I L+EF+    +    +  +E     L+DAF
Sbjct  42   VLGALGSDT-SPEEIHRMMSEIDTDGDGFIDLKEFAEFHKSNGTGNTKAEDELKELKDAF  100

Query  450  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            + +D D +G ISA+EL+ V K +G+ +C+L+DC RMI  VD +GDG V FE+F  MM
Sbjct  101  NLYDKDKNGLISAKELYTVLKRLGE-KCSLQDCSRMINSVDVDGDGHVNFEEFKLMM  156



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 9/111 (8%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
              P + EEL+ M+  VD DG+G I L EF  L++       DSE     LR AF  FDTD
Sbjct  73   GNPVTEEELQKMVKVVDLDGNGFIDLNEFIDLNTN----GVDSEKAVEDLRHAFMIFDTD  128

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             +G IS EEL  VF+++GD +C++ DC++MI GVD +GDG + FE+F  MM
Sbjct  129  GNGSISPEELQAVFRSLGDDKCSIADCKKMIRGVDCDGDGLISFEEFKNMM  179



>ref|XP_004159084.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=185

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -1

Query  588  PSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISA  412
             + EEL  M+ E D DGDG I+L EF  L++    P      LR+AF  +D D +G ISA
Sbjct  74   ATEEELGKMIDEFDADGDGFINLHEFVELNTKEIDPEELLENLREAFSVYDIDGNGSISA  133

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            EEL  V +++GD  C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  134  EELHKVLQSLGDD-CSVADCRQMISGVDSNGDGMISFEEFKVMM  176



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFF  442
            ++++ +G E P  EEL+  ++E+D+ GDG I+LEEF  + +           L+DAF  +
Sbjct  57   SIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFVELFTKGMDQNDVLENLKDAFSVY  115

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  116  DIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGVDKDGDGTIDFEEFKVMM  168



>gb|KCW58109.1| hypothetical protein EUGRSUZ_H00832, partial [Eucalyptus grandis]
Length=155

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDF  445
            +L  +G+ P +REE R  +SE+D+DGDG I+L+EF+  +L  +   P C + ELRDAFD 
Sbjct  38   VLYVLGSSPTTREEARAAMSEIDKDGDGFINLDEFAELILGGSDRGPECRAKELRDAFDL  97

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +G I A EL  V K +G  +C    CR+MI  VD +GD  V F++F +MM
Sbjct  98   YDLDGNGVILASELPAVLKKLG-QKCNRRYCRKMISLVDRDGDSNVNFKEFKKMM  151



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -1

Query  588  PSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISA  412
             + EEL  M+ E D DGDG I+L EF  L++    P      LR+AF  +D D +G ISA
Sbjct  74   ATEEELGKMIDEFDADGDGFINLHEFVELNTKEIDPEELLENLREAFSVYDIDGNGSISA  133

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            EEL  V +++GD  C++ DCR+MI GVD+NGDG + FE+F  MM
Sbjct  134  EELHKVLQSLGDD-CSVADCRQMISGVDSNGDGMISFEEFKVMM  176



>ref|XP_004145834.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 ref|XP_004160107.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 gb|KGN57816.1| hypothetical protein Csa_3G319280 [Cucumis sativus]
Length=156

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S +E+  ++SE+D+DGDG I L+EF+  +S+      + +L+DAFD +D D +G ISA+E
Sbjct  55   STDEIHRIMSEIDKDGDGFIDLDEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKE  112

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L +V K +G+ +C+L+DC RMI  VD +GDG V FE+F +MM
Sbjct  113  LHSVLKRLGE-KCSLKDCCRMISSVDVDGDGHVNFEEFKKMM  153



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            ++  +G+E  S EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D 
Sbjct  42   VMRALGSEV-SDEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EGELRDAFAMYDL  98

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DG+ISA+EL  V K +G+ +C++ DC RMI  VD++GDG V FE+F  MM
Sbjct  99   DRDGQISAKELHLVLKRLGE-KCSVHDCSRMIRSVDSDGDGSVNFEEFKMMM  149



>ref|XP_004971250.1| PREDICTED: probable calcium-binding protein CML10-like [Setaria 
italica]
Length=235

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFA--PPSCDSELRDAFDF  445
            AL   +G    S +EL  M++E D DGDG ISL+EF+ L++  A    + + +LR AF  
Sbjct  113  ALFESLG-HAASDDELARMMAEADADGDGFISLDEFAALNATVAGDAAAVEEDLRHAFRV  171

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            FD D +G ISA EL  V + +G+S  ++  CRRMI GVD NGDG + FE+F  MM
Sbjct  172  FDADGNGTISATELARVLRGLGES-ASVAQCRRMIEGVDQNGDGLISFEEFKVMM  225



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  EEL   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  60   AIMTSLGHEVP-EEELEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  118

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  119  DIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  579  EELRLMLSEVDRDGDGCISLEEFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEE  406
            +EL  M++E D DGDG ISL+EF+ L++  +    + + +LR AF  FD D +G ISA E
Sbjct  75   DELARMMAEADADGDGFISLDEFAALNATASGDAAAVEEDLRHAFRVFDADGNGTISAAE  134

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V   +G+ + T++ CRRMI GVD NGDG + FE+F  MM
Sbjct  135  LARVLHGLGE-KATVQQCRRMIEGVDQNGDGLISFEEFKVMM  175



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +L  +G++  S EE++ ++ E+D DGDG I  +EFS    A        EL+DAFD +D 
Sbjct  41   VLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDFKEFSTFHLAGGSTDGTKELKDAFDLYDM  99

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA EL  V K +G+ + +L+DC  MI  VD +GDG V FE+F +MM
Sbjct  100  DQNGLISANELHAVLKKLGE-KSSLKDCVNMIKKVDADGDGHVNFEEFKKMM  150


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            E+R  F+ FD + DGKISA+EL +V +++G S+ + E+ +R++  +D +GDG++ F++F 
Sbjct  17   EVRKVFNKFDKNGDGKISADELKDVLRSLG-SKTSPEEVKRVMDEIDTDGDGYIDFKEFS  75



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFA--PPSCDSELRDAFDF  445
            AL   +G    S +E+  M++E D DGDG ISL+EF+ L++  A    + + +LR AF  
Sbjct  67   ALFESLG-HAASDDEVARMMAEADADGDGFISLDEFAALNATVAGDAAAVEEDLRHAFRV  125

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            FD D +G ISA EL  V + +G+S  ++  CRRMI GVD NGDG + FE+F  MM
Sbjct  126  FDADGNGTISAAELARVLRGLGES-ASVAQCRRMIEGVDQNGDGLISFEEFKVMM  179



>ref|XP_011467223.1| PREDICTED: calcium-binding protein CML24-like [Fragaria vesca 
subsp. vesca]
Length=148

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +  ++G+E    EE++ +++E D+DGDG I L+EF+ + +  +      +LRDAFD +D 
Sbjct  41   IFRELGSETTP-EEVKTIMAEFDKDGDGRIDLDEFAEILNGGSTK----DLRDAFDLYDL  95

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            D +G+ISA EL  V K +G  +C+L+DC +MI  VD +GDG V FE+F +MM+
Sbjct  96   DKNGRISASELHEVLKRLG-QKCSLKDCAKMIGSVDADGDGHVNFEEFKKMMK  147



>gb|ABA95773.1| EF hand family protein, expressed [Oryza sativa Japonica Group]
 gb|EAZ17394.1| hypothetical protein OsJ_32918 [Oryza sativa Japonica Group]
 emb|CBX24419.1| hypothetical_protein [Oryza glaberrima]
Length=195

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 69/102 (68%), Gaps = 8/102 (8%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S+EEL  ML+E D  G+  + LEE +  ++       + EL++ F  FD D DG+ISAEE
Sbjct  97   SKEELAAMLAEADYAGE--LVLEEIAAAAAD------EGELKETFAVFDADGDGRISAEE  148

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD  C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  149  LRAVLASLGDELCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  190



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFF  442
            A+   +G E  + EEL+ M+ EVD DGDG I L+EF  L++           L+DAF  F
Sbjct  51   AIFRSLGGEAMAEEELKSMIREVDSDGDGFIDLKEFVELNTKDIDYDETVENLKDAFQVF  110

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D DG IS EEL  V +++G+  CTL +C +MI GVD++G+G + FE+F  MM
Sbjct  111  DIDGDGSISCEELRQVLESLGE-ECTLGECAKMIAGVDSDGNGMISFEEFKVMM  163


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -1

Query  489  APPSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  328
            + PS +S      EL   F  FD + DGKIS  EL  +F+++G      E+ + MI  VD
Sbjct  15   STPSMNSRAQIEEELEQVFKKFDVNGDGKISGSELGAIFRSLGGEAMAEEELKSMIREVD  74

Query  327  NNGDGFVCFEDFCRM  283
            ++GDGF+  ++F  +
Sbjct  75   SDGDGFIDLKEFVEL  89



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  EEL   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  60   AIMASLGHEVP-EEELEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  118

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  119  DIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVL-SSAFAPPSCDSELRDAFDFF  442
            A++S +G +P + EEL  M+ EVD DGDG I  +EF  L ++          L+DAF  +
Sbjct  63   AIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEFVELNTNGVDQAEALENLKDAFSVY  121

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL+ V +++GD  C++ +C++MI  VD++GDG + FE+F  MM
Sbjct  122  DIDGNGLISAEELYKVLRSLGD-ECSIAECKKMISAVDSDGDGMINFEEFKVMM  174


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = -1

Query  501  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  322
            S +F   +  +EL   F  FD + DGKIS+ EL  +  ++G      E+   MIL VD++
Sbjct  29   SPSFNSRAQIAELDQVFKKFDVNGDGKISSSELGAIMSSLGQP-ANEEELSHMILEVDSD  87

Query  321  GDGFVCFEDFCRM  283
            GDGF+ F++F  +
Sbjct  88   GDGFIDFKEFVEL  100



>ref|XP_007045260.1| Polcalcin Jun o, putative [Theobroma cacao]
 gb|EOY01092.1| Polcalcin Jun o, putative [Theobroma cacao]
Length=199

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
               PS +EL+ M+ E D DGDG I+ +EF  L++       DS+     L+DAF  +D D
Sbjct  83   GHKPSEDELQKMIKEFDADGDGSINFKEFVELNT----KGVDSDEVLENLKDAFSVYDID  138

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             +G ISAEEL  V K++GD  C++ +CR+MI GVD++GDG + FE+F  MM
Sbjct  139  GNGSISAEELHEVLKSLGD-ECSIAECRKMISGVDSDGDGMIDFEEFKVMM  188



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++  +G E P  EEL   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  60   AIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  118

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  119  DIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++  +G E P  EEL   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  60   AIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  118

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  119  DIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGVDKDGDGTIDFEEFKIMM  171



>emb|CDM86427.1| unnamed protein product [Triticum aestivum]
Length=190

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            AL   +G    + +EL  M++E D DGDG ISLEEF+ L+ A A    + +LR AF  FD
Sbjct  72   ALFESLG-HAATEDELTRMMAEADADGDGFISLEEFAALN-ATAAGDDEEDLRLAFKVFD  129

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D  G ISA EL +V   +G+ + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  130  ADGSGDISAAELASVLHGLGE-KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  181



>ref|XP_008800225.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=189

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFF  442
            A + Q    PP+ EEL+ M+ E D DGDG ISL+EF  L+ +    S   E LR AF  F
Sbjct  64   AAIFQSLGHPPTEEELQRMMGEADADGDGFISLDEFVELNVSTVDDSTALEDLRHAFSVF  123

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G IS +EL  V ++IG+   ++  C+RMI GVD +GDG + FE+F  MM
Sbjct  124  DLDRNGSISPDELARVLRSIGEG-ASVAQCKRMIEGVDRDGDGLISFEEFKLMM  176



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 75/126 (60%), Gaps = 13/126 (10%)
 Frame = -1

Query  618  ALLSQVGAEPP-SREELRLMLSEVDRDGDGCISLEEFSVL------------SSAFAPPS  478
            A+LS +G +   + EE   ++ E+DR+GDGCI L+EF               S  F    
Sbjct  74   AVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDLDEFMNAVNVDRSRSNDNNSVGFGNEE  133

Query  477  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFE  298
             DSEL DAF  FDTD +GKISA+EL  V  ++G   C+L +CR+MI GVD NGDG V FE
Sbjct  134  EDSELMDAFRIFDTDKNGKISAKELQRVLFSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193

Query  297  DFCRMM  280
            +F  MM
Sbjct  194  EFRLMM  199



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 10/107 (9%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
             +P + +EL  M+ EVD DGDGCISL+EF  L++       DS+     L+DAF  FD D
Sbjct  67   GQPATEQELDNMIREVDGDGDGCISLQEFIELNTK----GVDSDEILENLKDAFAVFDMD  122

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
             +G I+AEEL  V +++G+  C+L +CRRMI GVD++GDG + FE+F
Sbjct  123  GNGSITAEELNTVMRSLGE-ECSLAECRRMIGGVDSDGDGMIDFEEF  168



>ref|XP_004517285.1| PREDICTED: probable calcium-binding protein CML27-like [Cicer 
arietinum]
Length=137

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = -1

Query  591  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  412
              S EE+  M++E+D++GDG I L+EFS L       +   ELR+AF+ +D D +G ISA
Sbjct  35   KTSEEEVNRMMAELDQNGDGYIDLKEFSELHKDGGDVT---ELREAFEMYDLDKNGLISA  91

Query  411  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +EL  V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  92   KELHAVMRRLGE-KCSLGDCRRMIGNVDADGDGNVNFEEFKKMM  134



>ref|XP_006301789.1| hypothetical protein CARUB_v10022253mg [Capsella rubella]
 gb|EOA34687.1| hypothetical protein CARUB_v10022253mg [Capsella rubella]
Length=153

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -1

Query  603  VGAEPP--SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  430
            +GA  P  S+EE + M+ E D DG+G I ++EF  L           +L++AFD +D D 
Sbjct  40   IGALSPNASQEETKAMMKEFDLDGNGYIDMDEFVALFQVKQDNDQIKDLKEAFDLYDLDR  99

Query  429  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +G+ISA EL +V K +G+ +C+++DC+RMI  VD++GDG V F++F +MM
Sbjct  100  NGRISANELHSVMKNLGE-KCSIQDCKRMISKVDSDGDGCVDFDEFKKMM  148



>ref|XP_002888497.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64756.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = -1

Query  603  VGAEPP--SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRD---AFDFFD  439
            +GA  P  ++EE + M+ E D DG+G I L+EF  L       S  +E+RD   AFD +D
Sbjct  40   IGALSPNATQEETKSMMKEFDLDGNGFIDLDEFVALFQINDQSSDSNEIRDLKEAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G+ISA EL +V K +G+ +C+++DC+RMI  VD++GDG V FE+F +MM
Sbjct  100  LDRNGRISANELHSVMKNLGE-KCSVQDCQRMISKVDSDGDGCVDFEEFKKMM  151



>ref|XP_010026030.1| PREDICTED: probable calcium-binding protein CML23 [Eucalyptus 
grandis]
Length=265

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDF  445
            +L  +G+ P +REE R  +SE+D+DGDG I+L+EF+  +L  +   P C + ELRDAFD 
Sbjct  143  VLYVLGSSPTTREEARAAMSEIDKDGDGFINLDEFAELILGGSDRGPECRAKELRDAFDL  202

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +G I A EL  V K +G  +C    CR+MI  VD +GD  V F++F +MM
Sbjct  203  YDLDGNGVILASELPAVLKKLG-QKCNRRYCRKMISLVDRDGDSNVNFKEFKKMM  256



>ref|XP_008457051.1| PREDICTED: probable calcium-binding protein CML27 [Cucumis melo]
Length=157

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S  E+  ++SE+D+DGDG I L+EF+  +S+      + +L+DAFD +D D +G ISA+E
Sbjct  56   STGEIHRIMSEIDKDGDGFIDLDEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKE  113

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L +V K +G+ +C+L+DC RMI  VD +GDG V FE+F +MM
Sbjct  114  LHSVLKRLGE-KCSLKDCCRMISSVDVDGDGHVNFEEFKKMM  154



>emb|CDM86445.1| unnamed protein product [Triticum aestivum]
Length=190

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 3/113 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            AL   +G    + +EL  M++E D DGDG ISLEEF+ L+ A A    + +LR AF  FD
Sbjct  72   ALFESLG-HAATEDELTRMMAEADADGDGFISLEEFAALN-ATAAGDDEEDLRLAFKVFD  129

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D  G ISA EL  V   +G+ + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  130  ADGSGDISAAELARVLHGLGE-KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  181



>ref|XP_003552973.1| PREDICTED: calcium-binding protein CML24-like isoform 1 [Glycine 
max]
Length=139

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +++ +G++  S +E++ M++E+DR+GDG I L+EF              ELR+AF+ +D 
Sbjct  29   MMAALGSKTTS-DEVKRMMAELDRNGDGYIDLKEFGEFHCGGGGDG--RELREAFELYDL  85

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA+EL +V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  86   DKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVDADGDGNVNFEEFKKMM  136



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFF  442
            ++++ +G  P + EEL  M+ EVD DGDG I L+EF  L++           L+DAF  F
Sbjct  69   SIMASLG-NPTTEEELVNMIREVDSDGDGFIDLQEFIELNTKDIDSNEVLESLKDAFSVF  127

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++G+  CTL +CR+MI GVD +GDG + FE+F  MM
Sbjct  128  DMDKNGSISAEELLTVLRSLGED-CTLAECRKMISGVDCDGDGMINFEEFKIMM  180



>ref|XP_010922191.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=193

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGK  421
              PP+ EEL +M+ E D +GDG ISLEEF  L++         E LR AF  FD D +G 
Sbjct  74   GHPPTDEELEIMMGEADFNGDGYISLEEFLDLNTNKVDAKAALEDLRHAFSVFDMDRNGS  133

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            IS +EL  V ++IG+   T+  C++MI GVD +GDGF+ FE+F  MM
Sbjct  134  ISVDELNKVLRSIGEG-ATMAQCKKMIDGVDQDGDGFISFEEFKDMM  179



>ref|XP_004490807.1| PREDICTED: calcium-binding protein CML24-like [Cicer arietinum]
Length=143

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +L  +G +  S +E++ M+  +D++GDG I L+EFS      A     +ELRDAFD +D 
Sbjct  32   MLITLGTKTTS-DEVKRMMEMIDQNGDGYIDLKEFSDFHCIDAGKDDANELRDAFDLYDL  90

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA EL  V   +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  91   DKNGLISANELHAVLIKLGE-KCSLGDCRRMIKNVDVDGDGNVNFEEFKKMM  141


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  480  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  301
            S D E+R  F  FD + DGKIS+ EL  +  T+G ++ T ++ +RM+  +D NGDG++  
Sbjct  4    SMDDEVRKIFSKFDKNGDGKISSSELKEMLITLG-TKTTSDEVKRMMEMIDQNGDGYIDL  62

Query  300  EDF  292
            ++F
Sbjct  63   KEF  65



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++  +G E P  EEL   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  57   AIMKSLGHEVP-EEELEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  115

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +C++MI GVD +GDG + FE+F  MM
Sbjct  116  DIDGNGSISAEELHEVLRSLGD-ECSIAECKKMIGGVDKDGDGTIDFEEFKIMM  168



>ref|XP_003538397.1| PREDICTED: probable calcium-binding protein CML27-like isoformX1 
[Glycine max]
 ref|XP_006591331.1| PREDICTED: probable calcium-binding protein CML27-like isoform 
X2 [Glycine max]
Length=137

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            ++  +G++  S EE++ M++E+DR+GDG I L+EF              ELR+AF+ +D 
Sbjct  28   MMVALGSKTTS-EEVKRMMAELDRNGDGYIDLKEFGEFHCGGGDGR---ELREAFELYDL  83

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA+EL +V + +G+ +C+L DCRRMI  VD +GDG V FE+F +MM
Sbjct  84   DKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVDADGDGNVNFEEFKKMM  134


 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = -1

Query  474  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  295
            D E+R  F  FD + DGKIS  EL  +   +G S+ T E+ +RM+  +D NGDG++  ++
Sbjct  2    DEEVRKIFSKFDKNGDGKISCAELKEMMVALG-SKTTSEEVKRMMAELDRNGDGYIDLKE  60

Query  294  F  292
            F
Sbjct  61   F  61



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
             +  ++G++  S EE+R +++E DRDGDG I + EF+ + +         ELRDAFD +D
Sbjct  51   GVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDILEFAEIMNG----GSSQELRDAFDLYD  106

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS  EL  V K +G  +C+L+DC +MI  VD +GDG V F++F +MM
Sbjct  107  LDKNGLISVSELHEVMKRLG-LKCSLQDCVKMIRNVDADGDGHVNFDEFKKMM  158



>gb|AFG44138.1| hypothetical protein 0_990_01, partial [Pinus taeda]
Length=119

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFD  439
            L++ +G  P S +ELRLM+S  D +GDG I   EF+ L++     P    +++ AF  FD
Sbjct  2    LMASLGC-PASDDELRLMVSVADSNGDGFIDFSEFAELNTFGVDDPRRLQDMKSAFGIFD  60

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS +EL  VF  +G+ RC+LEDCR MI  VD+NGDG+V F++F  MM
Sbjct  61   FDGNGLISPDELLRVFHRLGE-RCSLEDCRIMIASVDSNGDGYVSFDEFLIMM  112



>gb|KDP23917.1| hypothetical protein JCGZ_27077 [Jatropha curcas]
Length=158

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  576  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  397
            EL  ++ +VD D DG I+LEEF+ L  + +  S  SELRDAFD +D + +G IS+ EL+ 
Sbjct  46   ELDRVMDDVDTDKDGFINLEEFAQLCRSSSGGSAVSELRDAFDLYDQNKNGLISSSELYQ  105

Query  396  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  277
            V   +G S CT++DC +MI GVD++GDG V FE+F +MM+
Sbjct  106  VLTRLGMS-CTVDDCVQMIKGVDSDGDGCVSFEEFRKMMD  144



>gb|EEC67650.1| hypothetical protein OsI_35060 [Oryza sativa Indica Group]
Length=412

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 69/102 (68%), Gaps = 8/102 (8%)
 Frame = -1

Query  585  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  406
            S+EEL  ML+E D  G+  + LEE +  ++       + EL++ F  FD D DG+ISAEE
Sbjct  314  SKEELAAMLAEADYAGE--LVLEEIAAAAAD------EGELKETFAVFDADGDGRISAEE  365

Query  405  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            L  V  ++GD  C+++DCRRMI GVD +GDGFVCF++F RMM
Sbjct  366  LRAVLASLGDELCSVDDCRRMIGGVDTDGDGFVCFDEFARMM  407



>ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
Length=204

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 76/118 (64%), Gaps = 4/118 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAF---APPSCDSELRDA  454
            E LL     +  + EE   M+ EVD +GDG I L+EF  V+++ F   +  +CD  L DA
Sbjct  78   EVLLWLGQEKSTAVEEAEGMVREVDCNGDGFIDLDEFMRVMNTDFTVGSSSTCDDGLMDA  137

Query  453  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            F  FD+D +G ISAEEL  V  ++G  +C+L++C+RMI GVD +GDGFV FE+F  MM
Sbjct  138  FLIFDSDKNGVISAEELQRVLISLGCVKCSLQECKRMIKGVDKDGDGFVDFEEFRSMM  195


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  513  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT-LEDCRRMIL  337
            F +L+S+F      ++L+  F   DT+ DGKIS+ EL  V   +G  + T +E+   M+ 
Sbjct  40   FDLLTSSFTAMEVSNQLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVR  99

Query  336  GVDNNGDGFVCFEDFCRMM  280
             VD NGDGF+  ++F R+M
Sbjct  100  EVDCNGDGFIDLDEFMRVM  118



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
             +   +G+E  S EE++ +++E D+DGDG I + EF+ + +  +      ELRDAFD +D
Sbjct  44   GVFGDLGSETASLEEVQRIMAEFDKDGDGHIDIVEFAEIINGGSTK----ELRDAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS  EL  V K +G  +C+L+DC +MI  VD +GDG V F +F +MM
Sbjct  100  LDKNGLISTSELHEVLKRLG-QKCSLKDCAKMISSVDADGDGHVNFAEFKKMM  151


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = -1

Query  528  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  349
            +S  E     S         EL+  FD FD + DG+IS EEL  VF  +G    +LE+ +
Sbjct  1    MSKSELDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQ  60

Query  348  RMILGVDNNGDGFVCFEDFCRMM  280
            R++   D +GDG +   +F  ++
Sbjct  61   RIMAEFDKDGDGHIDIVEFAEII  83



>gb|KJB15360.1| hypothetical protein B456_002G172400 [Gossypium raimondii]
Length=197

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
             + PS EEL  M+ E D DGDG I+  EF  L++       DSE     L+DAF  +D D
Sbjct  75   GQQPSDEELHNMIKEFDADGDGFINFNEFIELNT----KGVDSEEVLENLKDAFSVYDID  130

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             +G ISAEEL  V K++G+  C++ +CR+MI GVDN+G+G + FE+F  MM
Sbjct  131  GNGWISAEELHEVLKSLGE-ECSIAECRKMISGVDNDGNGMIDFEEFKVMM  180



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A++  +G +  + +EL  ML EVD DGDG ISL+EF  L++           L++AF  F
Sbjct  35   AVMGSLG-QKATEQELINMLREVDGDGDGYISLQEFIELNTKGVDSDEVLENLKEAFSVF  93

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G I+AEEL  V +++G+  CTL +CRRMI GVD++GDG + FE+F  MM
Sbjct  94   DIDGNGSITAEELNTVMRSLGE-ECTLAECRRMISGVDSDGDGMIDFEEFRVMM  146



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
             +  ++G+E  S EE++ +++E D+DGDG I + EF+ + +  +      ELRDAFD +D
Sbjct  44   GIFGELGSETASLEEVQRIMAEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS  EL  V K +G  +C+L++C +MI  VD +GDG V F +F +MM
Sbjct  100  LDKNGLISKSELHEVLKRLG-QKCSLKECAKMIGSVDADGDGHVNFAEFKKMM  151



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
             +  ++G+E  S EE++ +++E D+DGDG I + EF+ + +  +      ELRDAFD +D
Sbjct  44   GIFGELGSETASLEEVQRIMAEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYD  99

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS  EL  V K +G  +C+L++C +MI  VD +GDG V F +F +MM
Sbjct  100  LDKNGLISKSELHEVLKRLG-QKCSLKECAKMIGSVDADGDGHVNFAEFKKMM  151



>ref|XP_010271280.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=205

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 1/103 (1%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP-SCDSELRDAFDFFDTDHDGK  421
              P + EEL+ M+ EVD DGDG I L EF  L++          +L++AF  FD D +G 
Sbjct  73   GHPATEEELQKMVEEVDSDGDGFIDLNEFIELNTKGVDSLKVIEDLKNAFMVFDIDRNGS  132

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
            IS EEL  V K++GD RC++ +C++MI GVD +GDG + FE+F
Sbjct  133  ISPEELQTVLKSLGDDRCSIAECKKMIRGVDCDGDGLINFEEF  175



>gb|EMS57533.1| putative calcium-binding protein CML36 [Triticum urartu]
Length=183

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  474  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  295
            + ELRD F  FD D DG+ISAEEL  V  ++GD RC++EDC RMI GVD +GDGFVCF +
Sbjct  115  EGELRDTFAVFDADGDGRISAEELRAVLASLGDERCSVEDCGRMIGGVDTDGDGFVCFNE  174

Query  294  FCRMM  280
            F RMM
Sbjct  175  FTRMM  179



>ref|XP_009782225.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana sylvestris]
Length=154

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVL-SSAFAPPSCDSELRDAFDFF  442
             +L  +G++  S +E+  M++E+D D DGCI+L+EF+    S  +      EL++AFD +
Sbjct  37   GVLKALGSDT-SPDEVERMMAEIDTDRDGCINLQEFADFCKSDDSVDGGAKELKEAFDLY  95

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DH+G ISA EL  +   +G   CT++DC RMI  VD +GDG V FE+F +MM
Sbjct  96   DQDHNGLISAAELHQILNRLG-QNCTIQDCTRMITSVDADGDGNVSFEEFKQMM  148



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = -1

Query  576  ELRLMLSEVDRDGDGCISLEEFSVLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELF  400
            EL LM+ E D DGDG ISLEEF  L++      +C  +L++AF  FD D +G ISA+EL+
Sbjct  87   ELGLMMKEADADGDGFISLEEFIDLNTKGNDKAACLEDLKNAFKIFDLDRNGSISADELY  146

Query  399  NVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
             V K +GD   + EDC+ MI GVD NGDG + FE+F
Sbjct  147  QVLKGMGDG-SSREDCQNMITGVDRNGDGLINFEEF  181



>ref|XP_009595960.1| PREDICTED: calcium-binding allergen Ole e 8-like [Nicotiana tomentosiformis]
Length=157

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVL-SSAFAPPSCDSELRDAFDFF  442
             +L  +G++  S +E+  M++E+D D DGCI+L+EF+    S  +      EL++AFD +
Sbjct  40   GVLKALGSDT-SPDEVERMMAEIDTDRDGCINLQEFADFCKSDDSVDGGAKELKEAFDLY  98

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D DH+G ISA EL  +   +G   CT++DC RMI  VD +GDG V FE+F +MM
Sbjct  99   DQDHNGLISAAELHQILNRLG-QNCTVQDCTRMITSVDADGDGNVSFEEFKQMM  151



>ref|XP_010033692.1| PREDICTED: probable calcium-binding protein CML27 [Eucalyptus 
grandis]
 gb|KCW84060.1| hypothetical protein EUGRSUZ_B00943 [Eucalyptus grandis]
Length=171

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            + L +   A PP  E+L   ++E+D DGDG ISL EF+ L  +   PS D++LRDAFD +
Sbjct  56   QVLAAMGSAVPP--EDLDRAMAEIDADGDGFISLPEFAGLCRS--GPSPDADLRDAFDLY  111

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISA EL  V   +    C++EDC RMI  VD +GDG V FE+F +MM
Sbjct  112  DQDRNGLISAAELHLVLNRLS-MNCSVEDCARMIKSVDGDGDGNVNFEEFRKMM  164


 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = -1

Query  486  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFV  307
            P   + ELR  FD FD + DGKISA EL  V   +G S    ED  R +  +D +GDGF+
Sbjct  27   PHMTNEELRKVFDQFDANGDGKISASELSQVLAAMG-SAVPPEDLDRAMAEIDADGDGFI  85

Query  306  CFEDFC  289
               +F 
Sbjct  86   SLPEFA  91



>ref|XP_008229213.1| PREDICTED: probable calcium-binding protein CML23 [Prunus mume]
Length=161

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +  ++G++  S EE+R +++E DRDGDG I + EF+ + +  +      ELRDAFD +D 
Sbjct  52   VFGELGSDTSSLEEVRSIMAEFDRDGDGHIDILEFAEIMNGGSS----QELRDAFDLYDL  107

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA EL  V K +G  +C+ +DC +MI  VD +GDG V F++F +MM
Sbjct  108  DKNGLISASELHEVMKRLG-LKCSHQDCVKMIRNVDADGDGHVNFDEFKKMM  158



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = -1

Query  576  ELRLMLSEVDRDGDGCISLEEFSVLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELF  400
            EL LM+ E D DGDG ISLEEF  L++      +C  +L++AF  FD D +G ISA+EL+
Sbjct  87   ELGLMMKEADADGDGFISLEEFIDLNTKGNDKAACLEDLKNAFKVFDLDRNGSISADELY  146

Query  399  NVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
             V K +GD   + EDC+ MI GVD NGDG + FE+F
Sbjct  147  QVLKGMGDG-SSREDCQNMITGVDRNGDGLINFEEF  181



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 74/126 (59%), Gaps = 13/126 (10%)
 Frame = -1

Query  618  ALLSQVGAEPP-SREELRLMLSEVDRDGDGCISLEEFSVL------------SSAFAPPS  478
            A+LS +G +   + EE   ++ E+DR+GDGCI L+EF               S  F    
Sbjct  74   AVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDLDEFMNAVNVDRSRSNDSDSVGFGNEE  133

Query  477  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFE  298
             D EL DAF  FDTD +GKISA+EL  V  ++G   C+L +CR+MI GVD NGDG V FE
Sbjct  134  EDCELMDAFRIFDTDKNGKISAKELQRVLVSLGCKECSLRECRQMIKGVDRNGDGAVDFE  193

Query  297  DFCRMM  280
            +F  MM
Sbjct  194  EFRLMM  199



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            +++S +G E  + EE+  M+ E D DGDG I  +EF  L++           L+DAFD +
Sbjct  68   SIMSSLGHEA-NEEEVMKMIKEFDADGDGFIDFKEFVELNTQGVGSDEVMENLKDAFDVY  126

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V  +IG+S C++ +CR+MI GVD++GDG + FE+F  MM
Sbjct  127  DIDGNGSISAEELHKVMGSIGES-CSIAECRKMISGVDSDGDGMIDFEEFKVMM  179



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP---PSCDSELRDAFDF  445
            +L  +G+   S +E++ +++E+D DGDG I  +EF    S  +     + + ELRDAFD 
Sbjct  35   VLGALGS-KTSDDEVKRVMAEIDADGDGYIDFDEFVKFHSGGSENDGAANEKELRDAFDL  93

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +G IS+ EL +V +++G+ +C+L DC RMI  VD +GDG V FE+F +MM
Sbjct  94   YDLDKNGVISSRELHSVLRSLGE-KCSLSDCSRMIRSVDADGDGSVNFEEFKKMM  147



>dbj|BAJ88405.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            AL   +G    + +EL  M++E D DGDG ISL EF+ L+ A A    + +LR AF  FD
Sbjct  73   ALFESLG-HAATDDELSRMMAEADADGDGFISLAEFAALN-ATAAGDDEEDLRLAFKVFD  130

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D  G ISA EL  V   +G+ + T++ CRRMI GVD NGDG + F++F  MM
Sbjct  131  ADGSGAISAAELARVLHGLGE-KATVQQCRRMIEGVDKNGDGLISFDEFKVMM  182



>ref|XP_004977499.1| PREDICTED: probable calcium-binding protein CML36-like [Setaria 
italica]
Length=182

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            ELR+ F  FD D DG+ISAEEL  V  ++GD RC++EDCRRMI GVD +GDGFVCF +F 
Sbjct  116  ELRETFAVFDADGDGRISAEELLAVLASLGDDRCSVEDCRRMIGGVDVDGDGFVCFNEFT  175

Query  288  RMM  280
            RMM
Sbjct  176  RMM  178



>ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=188

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  433
             +P +  EL  M+ EVD DGDGCISL EF  L++       DS+     L+DAF  FD D
Sbjct  65   GQPATELELDNMIREVDGDGDGCISLPEFIELNT----KGVDSDEVLENLKDAFAVFDID  120

Query  432  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             +G I+AEEL  V +++G+  C+L +CRRMI GVD +GDG + FE+F  MM
Sbjct  121  GNGSITAEELNTVMRSLGED-CSLAECRRMISGVDGDGDGTIDFEEFRVMM  170



>ref|XP_010531587.1| PREDICTED: probable calcium-binding protein CML25 [Tarenaya hassleriana]
Length=202

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            ++++ +G E P  +EL+  ++E+D DGDG I+ EEF  L++           L+DAF  +
Sbjct  72   SIMASLGHEVP-EDELQKAITEIDGDGDGNINFEEFVELNTKGMDQDDVMENLKDAFSVY  130

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL+ V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  131  DIDGNGSISAEELYEVLRSLGD-ECSIGECRKMISGVDKDGDGSIDFEEFKVMM  183



>ref|XP_010938627.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
 ref|XP_010938628.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=189

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFF  442
            A+   +G  P + EEL+ M+ E D DGDG ISL+EF  L+      S   E LR AF  F
Sbjct  65   AIFQNLG-HPATEEELQRMMGEADADGDGFISLDEFVDLNVRTVDDSAALEDLRHAFSVF  123

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISA+EL  V ++IG+   ++  C+RMI GVD +GDG V FE+F  MM
Sbjct  124  DLDRNGAISADELARVLRSIGEG-ASVTQCKRMIEGVDRDGDGLVSFEEFKLMM  176



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFD  439
            A + Q   E P+REE++ M++EVD DGDG I  E+F  + +     +   EL++AF  FD
Sbjct  34   ASVIQSLHENPTREEMQEMMNEVDPDGDGTIDFEDFLNIMAKKLKDNVTEELKEAFKVFD  93

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D DG ISA EL NV   +G+ R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  94   RDQDGFISANELRNVMMNLGE-RLTEEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -1

Query  594  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  415
            E P++EE+R M+ EVD DGDG +  EEF  + +     +   EL++AF  FD D DG IS
Sbjct  42   EHPTKEEIREMMHEVDADGDGTVDFEEFLSIMARKMKENVAEELKEAFKVFDRDQDGFIS  101

Query  414  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            A EL NV   +G+ R + E+  +MI   D +GDG V +E+F RMM
Sbjct  102  AIELRNVMMNLGE-RLSDEEAEQMIREADLDGDGVVSYEEFVRMM  145


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  471  SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
            +E R+AF   D D DG I+ EEL +V +++ +   T E+ R M+  VD +GDG V FE+F
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLNE-HPTKEEIREMMHEVDADGDGTVDFEEF  69

Query  291  CRMM  280
              +M
Sbjct  70   LSIM  73



>gb|AEW07415.1| hypothetical protein 0_990_01, partial [Pinus radiata]
 gb|AFG44135.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44136.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44137.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44139.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44140.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44141.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44143.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44144.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44145.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44146.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44147.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44148.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44149.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44150.1| hypothetical protein 0_990_01, partial [Pinus taeda]
 gb|AFG44151.1| hypothetical protein 0_990_01, partial [Pinus taeda]
Length=119

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFD  439
            L++ +G  P S +EL+LM+S  D +GDG I   EF+ L++     P    +++ AF  FD
Sbjct  2    LMASLGC-PASDDELQLMVSVADSNGDGFIDFSEFAELNTFGVDDPRRLQDMKSAFGIFD  60

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS +EL  VF  +G+ RC+LEDCR MI  VD+NGDG+V F++F  MM
Sbjct  61   FDGNGLISPDELLRVFHRLGE-RCSLEDCRIMIASVDSNGDGYVSFDEFLIMM  112



>ref|XP_010511464.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
 ref|XP_010415182.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
 ref|XP_010470515.1| PREDICTED: probable calcium-binding protein CML23 [Camelina sativa]
Length=158

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 8/115 (7%)
 Frame = -1

Query  603  VGAEPP--SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCD--SELRD---AFDF  445
            +GA  P  S+EE + M+ E D DG+G I L+EF  L         D  SE+RD   AFD 
Sbjct  40   IGALSPNASQEETKSMMKEFDLDGNGYIDLDEFVALFQVKQEDGEDNNSEIRDLKEAFDL  99

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +D D +G+ISA EL +V K +G+ +C+++DC+RMI  VD++GDG V F++F +MM
Sbjct  100  YDLDRNGRISANELHSVMKNLGE-KCSIQDCKRMISKVDSDGDGCVDFDEFKKMM  153



>ref|XP_010097572.1| putative calcium-binding protein CML27 [Morus notabilis]
 gb|EXB69104.1| putative calcium-binding protein CML27 [Morus notabilis]
Length=170

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  621  EALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFF  442
            EAL +Q     P  ++L+ ++ ++D D DG IS++EF    S  +     +ELRDAFD +
Sbjct  47   EALKAQGTTVTP--KDLQRVIEDLDSDRDGFISVKEFGAFCSQGSDDGGSAELRDAFDLY  104

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V   +G  +C+ EDC RMI+ VD++GDG V F +F +MM
Sbjct  105  DVDKNGLISAEELHKVLNRLG-MKCSPEDCHRMIISVDSDGDGNVNFAEFEKMM  157



>ref|XP_010032678.1| PREDICTED: calcium-binding protein CML24 [Eucalyptus grandis]
Length=147

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 5/114 (4%)
 Frame = -1

Query  612  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC---DSELRDAFDFF  442
            LS +G    + EE R  LSE+D +GDG I L EF+ + + + P        EL+  FD +
Sbjct  28   LSALGPTAATLEEARRALSEIDMNGDGFIDLNEFAEIFT-WGPGGGRNEQEELKGVFDIY  86

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G+ISA+EL  V K +G+ +C+L DCRRMI  VD +GDG V F++F  MM
Sbjct  87   DLDKNGRISAKELHAVMKKLGE-KCSLSDCRRMIGSVDRDGDGQVDFDEFKAMM  139


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  289
            E+R  F+ +D + DGKIS +EL      +G +  TLE+ RR +  +D NGDGF+   +F 
Sbjct  3    EVRLVFNKYDANGDGKISCDELRQALSALGPTAATLEEARRALSEIDMNGDGFIDLNEFA  62

Query  288  RM  283
             +
Sbjct  63   EI  64



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  436
            +++ +G++  + EE+  M+ E+DR+GDG I L+EF  L +         ELR+AF+ +D 
Sbjct  29   MMTALGSKTTT-EEVTRMMEELDRNGDGYIDLKEFGELHNGGGDTK---ELREAFEMYDL  84

Query  435  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D +G ISA+EL  V + +G+ +C+L DCR+MI  VD + DG V FE+F +MM
Sbjct  85   DKNGLISAKELHAVMRRLGE-KCSLGDCRKMIGNVDADADGNVNFEEFKKMM  135


 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -1

Query  468  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  292
            E+R  F+ FD + DGKIS  EL  +   +G S+ T E+  RM+  +D NGDG++  ++F
Sbjct  5    EVRKIFNKFDKNGDGKISRTELKEMMTALG-SKTTTEEVTRMMEELDRNGDGYIDLKEF  62



>gb|AFG44142.1| hypothetical protein 0_990_01, partial [Pinus taeda]
Length=119

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = -1

Query  615  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFD  439
            L++ +G  P S  EL+LM+S  D +GDG I   EF+ L++     P    +++ AF  FD
Sbjct  2    LMASLGC-PASDNELQLMVSVADSNGDGFIDFSEFAELNTFGVDDPRRLQDMKSAFGIFD  60

Query  438  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
             D +G IS +EL  VF  +G+ RC+LEDCR MI  VD+NGDG+V F++F  MM
Sbjct  61   FDGNGLISPDELLRVFHRLGE-RCSLEDCRIMIASVDSNGDGYVSFDEFLIMM  112



>ref|XP_011002781.1| PREDICTED: calcium-binding protein CML24-like [Populus euphratica]
Length=145

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = -1

Query  612  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCD--SELRDAFDF  445
            LS++G +  S  E+ L++ E D+DGDG I L+EF   + +      S +   ELRDAFD 
Sbjct  28   LSELGTKI-SPAEVELIMQEFDKDGDGYIDLDEFVDFIQNGGLGDSSGNDSKELRDAFDL  86

Query  444  FDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            +DT+ +G IS +EL +V K +G  +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  87   YDTNKNGLISVDELHSVMKMLG-LKCSLGDCRKMIREVDEDGDGNVNFEEFKKMM  140



>emb|CDX84967.1| BnaC05g20880D [Brassica napus]
Length=189

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  E L   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  62   AIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  120

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  121  DIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGVDKDGDGTIDFEEFKIMM  173



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  E L+  ++++DR GDG I+ EEF  L++           L+DAF  +
Sbjct  61   AIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFEEFVELNTKGMDQNEVLENLKDAFSVY  119

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  120  DIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGVDKDGDGTIDFEEFKIMM  172



>ref|XP_008808789.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=160

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -1

Query  597  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGK  421
              P + EEL +M+ E D +GDG ISLEEF  L++         E LR AF  FD D +G 
Sbjct  41   GHPATDEELEIMMGEADFNGDGYISLEEFLELNTKTVDAKAALEDLRHAFSVFDIDRNGS  100

Query  420  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            IS +EL  V ++IG+   TL  C++MI GVD +GDG + FE+F  MM
Sbjct  101  ISVDELEKVLRSIGEEE-TLAQCKKMIDGVDQDGDGLISFEEFKDMM  146



>ref|XP_009113828.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY27574.1| BnaA09g28330D [Brassica napus]
Length=191

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -1

Query  618  ALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFF  442
            A+++ +G E P  E L   ++E+DR GDG I+ EEF  L++           L+DAF  +
Sbjct  62   AIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENLKDAFSVY  120

Query  441  DTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  280
            D D +G ISAEEL  V +++GD  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  121  DIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGVDKDGDGTIDFEEFKIMM  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950