BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042E02

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              200   6e-60   
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     196   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              196   9e-60   Camelina sativa [gold-of-pleasure]
gb|AHZ58481.1|  alpha-tubulin                                           197   9e-60   Syntrichia caninervis
gb|AAD50629.1|AF106571_1  alpha-tubulin                                 194   1e-59   Gossypium hirsutum [American cotton]
emb|CDY35856.1|  BnaC09g37880D                                          195   1e-59   Brassica napus [oilseed rape]
emb|CAL35827.1|  alpha-2 tubulin                                        198   2e-59   Plantago major [cart-track plant]
dbj|BAH20267.1|  AT5G19780                                              198   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50628.1|AF106570_1  alpha-tubulin                                 193   3e-59   Gossypium hirsutum [American cotton]
gb|AAD50627.1|AF106569_1  alpha-tubulin                                 193   3e-59   Gossypium hirsutum [American cotton]
emb|CAJ44429.1|  alpha tubulin                                          192   4e-59   Cocos nucifera
gb|AAD50625.1|AF106567_1  alpha-tubulin                                 193   4e-59   Gossypium hirsutum [American cotton]
gb|AAD50626.1|AF106568_1  alpha-tubulin                                 193   5e-59   Gossypium hirsutum [American cotton]
emb|CAD20820.1|  alpha tubulin                                          195   5e-59   Zea mays [maize]
emb|CAD20821.1|  alpha tubulin                                          197   5e-59   Zea mays [maize]
gb|ABR25510.1|  tubulin alpha-1 chain                                   197   5e-59   Oryza sativa Indica Group [Indian rice]
gb|AFR42026.1|  alpha-tubulin                                           194   8e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            195   9e-59   
gb|AFR42020.1|  alpha-tubulin                                           194   1e-58   Populus trichocarpa [western balsam poplar]
gb|AFR42049.1|  alpha-tubulin                                           194   1e-58   Populus fremontii
ref|XP_001777110.1|  predicted protein                                  199   1e-58   
gb|ETK93233.1|  tubulin alpha-2 chain                                   191   1e-58   Phytophthora parasitica
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               195   1e-58   Erythranthe guttata [common monkey flower]
gb|AFR42036.1|  alpha-tubulin                                           194   1e-58   Populus alba [abele]
gb|AFR42035.1|  alpha-tubulin                                           194   1e-58   Populus alba [abele]
gb|AAN32997.1|  alpha-tubulin 1                                         192   1e-58   Gossypium hirsutum [American cotton]
gb|AFR42054.1|  alpha-tubulin                                           194   1e-58   Populus fremontii
gb|AFR42047.1|  alpha-tubulin                                           194   1e-58   Populus fremontii
gb|AFR42042.1|  alpha-tubulin                                           194   1e-58   Populus fremontii
gb|KIY91712.1|  Tubulin alpha chain                                     196   1e-58   Monoraphidium neglectum
dbj|BAA99561.1|  alpha-tubulin                                          192   1e-58   Chlorella vulgaris
dbj|BAH19954.1|  AT1G50010                                              195   2e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003886491.1|  unnamed protein product                            192   2e-58   Leishmania mexicana MHOM/GT/2001/U1103
gb|ACN40714.1|  unknown                                                 191   2e-58   Picea sitchensis
gb|KJB33191.1|  hypothetical protein B456_006G002500                    193   2e-58   Gossypium raimondii
emb|CAJ38386.1|  alpha tubulin                                          196   2e-58   Plantago major [cart-track plant]
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              194   3e-58   Solanum lycopersicum
gb|AAG28536.1|AF199019_1  alpha tubulin                                 193   3e-58   Leishmania major
gb|AFR42125.1|  alpha-tubulin                                           191   3e-58   Populus fremontii
gb|KJB83378.1|  hypothetical protein B456_013G244600                    199   3e-58   Gossypium raimondii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    197   3e-58   Gossypium raimondii
gb|AAU10519.1|  alpha tubulin                                           194   3e-58   Leishmania donovani
gb|AFR42118.1|  alpha-tubulin                                           191   4e-58   Populus trichocarpa [western balsam poplar]
gb|AFR42117.1|  alpha-tubulin                                           191   4e-58   Populus trichocarpa [western balsam poplar]
gb|AFR42123.1|  alpha-tubulin                                           191   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              200   4e-58   Populus euphratica
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              200   4e-58   Malus domestica [apple tree]
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   200   5e-58   
gb|AFR42124.1|  alpha-tubulin                                           190   5e-58   Populus alba [abele]
gb|AGG37286.1|  alpha-tubulin 4                                         200   5e-58   Salix arbutifolia
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              200   5e-58   Pyrus x bretschneideri [bai li]
gb|KDO25258.1|  hypothetical protein SPRG_09506                         192   5e-58   Saprolegnia parasitica CBS 223.65
gb|AGG37288.1|  alpha-tubulin 6                                         200   5e-58   Salix arbutifolia
ref|XP_008621874.1|  tubulin alpha                                      195   5e-58   Saprolegnia diclina VS20
emb|CDP17586.1|  unnamed protein product                                200   6e-58   Coffea canephora [robusta coffee]
gb|AGG37290.1|  alpha-tubulin 8                                         199   6e-58   Salix arbutifolia
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              199   6e-58   Populus euphratica
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               199   6e-58   Populus trichocarpa [western balsam poplar]
gb|ABR67425.1|  alpha-tubulin 4                                         199   6e-58   Populus tremuloides
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   199   6e-58   Populus euphratica
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   199   6e-58   Pyrus x bretschneideri [bai li]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   199   6e-58   Malus domestica [apple tree]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     199   6e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010112637.1|  Tubulin alpha-3 chain                              199   6e-58   Morus notabilis
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          199   6e-58   Amborella trichopoda
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   199   7e-58   Malus domestica [apple tree]
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   199   7e-58   Populus euphratica
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              199   7e-58   Prunus mume [ume]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     199   7e-58   Populus trichocarpa [western balsam poplar]
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        199   7e-58   Fragaria vesca subsp. vesca
gb|AGG37284.1|  alpha-tubulin 2                                         199   7e-58   Salix arbutifolia
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             199   7e-58   Prunus persica
gb|AAO63773.2|  alpha-tubulin 2                                         199   7e-58   Populus tremuloides
emb|CDY46272.1|  BnaC05g50610D                                          195   8e-58   Brassica napus [oilseed rape]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                199   8e-58   Erythranthe guttata [common monkey flower]
tpg|DAA41189.1|  TPA: alpha tubulin5                                    196   8e-58   
emb|CAB76917.1|  alpha-tubulin 4                                        195   8e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    196   8e-58   
emb|CDY44941.1|  BnaA02g04460D                                          199   8e-58   Brassica napus [oilseed rape]
gb|AHM93474.1|  alpha-tubulin                                           196   9e-58   Camellia chekiangoleosa
emb|CAB76918.1|  alpha-tubulin 5                                        191   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    197   1e-57   Gossypium raimondii
gb|ABR26014.1|  tubulin alpha-3 chain                                   189   1e-57   Oryza sativa Indica Group [Indian rice]
gb|ADD84794.1|  tubulin-like protein                                    191   1e-57   Cenchrus ciliaris [African foxtail grass]
ref|XP_006482574.1|  PREDICTED: tubulin alpha chain-like                190   1e-57   
emb|CAM58978.1|  alpha tubulin 5                                        193   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002677064.1|  alpha-tubulin                                      191   1e-57   Naegleria gruberi strain NEG-M
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              199   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     197   1e-57   Eucalyptus grandis [rose gum]
gb|AHJ80820.1|  Tua3                                                    197   1e-57   Eragrostis tef [tef]
gb|AAW57309.1|  alpha-tubulin                                           194   1e-57   Ceratopteris richardii
gb|AHJ80821.1|  Tua3                                                    197   1e-57   Eragrostis tef [tef]
gb|AEE98361.1|  alpha-tubulin                                           193   1e-57   Deschampsia antarctica
ref|XP_002525416.1|  tubulin alpha chain, putative                      199   1e-57   Ricinus communis
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              199   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              199   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN40824.1|  unknown                                                 199   1e-57   Picea sitchensis
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             199   1e-57   Gossypium arboreum [tree cotton]
gb|AAW57310.1|  alpha-tubulin                                           193   1e-57   Ceratopteris richardii
gb|KJB83375.1|  hypothetical protein B456_013G244600                    199   2e-57   Gossypium raimondii
ref|XP_007030078.1|  Tubulin alpha-5                                    199   2e-57   
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             198   2e-57   Citrus clementina [clementine]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   196   2e-57   Citrus sinensis [apfelsine]
gb|AEG74028.1|  alpha-tubulin                                           198   2e-57   Apopellia endiviifolia (species B)
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         198   2e-57   Jatropha curcas
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Vitis vinifera
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                198   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             198   2e-57   Citrus clementina [clementine]
ref|XP_001777081.1|  predicted protein                                  198   2e-57   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Sesamum indicum [beniseed]
gb|ABO47735.1|  alpha-tubulin                                           198   2e-57   Gossypium hirsutum [American cotton]
gb|AAW57306.1|  alpha-tubulin                                           193   2e-57   Ceratopteris richardii
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Brassica rapa
ref|XP_007014666.1|  Tubulin alpha-5                                    198   2e-57   Theobroma cacao [chocolate]
gb|ABO47741.1|  alpha-tubulin                                           198   2e-57   Gossypium hirsutum [American cotton]
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Brassica rapa
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_001782790.1|  predicted protein                                  198   2e-57   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Brassica rapa
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    198   2e-57   Tarenaya hassleriana [spider flower]
gb|KHG06861.1|  Tubulin alpha-6 chain                                   198   2e-57   Gossypium arboreum [tree cotton]
gb|AAO46127.1|  alpha-tubulin                                           192   2e-57   Streblomastix strix
emb|CDX88875.1|  BnaA03g07740D                                          198   2e-57   
ref|NP_197478.1|  tubulin alpha-3                                       198   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   198   2e-57   Nicotiana tomentosiformis
gb|EPY32266.1|  alpha tubulin                                           189   2e-57   Strigomonas culicis
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              198   2e-57   Brassica rapa
emb|CDY42294.1|  BnaC02g09000D                                          198   2e-57   Brassica napus [oilseed rape]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             198   2e-57   Capsella rubella
gb|KHN06388.1|  Tubulin alpha-3 chain                                   197   2e-57   Glycine soja [wild soybean]
ref|XP_002886753.1|  alpha-1 tubulin                                    198   3e-57   Arabidopsis lyrata subsp. lyrata
gb|ETL99841.1|  tubulin alpha-2 chain                                   188   3e-57   Phytophthora parasitica
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   198   3e-57   Camelina sativa [gold-of-pleasure]
gb|AAO46130.1|  alpha-tubulin                                           192   3e-57   Streblomastix strix
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              198   3e-57   Phoenix dactylifera
gb|EKG00833.1|  epsilon tubulin, putative                               189   3e-57   Trypanosoma cruzi
gb|ABB16994.1|  unknown                                                 198   3e-57   Solanum tuberosum [potatoes]
ref|NP_176654.1|  tubulin alpha-1 chain                                 198   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             198   3e-57   Capsella rubella
gb|ABL61201.1|  alpha-tubulin                                           194   3e-57   Oxymonadida environmental sample
gb|AHJ80819.1|  Tua1                                                    192   3e-57   Eragrostis tef [tef]
emb|CAC84108.1|  alpha-tubulin                                          188   3e-57   Gossypium hirsutum [American cotton]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              197   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             197   3e-57   Capsella rubella
emb|CBH08953.1|  alpha tubulin, (fragment)                              190   3e-57   Trypanosoma brucei gambiense DAL972
gb|ETK93222.1|  tubulin alpha-2 chain                                   187   4e-57   Phytophthora parasitica
ref|XP_001566612.1|  alpha tubulin                                      192   4e-57   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_002779346.1|  alpha-tubulin, putative                            190   4e-57   Perkinsus marinus ATCC 50983
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              197   4e-57   Sesamum indicum [beniseed]
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   197   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   197   4e-57   Phoenix dactylifera
gb|ETM52961.1|  tubulin alpha-2 chain                                   187   4e-57   Phytophthora parasitica
gb|ABL61216.1|  alpha-tubulin                                           194   4e-57   Oxymonadida environmental sample
gb|EKF29047.1|  epsilon tubulin, putative                               191   4e-57   Trypanosoma cruzi marinkellei
gb|EKF28172.1|  epsilon tubulin, putative                               192   5e-57   Trypanosoma cruzi marinkellei
emb|CCD11782.1|  unnamed protein product                                192   5e-57   Trypanosoma congolense IL3000
emb|CAD26886.1|  alpha-tubulin                                          197   5e-57   Miscanthus sinensis
gb|ABL61226.1|  alpha-tubulin                                           194   5e-57   Oxymonadida environmental sample
emb|CAD26891.1|  alpha-tubulin                                          197   5e-57   Miscanthus floridulus
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              197   5e-57   Elaeis guineensis
ref|NP_001105324.1|  tubulin alpha-5 chain                              197   5e-57   Zea mays [maize]
gb|AGD80034.1|  alpha-tubulin 1                                         197   5e-57   Hevea brasiliensis [jebe]
emb|CAD24768.1|  alpha-tubulin                                          197   5e-57   Miscanthus floridulus
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              197   5e-57   Setaria italica
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              197   5e-57   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      197   5e-57   Medicago truncatula
dbj|BAJ06363.1|  alpha-tubulin                                          197   6e-57   Alopecurus aequalis
gb|ABL61212.1|  alpha-tubulin                                           193   6e-57   Oxymonadida environmental sample
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   197   6e-57   Brachypodium distachyon [annual false brome]
gb|AGY80453.1|  tubulin                                                 197   6e-57   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               197   6e-57   Populus trichocarpa [western balsam poplar]
gb|ABL61224.1|  alpha-tubulin                                           193   6e-57   Oxymonadida environmental sample
gb|EPY40479.1|  tubulin alpha                                           191   6e-57   Angomonas deanei
gb|ABL61213.1|  alpha-tubulin                                           193   6e-57   Oxymonadida environmental sample
gb|ABL61215.1|  alpha-tubulin                                           193   6e-57   Oxymonadida environmental sample
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   197   6e-57   Elaeis guineensis
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             195   6e-57   Anemia phyllitidis
emb|CAD24766.1|  alpha-tubulin                                          197   6e-57   Miscanthus sinensis
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             197   6e-57   Gossypium arboreum [tree cotton]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    197   6e-57   Gossypium raimondii
ref|NP_001105588.1|  tubulin alpha-6 chain                              197   6e-57   Zea mays [maize]
emb|CAD24767.1|  alpha-tubulin                                          197   6e-57   Miscanthus floridulus
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              197   6e-57   Oryza brachyantha
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    197   6e-57   Eleusine indica [crabgrass]
emb|CAD26887.1|  alpha-tubulin                                          197   6e-57   Miscanthus sinensis
gb|ABV55994.1|  alpha-tubulin 6                                         197   6e-57   Populus tremuloides
ref|NP_001060075.1|  Os07g0574800                                       197   6e-57   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             197   6e-57   Hordeum vulgare [barley]
gb|ABD92942.1|  alpha tubulin-1D                                        197   6e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   197   6e-57   Eucalyptus grandis [rose gum]
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        197   7e-57   Prunus mume [ume]
emb|CAD24765.1|  alpha-tubulin                                          197   7e-57   Miscanthus sinensis
emb|CAD26890.1|  alpha-tubulin                                          197   7e-57   Miscanthus sinensis subsp. condensatus
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             197   7e-57   Prunus persica
gb|EPS62716.1|  alpha-tubulin                                           196   7e-57   Genlisea aurea
emb|CBH08958.1|  alpha tubulin, (fragment)                              193   7e-57   Trypanosoma brucei gambiense DAL972
ref|NP_001237301.1|  tubulin A                                          197   7e-57   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               197   7e-57   Glycine max [soybeans]
gb|AAD11425.1|  alpha tubulin                                           194   7e-57   Mesembryanthemum crystallinum
gb|KHN47983.1|  Tubulin alpha-3 chain                                   196   7e-57   Glycine soja [wild soybean]
gb|AAP34367.1|  alpha-tubulin                                           186   7e-57   Gossypium barbadense [Egyptian cotton]
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     197   7e-57   Eucalyptus grandis [rose gum]
emb|CAD26892.1|  alpha-tubulin                                          197   7e-57   Miscanthus floridulus
ref|XP_002532068.1|  tubulin alpha chain, putative                      197   7e-57   Ricinus communis
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    197   8e-57   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             197   8e-57   Phaseolus vulgaris [French bean]
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              197   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPY39349.1|  tubulin alpha                                           193   8e-57   Angomonas deanei
gb|KJB58756.1|  hypothetical protein B456_009G224800                    196   8e-57   Gossypium raimondii
ref|XP_002772835.1|  alpha-tubulin, putative                            188   8e-57   Perkinsus marinus ATCC 50983
gb|ABL61086.1|  alpha-tubulin                                           193   9e-57   Oxymonadida environmental sample
gb|EPY33355.1|  tubulin alpha                                           193   9e-57   Strigomonas culicis
gb|ABE01246.1|  alpha tubulin                                           196   1e-56   Camellia sinensis [black tea]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       196   1e-56   Cucumis sativus [cucumbers]
gb|AGI78243.1|  alpha tubulin 5                                         191   1e-56   Caragana korshinskii
gb|ABO47738.1|  alpha-tubulin                                           196   1e-56   Gossypium hirsutum [American cotton]
gb|ADJ00012.1|  tubulin alpha chain                                     190   1e-56   Chromera velia
ref|XP_002959708.1|  alpha tubulin                                      191   1e-56   Volvox carteri f. nagariensis
ref|XP_007515802.1|  alpha-tubulin                                      195   1e-56   Bathycoccus prasinos
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      196   1e-56   Phaseolus vulgaris [French bean]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   196   1e-56   Gossypium arboreum [tree cotton]
gb|ETM52928.1|  tubulin alpha chain                                     195   1e-56   Phytophthora parasitica
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   196   1e-56   Populus euphratica
gb|KJB44614.1|  hypothetical protein B456_007G261000                    196   1e-56   Gossypium raimondii
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             196   1e-56   Phaseolus vulgaris [French bean]
gb|ABQ59633.1|  alpha-tubulin 3                                         196   1e-56   Populus tremuloides
emb|CDP14299.1|  unnamed protein product                                196   1e-56   Coffea canephora [robusta coffee]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              196   2e-56   Populus euphratica
ref|NP_001275086.1|  uncharacterized LOC102577521                       196   2e-56   Solanum tuberosum [potatoes]
ref|XP_011398411.1|  Tubulin alpha chain                                194   2e-56   Auxenochlorella protothecoides
gb|AGG37285.1|  alpha-tubulin 3                                         196   2e-56   Salix arbutifolia
gb|ABK92520.1|  unknown                                                 196   2e-56   Populus trichocarpa [western balsam poplar]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         196   2e-56   Jatropha curcas
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              196   2e-56   
emb|CAD20819.1|  alpha tubulin                                          187   2e-56   Zea mays [maize]
gb|ABL61204.1|  alpha-tubulin                                           192   2e-56   Oxymonadida environmental sample
gb|AAB36609.1|  alpha-tubulin                                           194   2e-56   Eucalyptus globulus subsp. bicostata
gb|ABL61203.1|  alpha-tubulin                                           192   2e-56   Oxymonadida environmental sample
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 196   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003624633.1|  Alpha-tubulin                                      196   2e-56   Medicago truncatula
gb|ABL61202.1|  alpha-tubulin                                           192   2e-56   Oxymonadida environmental sample
gb|ABL61219.1|  alpha-tubulin                                           192   2e-56   Oxymonadida environmental sample
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                196   2e-56   Euglena gracilis
gb|ABR26150.1|  tubulin alpha-3 chain                                   188   2e-56   Oryza sativa Indica Group [Indian rice]
gb|ETI53409.1|  tubulin alpha chain                                     187   2e-56   Phytophthora parasitica P1569
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              196   2e-56   Cucumis sativus [cucumbers]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   195   2e-56   Citrus sinensis [apfelsine]
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 196   2e-56   Euglena gracilis
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        196   2e-56   Cucumis melo [Oriental melon]
gb|AAO46128.1|  alpha-tubulin                                           190   2e-56   Streblomastix strix
emb|CAA52158.1|  alpha tubulin                                          190   2e-56   Zea mays [maize]
gb|ABU93324.1|  tubulin alpha subunit                                   196   2e-56   Monocercomonoides sp. PA
gb|AEQ75493.1|  alpha-tubulin                                           195   2e-56   Rosa multiflora [Japanese rose]
gb|AFW89176.1|  hypothetical protein ZEAMMB73_322393                    195   2e-56   
gb|AIX10773.1|  alpha tubulin                                           195   3e-56   Panax notoginseng [san-qi]
gb|ABU93323.1|  tubulin alpha subunit                                   195   3e-56   Monocercomonoides sp. PA
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    195   3e-56   
gb|AAO46126.1|  alpha-tubulin                                           189   3e-56   Streblomastix strix
ref|XP_001427643.1|  hypothetical protein                               189   3e-56   Paramecium tetraurelia strain d4-2
gb|ABU93321.1|  tubulin alpha subunit                                   195   3e-56   Monocercomonoides sp. PA
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                194   3e-56   Erythranthe guttata [common monkey flower]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    194   3e-56   Gossypium raimondii
gb|AAO23139.1|  alpha tubulin                                           195   3e-56   Populus tremuloides
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              195   3e-56   
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          195   3e-56   Sorghum bicolor [broomcorn]
gb|ABL61217.1|  alpha-tubulin                                           191   3e-56   Oxymonadida environmental sample
sp|O22348.1|TBA2_ELEIN  RecName: Full=Tubulin alpha-2 chain; AltN...    195   3e-56   Eleusine indica [crabgrass]
gb|KIZ03400.1|  Tubulin alpha chain                                     195   3e-56   Monoraphidium neglectum
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              195   3e-56   Cucumis melo [Oriental melon]
gb|AGV54500.1|  tubulin A                                               195   3e-56   Phaseolus vulgaris [French bean]
gb|ABL61227.1|  alpha-tubulin                                           191   3e-56   Oxymonadida environmental sample
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              195   3e-56   Glycine max [soybeans]
emb|CDY66630.1|  BnaCnng51680D                                          195   3e-56   Brassica napus [oilseed rape]
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   195   3e-56   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                196   3e-56   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  195   3e-56   
ref|XP_010093625.1|  Tubulin alpha chain                                195   3e-56   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              195   3e-56   
gb|ACU20294.1|  unknown                                                 192   3e-56   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   195   3e-56   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      195   3e-56   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                195   4e-56   
emb|CDY29334.1|  BnaA05g16010D                                          194   4e-56   
gb|KHN08201.1|  Tubulin alpha chain                                     195   4e-56   
gb|KHG20487.1|  Tubulin alpha chain                                     195   4e-56   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   195   4e-56   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              195   4e-56   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             195   4e-56   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             195   4e-56   
gb|ADW83724.1|  alpha-tubulin                                           194   4e-56   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             195   4e-56   
ref|NP_001289660.1|  tubulin alpha chain-like                           195   4e-56   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    195   4e-56   
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             195   4e-56   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    189   4e-56   
emb|CAN62392.1|  hypothetical protein VITISV_016172                     194   4e-56   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_002510010.1|  tubulin alpha chain, putative                      195   4e-56   
gb|ABX57816.1|  alpha tubulin                                           195   4e-56   
gb|AAV92352.1|  alpha tubulin 1                                         195   4e-56   
gb|ABR25378.1|  tubulin alpha 3 chain                                   188   4e-56   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             195   4e-56   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             195   4e-56   
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          195   4e-56   
gb|KHG18997.1|  Tubulin alpha chain                                     195   4e-56   
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    195   4e-56   
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             195   4e-56   
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   195   4e-56   
ref|XP_002522104.1|  tubulin alpha chain, putative                      195   4e-56   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             195   4e-56   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    195   4e-56   
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
gb|AID52921.1|  tubulin alpha chain                                     195   4e-56   
gb|ACN40181.1|  unknown                                                 195   4e-56   
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     195   4e-56   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             195   4e-56   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   195   4e-56   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   195   4e-56   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          195   4e-56   
ref|XP_007018369.1|  Tubulin alpha-2 chain                              195   4e-56   
ref|XP_001764722.1|  predicted protein                                  195   4e-56   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             195   4e-56   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              195   4e-56   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              195   4e-56   
gb|AGG37283.1|  alpha-tubulin 1                                         195   4e-56   
ref|NP_171974.1|  tubulin alpha-4 chain                                 195   4e-56   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              195   4e-56   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    195   4e-56   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     195   4e-56   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              195   4e-56   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_007512064.1|  alpha-tubulin                                      195   4e-56   
ref|XP_001419217.1|  predicted protein                                  195   4e-56   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   195   4e-56   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         195   4e-56   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        195   4e-56   
gb|AIC33057.1|  tubulin alpha-1 chain                                   195   4e-56   
ref|XP_010104543.1|  Tubulin alpha chain                                195   4e-56   
gb|AIX10966.1|  tubulin                                                 195   4e-56   
prf||1503274A  alpha1 tubulin                                           195   4e-56
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                195   4e-56   
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     195   4e-56   
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     195   4e-56   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             195   4e-56   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     195   5e-56   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              195   5e-56   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             195   5e-56   
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     195   5e-56   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          195   5e-56   
gb|ABO47740.1|  alpha-tubulin                                           194   5e-56   
gb|ABO47736.1|  alpha-tubulin                                           194   5e-56   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             194   5e-56   
gb|AEW46684.1|  beta-tubulin                                            195   5e-56   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        195   5e-56   
ref|XP_010096739.1|  Tubulin alpha chain                                194   5e-56   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     194   5e-56   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         194   5e-56   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             194   5e-56   
gb|ABV55999.1|  alpha-tubulin 7                                         194   5e-56   
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         194   5e-56   
gb|ACJ60905.1|  alpha tubulin                                           194   5e-56   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     194   5e-56   
gb|ABO47742.1|  alpha-tubulin                                           194   5e-56   
gb|ABO47739.1|  alpha-tubulin                                           194   5e-56   
emb|CAD13176.1|  alpha-tubulin                                          194   5e-56   
emb|CDP02221.1|  unnamed protein product                                194   5e-56   
ref|XP_002508010.1|  alpha tubulin 2                                    194   5e-56   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               194   5e-56   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   194   5e-56   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             194   5e-56   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   194   5e-56   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     194   5e-56   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             194   5e-56   
ref|XP_010099392.1|  Tubulin alpha chain                                195   5e-56   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             194   5e-56   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        194   5e-56   
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             194   5e-56   
gb|ACJ04933.1|  alpha tubulin                                           188   5e-56   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                194   5e-56   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              194   5e-56   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              194   5e-56   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   194   5e-56   
ref|NP_001275271.1|  alpha-tubulin-like protein                         194   5e-56   
ref|XP_007042689.1|  Tubulin alpha-2 chain                              194   5e-56   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              194   5e-56   
ref|NP_001291325.1|  tubulin alpha chain-like                           194   5e-56   
ref|XP_005643073.1|  tubulin alpha chain                                194   5e-56   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             194   5e-56   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          194   5e-56   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     194   5e-56   
ref|XP_005851144.1|  alpha-tubulin                                      194   5e-56   
ref|WP_039310890.1|  hypothetical protein                               194   5e-56   
gb|ABL61214.1|  alpha-tubulin                                           191   5e-56   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              194   6e-56   
ref|NP_193232.1|  tubulin alpha-6 chain                                 194   6e-56   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     194   6e-56   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                194   6e-56   
ref|XP_005651460.1|  tubulin alpha chain                                194   6e-56   
ref|XP_003058621.1|  alpha tubulin                                      194   6e-56   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              194   6e-56   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     194   6e-56   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             194   6e-56   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                194   6e-56   
gb|ABB02631.1|  unknown                                                 194   6e-56   
ref|XP_002517492.1|  tubulin alpha chain, putative                      194   6e-56   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     194   6e-56   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                194   6e-56   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     194   6e-56   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    194   6e-56   
gb|AGG37289.1|  alpha-tubulin 7                                         194   6e-56   
dbj|BAJ06365.1|  alpha-tubulin                                          194   6e-56   
gb|ACK76232.1|  alpha-tubulin                                           194   6e-56   
gb|ABP65320.1|  alpha tubulin                                           194   6e-56   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                194   6e-56   
gb|ABC59068.2|  alpha tubulin 1                                         194   6e-56   
gb|AAW57305.1|  alpha-tubulin                                           191   6e-56   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              194   6e-56   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    194   7e-56   
gb|ACH68563.1|  alpha-tubulin                                           194   7e-56   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            191   7e-56   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                194   7e-56   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             193   7e-56   
gb|ETM53002.1|  tubulin alpha chain                                     186   7e-56   
emb|CCI45804.1|  unnamed protein product                                194   8e-56   
ref|XP_007015700.1|  Tubulin alpha-5, putative                          196   8e-56   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             194   8e-56   
gb|KJB46051.1|  hypothetical protein B456_007G346000                    192   8e-56   
gb|AFK33477.1|  unknown                                                 191   8e-56   
emb|CAD26893.1|  alpha-tubulin                                          194   8e-56   
emb|CCW60849.1|  unnamed protein product                                192   8e-56   
gb|AFW67749.1|  alpha tubulin4                                          191   8e-56   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             194   9e-56   
ref|XP_001563163.2|  alpha tubulin                                      194   9e-56   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                194   9e-56   
emb|CCA20146.1|  alpha tubulin 1 putative                               194   9e-56   
gb|ABL61228.1|  alpha-tubulin                                           190   9e-56   
gb|AAZ23863.1|  alpha-tubulin                                           194   9e-56   
gb|AEW44192.1|  alpha-tubulin                                           184   9e-56   
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              194   9e-56   
sp|P50258.1|TBAD_PHYPO  RecName: Full=Tubulin alpha-1A chain            194   1e-55   
gb|ABC40566.1|  alpha-tubulin                                           194   1e-55   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     194   1e-55   
gb|ETM30643.1|  tubulin alpha chain                                     194   1e-55   
gb|AAZ42551.1|  alpha-tubulin                                           194   1e-55   
gb|AFK92919.1|  alpha-tubulin                                           194   1e-55   
ref|XP_008877307.1|  tubulin alpha chain                                191   1e-55   
ref|XP_001770881.1|  predicted protein                                  194   1e-55   
ref|XP_001681772.1|  alpha tubulin                                      194   1e-55   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    194   1e-55   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   194   1e-55   
gb|ABL61218.1|  alpha-tubulin                                           190   1e-55   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              195   1e-55   
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              194   1e-55   
ref|XP_003392359.1|  alpha tubulin                                      194   1e-55   
gb|ABP65323.1|  alpha tubulin                                           194   1e-55   
emb|CCI41153.1|  unnamed protein product                                194   1e-55   
ref|XP_008900864.1|  tubulin alpha chain                                194   1e-55   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             194   1e-55   
ref|XP_008872990.1|  tubulin alpha chain                                194   1e-55   
gb|ETO82054.1|  tubulin alpha chain                                     194   1e-55   
ref|XP_002904195.1|  alpha-tubulin, putative                            194   1e-55   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      190   1e-55   
dbj|BAJ86161.1|  predicted protein                                      193   1e-55   
gb|ETM52951.1|  tubulin alpha chain                                     193   1e-55   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     193   1e-55   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        193   1e-55   
gb|EMT20847.1|  Tubulin alpha-2 chain                                   193   1e-55   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              193   1e-55   
ref|XP_002904194.1|  alpha-tubulin                                      193   1e-55   
gb|ABD92939.1|  alpha tubulin-5D                                        193   1e-55   
ref|XP_006649647.1|  PREDICTED: tubulin alpha-2 chain-like              193   1e-55   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   193   1e-55   
ref|XP_009842456.1|  tubulin alpha chain                                193   1e-55   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                193   1e-55   
dbj|BAJ06364.1|  alpha-tubulin                                          193   1e-55   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              193   1e-55   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           193   2e-55   
gb|KJB29387.1|  hypothetical protein B456_005G097800                    193   2e-55   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           193   2e-55   
gb|ABD92937.1|  alpha tubulin-4A                                        193   2e-55   
gb|ABD92936.1|  alpha tubulin-4D                                        193   2e-55   
gb|ABD92940.1|  alpha tubulin-5A                                        193   2e-55   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    193   2e-55   
gb|ETW27380.1|  tubulin alpha chain                                     190   2e-55   
gb|ABD77520.1|  tubulin alpha 2                                         184   2e-55   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  174  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  233

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  234  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  74   VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   196 bits (499),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  74   VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  92   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  151

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  152  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>gb|AAD50629.1|AF106571_1 alpha-tubulin [Gossypium hirsutum]
Length=126

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  18   VQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  77

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  78   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  109



>emb|CDY35856.1| BnaC09g37880D [Brassica napus]
Length=149

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  40   VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  99

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  100  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  131



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  140  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  199

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  175  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  234

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  235  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>gb|AAD50628.1|AF106570_1 alpha-tubulin [Gossypium hirsutum]
Length=127

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  18   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  77

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  78   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  109



>gb|AAD50627.1|AF106569_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>emb|CAJ44429.1| alpha tubulin [Cocos nucifera]
Length=115

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCM+SN+T+VAEVFSRIDHKFDLMY+
Sbjct  3    VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMVSNSTSVAEVFSRIDHKFDLMYA  62

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  63   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  94



>gb|AAD50625.1|AF106567_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AAD50626.1|AF106568_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  114



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   195 bits (496),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  91   VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  150

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  151  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  165  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  224

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  225  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  146  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  205

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  206  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  102  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  161

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  162  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  108  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  167

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  168  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  102  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  161

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  162  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  102  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  161

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  162  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  236  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  295

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  296  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>gb|ETK93233.1| tubulin alpha-2 chain, partial [Phytophthora parasitica]
Length=119

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRIDHKFDLMY+
Sbjct  7    IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYA  66

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  67   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  98



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  108  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  167

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  168  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  100  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  159

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  160  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  101  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  160

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  161  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AAN32997.1| alpha-tubulin 1, partial [Gossypium hirsutum]
Length=132

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  22   IQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  81

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  82   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  113



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  101  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  160

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  161  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  99   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  158

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  159  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  99   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  158

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  159  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAVAEVFSR+DHKFDLMY+
Sbjct  139  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYA  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>dbj|BAA99561.1| alpha-tubulin [Chlorella vulgaris]
Length=149

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSR+DHKFDLMY+
Sbjct  39   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYA  98

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  99   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  130



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  139  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  93   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  152

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  153  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>ref|XP_003886491.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ41034.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
Length=151

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  41   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ACN40714.1| unknown [Picea sitchensis]
Length=139

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN T+VAEVFSRIDHKFDLMY+
Sbjct  29   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNLTSVAEVFSRIDHKFDLMYA  88

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  120



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  74   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYV EGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFVHWYVSEGMEEGEFSEAREDLAALEKDY  165



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  161  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  220

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  221  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  117  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYA  176

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  177  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>gb|AAG28536.1|AF199019_1 alpha tubulin [Leishmania major]
Length=200

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  90   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  149

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  181



>gb|AFR42125.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42126.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42127.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42128.1| alpha-tubulin, partial [Populus fremontii]
Length=131

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+
Sbjct  21   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYA  80

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  81   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  112



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  296  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  355

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  356  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  387



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  231  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  290

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  291  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|AAU10519.1| alpha tubulin, partial [Leishmania donovani]
Length=249

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  139  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AFR42118.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AFR42117.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42119.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42120.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42121.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42122.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42129.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42130.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42131.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42132.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42133.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42134.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42135.1| alpha-tubulin, partial [Populus nigra]
Length=133

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AFR42123.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42124.1| alpha-tubulin, partial [Populus alba]
Length=133

 Score =   190 bits (483),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+
Sbjct  23   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYA  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRIDHKFDLMY+
Sbjct  74   IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRIDHKFDLMY+
Sbjct  161  IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYA  220

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  221  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY46272.1| BnaC05g50610D [Brassica napus]
Length=289

 Score =   195 bits (495),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  180  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  239

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  240  KRAFFHWYVGEGMEEGEFSEAREDLAALEKDY  271



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  211  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  270

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  271  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   195 bits (495),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMY+
Sbjct  179  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYA  238

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  239  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  211  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  270

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  271  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  218  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  277

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  278  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>emb|CAB76918.1| alpha-tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKV+RAVCMISNNTAVAEVFSRID KFDLMY+
Sbjct  84   VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYA  143

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  144  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  252  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  311

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  312  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|ABR26014.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=133

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMYS
Sbjct  23   IQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYS  82

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  83   KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMY+
Sbjct  74   IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_006482574.1| PREDICTED: tubulin alpha chain-like [Citrus sinensis]
Length=150

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMYS
Sbjct  41   IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYS  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>emb|CAM58978.1| alpha tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKV+RAVCMISNNTAVAEVFSRID KFDLMY+
Sbjct  139  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYA  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRIDHKFDLMY+
Sbjct  83   IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYA  142

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  143  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  174



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  273  VQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  332

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  333  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  364



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  291  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  350

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  351  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  382



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID+KFDLMY+
Sbjct  156  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYA  215

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  216  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  292  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  351

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  352  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  383



>gb|AEE98361.1| alpha-tubulin [Deschampsia antarctica]
Length=254

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKV+RAVCMISNNTAVAEVFSRID KFDLMY+
Sbjct  146  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYA  205

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  206  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRID+KFDLMY+
Sbjct  157  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYA  216

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  217  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  374  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  433

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  434  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  465



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  245  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  304

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  305  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T++AEVFSR+DHKFDLMY+
Sbjct  147  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYA  206

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  207  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  352  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  411

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  412  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  443



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRIDHKFDLMY+
Sbjct  140  IQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYA  199

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY32266.1| alpha tubulin [Strigomonas culicis]
 gb|EPY32660.1| alpha tubulin [Strigomonas culicis]
Length=150

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  41   IQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  313  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  372

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  373  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETL99841.1| tubulin alpha-2 chain, partial [Phytophthora parasitica]
Length=127

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAV MISN +A+AEVFSRIDHKFDLMY+
Sbjct  15   IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVAMISNTSAIAEVFSRIDHKFDLMYA  74

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHW+VGEGMEEGEFSEAREDLAALEKDY
Sbjct  75   KRAFVHWFVGEGMEEGEFSEAREDLAALEKDY  106



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRIDHKFDLMY+
Sbjct  140  IQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYA  199

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EKG00833.1| epsilon tubulin, putative [Trypanosoma cruzi]
 gb|ESL09113.1| hypothetical protein TRSC58_03174 [Trypanosoma rangeli SC58]
 gb|ESL09781.1| hypothetical protein TRSC58_02494 [Trypanosoma rangeli SC58]
Length=151

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  41   IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  359  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  418

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  419  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  450



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  189  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  248

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  249  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMY+
Sbjct  133  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYA  192

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  193  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>emb|CAC84108.1| alpha-tubulin, partial [Gossypium hirsutum]
Length=132

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  41   IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEK  318
            KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEK  130



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  80   IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  139

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  140  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  171



>gb|ETK93222.1| tubulin alpha-2 chain, partial [Phytophthora parasitica]
Length=111

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = -3

Query  581  FVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKR  402
            FVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRIDHKFDLMY+KR
Sbjct  1    FVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKR  60

Query  401  AFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  61   AFVHWYVGEGMEEGEFSEAREDLAALEKDY  90



>ref|XP_001566612.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM40126.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
Length=259

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  149  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  208

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  209  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  240



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMISN+TAVAEVFSRIDHKFDLMY+
Sbjct  74   IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVFSRIDHKFDLMYA  133

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETM52961.1| tubulin alpha-2 chain, partial [Phytophthora parasitica]
Length=117

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAV MISN +A+AEVFSRIDHKFDLMY+
Sbjct  5    IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVAMISNTSAIAEVFSRIDHKFDLMYA  64

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHW+VGEGMEEGEFSEAREDLAALEKDY
Sbjct  65   KRAFVHWFVGEGMEEGEFSEAREDLAALEKDY  96



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  130  IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  189

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  190  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  221



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  139  IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  147  IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  206

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  207  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  238



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61226.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRID+KFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|EPY40479.1| tubulin alpha [Angomonas deanei]
 gb|EPY41044.1| tubulin alpha [Angomonas deanei]
 gb|EPY41215.1| tubulin alpha [Angomonas deanei]
Length=248

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  139  IQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  198

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|ABL61213.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  257  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  316

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            K AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  317  KLAFVHWYVGEGMEEGEFSEAREDLAALEKDY  348



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRID+KFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  295  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  354

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  193  IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  252

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  253  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  284



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  256  IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  315

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  316  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  347



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  314  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  373

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  374  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  405



>gb|AAP34367.1| alpha-tubulin [Gossypium barbadense]
Length=108

 Score =   186 bits (473),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = -3

Query  578  VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRA  399
            VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRA
Sbjct  2    VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRA  61

Query  398  FVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            FVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   FVHWYVGEGMEEGEFSEAREDLAALEKDY  90



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  350  VQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  409

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  410  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  441



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY39349.1| tubulin alpha, partial [Angomonas deanei]
Length=306

 Score =   193 bits (490),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  206  IQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  265

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  266  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  306  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  365

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  366  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_002772835.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER04651.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=153

 Score =   188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMISN+TAVAEVFSRIDHKFDLMY+
Sbjct  41   IQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVFSRIDHKFDLMYA  100

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  101  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ABL61086.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   193 bits (490),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|EPY33355.1| tubulin alpha [Strigomonas culicis]
 gb|EPY33584.1| tubulin alpha [Strigomonas culicis]
Length=315

 Score =   193 bits (490),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYS
Sbjct  206  IQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYS  265

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  266  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT VAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTLVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY+
Sbjct  306  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYA  365

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  366  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/90 (98%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRID KFDLMYS
Sbjct  151  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDQKFDLMYS  210

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEK  318
            KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  211  KRAFVHWYVGEGMEEGEFSEAREDLAALEK  240



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAVAEVF+RIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKV RA CMISN+TA+AEVFSR+DHKFDLMY+
Sbjct  143  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRACCMISNSTAIAEVFSRMDHKFDLMYA  202

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  203  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  234



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+ E+FSR+DHKFDLMY+
Sbjct  145  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYA  204

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  205  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSR+DHKFDLMY+
Sbjct  306  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYA  365

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  366  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRID+KFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRIDHKFDLMY+
Sbjct  286  IQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYA  345

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  346  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  377



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRID+KFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPCGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275086.1| uncharacterized LOC102577521 [Solanum tuberosum]
 gb|ABC01891.1| tubulin alpha-5 chain-like protein [Solanum tuberosum]
Length=449

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA CMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAACMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSR+DHKFDLMY+
Sbjct  285  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYA  344

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  345  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  376



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  IQFVDWCPTGFKCGINYQPPSVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20819.1| alpha tubulin [Zea mays]
Length=146

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMY+
Sbjct  36   IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYA  95

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  96   KRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  127



>gb|ABL61204.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+
Sbjct  189  IQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYA  248

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  249  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T +AEVFSRIDHKFDLMY+
Sbjct  271  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYA  330

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  331  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  362



>gb|ABL61203.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDL+Y+
Sbjct  189  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLVYA  248

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  249  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            VQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRIDHKFDLMY+
Sbjct  341  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDHKFDLMYA  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KF+LMY+
Sbjct  189  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFELMYA  248

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  249  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAVAEVFSRID KFDLMY+
Sbjct  204  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRIDRKFDLMYA  263

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  264  KRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  295



>sp|P33625.1|TBA_EUGGR RecName: Full=Tubulin alpha chain [Euglena gracilis]
 emb|CAA80497.1| tubulin [Euglena gracilis]
Length=451

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF+RIDHKFDLMYS
Sbjct  341  IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFARIDHKFDLMYS  400

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  401  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  587  VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYS  408
            +QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRID KFDLMYS
Sbjct  76   IQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYS  135

Query  407  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  312
            KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  136  KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925