BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF042C12

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610723.1|  PREDICTED: uncharacterized protein LOC104104364    125   2e-30   Nicotiana tomentosiformis
ref|XP_009786123.1|  PREDICTED: uncharacterized protein LOC104234287    125   2e-30   Nicotiana sylvestris
ref|XP_006346625.1|  PREDICTED: uncharacterized protein LOC102590754    119   4e-28   Solanum tuberosum [potatoes]
ref|XP_006346626.1|  PREDICTED: uncharacterized protein LOC102591330    119   5e-28   Solanum tuberosum [potatoes]
dbj|BAF47117.1|  MtN19 like protein                                     110   4e-27   Nicotiana tabacum [American tobacco]
ref|XP_004252289.1|  PREDICTED: uncharacterized protein LOC101252852    115   7e-27   Solanum lycopersicum
ref|XP_006368006.1|  PREDICTED: uncharacterized protein LOC102587597    114   3e-26   Solanum tuberosum [potatoes]
ref|XP_004242193.1|  PREDICTED: uncharacterized protein LOC101264834    113   4e-26   Solanum lycopersicum
ref|XP_009802236.1|  PREDICTED: uncharacterized protein LOC104247817    110   4e-25   Nicotiana sylvestris
ref|XP_009596902.1|  PREDICTED: uncharacterized protein LOC104092914    109   9e-25   
emb|CDO98292.1|  unnamed protein product                                108   4e-24   Coffea canephora [robusta coffee]
ref|XP_006346659.1|  PREDICTED: uncharacterized protein LOC102603832    107   9e-24   Solanum tuberosum [potatoes]
ref|XP_006376936.1|  hypothetical protein POPTR_0012s11240g             100   1e-22   
ref|XP_011043019.1|  PREDICTED: uncharacterized protein LOC105138...  99.8    1e-22   Populus euphratica
ref|XP_011043018.1|  PREDICTED: uncharacterized protein LOC105138...  99.8    2e-22   Populus euphratica
gb|KDO37888.1|  hypothetical protein CISIN_1g033184mg                 98.2    2e-22   Citrus sinensis [apfelsine]
emb|CBI15775.3|  unnamed protein product                                100   3e-22   Vitis vinifera
gb|KDO57643.1|  hypothetical protein CISIN_1g041033mg                 96.3    1e-21   Citrus sinensis [apfelsine]
ref|XP_006374581.1|  hypothetical protein POPTR_0015s11990g             100   2e-21   
ref|XP_007038175.1|  MtN19-like protein, putative isoform 2             101   3e-21   
emb|CDO98291.1|  unnamed protein product                                100   3e-21   Coffea canephora [robusta coffee]
ref|XP_002284739.2|  PREDICTED: uncharacterized protein LOC100243...    100   4e-21   Vitis vinifera
ref|XP_007038174.1|  MtN19-like protein, putative isoform 1             100   5e-21   
ref|XP_011016694.1|  PREDICTED: uncharacterized protein LOC105120200  99.4    7e-21   Populus euphratica
ref|XP_011003519.1|  PREDICTED: uncharacterized protein LOC105110237  99.4    7e-21   Populus euphratica
ref|XP_006376935.1|  hypothetical protein POPTR_0012s11210g           98.6    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009411808.1|  PREDICTED: uncharacterized protein LOC103993457  98.2    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511073.1|  conserved hypothetical protein                   97.8    2e-20   
ref|XP_011040291.1|  PREDICTED: uncharacterized protein LOC105136589  97.8    2e-20   Populus euphratica
ref|XP_002321764.2|  hypothetical protein POPTR_0015s12000g           97.4    3e-20   
ref|XP_010255828.1|  PREDICTED: uncharacterized protein LOC104596...  97.1    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010255827.1|  PREDICTED: uncharacterized protein LOC104596...  97.1    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010255826.1|  PREDICTED: uncharacterized protein LOC104596...  97.4    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010036842.1|  PREDICTED: uncharacterized protein LOC104425754  96.3    7e-20   Eucalyptus grandis [rose gum]
ref|XP_006485063.1|  PREDICTED: uncharacterized protein LOC102618549  95.9    1e-19   Citrus sinensis [apfelsine]
ref|XP_006436986.1|  hypothetical protein CICLE_v10031458mg           95.9    1e-19   Citrus clementina [clementine]
gb|EYU21767.1|  hypothetical protein MIMGU_mgv1a005580mg              95.9    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_006436984.1|  hypothetical protein CICLE_v10031461mg           95.1    2e-19   Citrus clementina [clementine]
ref|XP_011040294.1|  PREDICTED: uncharacterized protein LOC105136594  94.0    6e-19   Populus euphratica
ref|XP_011073280.1|  PREDICTED: uncharacterized protein LOC105158279  92.4    2e-18   Sesamum indicum [beniseed]
gb|KJB53255.1|  hypothetical protein B456_008G211400                  92.0    2e-18   Gossypium raimondii
gb|KJB53254.1|  hypothetical protein B456_008G211400                  92.0    2e-18   Gossypium raimondii
ref|XP_009373663.1|  PREDICTED: uncharacterized protein LOC103962645  91.7    3e-18   Pyrus x bretschneideri [bai li]
gb|KJB53256.1|  hypothetical protein B456_008G211400                  92.0    3e-18   Gossypium raimondii
gb|KJB53258.1|  hypothetical protein B456_008G211400                  92.0    3e-18   Gossypium raimondii
ref|XP_008360160.1|  PREDICTED: uncharacterized protein LOC103423859  89.0    6e-18   
ref|XP_002511074.1|  conserved hypothetical protein                   90.9    7e-18   
ref|XP_010663820.1|  PREDICTED: uncharacterized protein LOC100243...  89.7    1e-17   
gb|AFK39203.1|  unknown                                               84.7    1e-17   Lotus japonicus
gb|AFA26164.1|  hypothetical protein                                  84.7    1e-17   Lolium perenne [perennial ryegrass]
gb|KEH31349.1|  stress up-regulated Nod 19 protein                    89.7    1e-17   Medicago truncatula
gb|KHG10977.1|  G2/mitotic-specific cyclin-B                          89.7    2e-17   Gossypium arboreum [tree cotton]
ref|XP_008375426.1|  PREDICTED: uncharacterized protein LOC103438663  89.0    2e-17   Malus domestica [apple tree]
ref|XP_006844650.1|  hypothetical protein AMTR_s00016p00236100        89.4    2e-17   
ref|XP_009360279.1|  PREDICTED: uncharacterized protein LOC103950769  88.6    3e-17   Pyrus x bretschneideri [bai li]
gb|KJB46718.1|  hypothetical protein B456_008G2113001                 88.6    4e-17   Gossypium raimondii
gb|KJB46717.1|  hypothetical protein B456_008G2113001                 88.6    5e-17   Gossypium raimondii
ref|XP_010099538.1|  hypothetical protein L484_011611                 87.8    5e-17   Morus notabilis
ref|XP_010099537.1|  hypothetical protein L484_011610                 87.8    6e-17   Morus notabilis
ref|XP_011073282.1|  PREDICTED: uncharacterized protein LOC105158282  88.2    6e-17   Sesamum indicum [beniseed]
ref|XP_003574848.1|  PREDICTED: uncharacterized protein LOC100825842  87.4    7e-17   Brachypodium distachyon [annual false brome]
dbj|BAJ88316.1|  predicted protein                                    86.3    7e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006374582.1|  hypothetical protein POPTR_0015s12010g           87.4    1e-16   
gb|KHN25869.1|  hypothetical protein glysoja_018723                   85.1    1e-16   Glycine soja [wild soybean]
gb|KEH31347.1|  stress up-regulated Nod 19 protein                    87.0    1e-16   Medicago truncatula
ref|XP_010099536.1|  hypothetical protein L484_011609                 86.7    2e-16   Morus notabilis
ref|XP_008808814.1|  PREDICTED: uncharacterized protein LOC103720...  87.0    2e-16   
ref|XP_008808813.1|  PREDICTED: uncharacterized protein LOC103720...  87.0    2e-16   Phoenix dactylifera
ref|XP_011073597.1|  PREDICTED: uncharacterized protein LOC105158512  86.3    2e-16   Sesamum indicum [beniseed]
dbj|BAJ87916.1|  predicted protein                                    86.3    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86815.1|  predicted protein                                    86.3    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011040295.1|  PREDICTED: uncharacterized protein LOC105136...  86.7    2e-16   Populus euphratica
ref|XP_011040297.1|  PREDICTED: uncharacterized protein LOC105136...  86.7    2e-16   Populus euphratica
dbj|BAJ53113.1|  JHL07K02.3                                           85.9    2e-16   Jatropha curcas
ref|XP_003574847.1|  PREDICTED: uncharacterized protein LOC100825330  85.5    4e-16   Brachypodium distachyon [annual false brome]
gb|EMS55330.1|  hypothetical protein TRIUR3_10894                     85.5    4e-16   Triticum urartu
ref|XP_004504713.1|  PREDICTED: uncharacterized protein LOC101499286  85.1    5e-16   Cicer arietinum [garbanzo]
gb|EYU24544.1|  hypothetical protein MIMGU_mgv1a007758mg              84.7    5e-16   Erythranthe guttata [common monkey flower]
gb|KEH31355.1|  stress up-regulated Nod 19 protein                    85.1    6e-16   Medicago truncatula
gb|KHG23950.1|  G2/mitotic-specific cyclin-B                          85.1    7e-16   Gossypium arboreum [tree cotton]
gb|KEH31354.1|  stress up-regulated Nod 19 protein                    84.0    7e-16   Medicago truncatula
gb|KHN39141.1|  hypothetical protein glysoja_027946                   85.9    8e-16   Glycine soja [wild soybean]
ref|XP_010668152.1|  PREDICTED: uncharacterized protein LOC104885143  84.3    8e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524108.1|  PREDICTED: uncharacterized protein LOC100785991  84.7    9e-16   Glycine max [soybeans]
gb|EMT11028.1|  hypothetical protein F775_20874                       84.7    9e-16   
gb|EMT06228.1|  hypothetical protein F775_26753                       84.3    1e-15   
gb|AAU14999.2|  MtN19-like protein                                    84.3    1e-15   Pisum sativum [garden pea]
gb|AES64800.2|  stress up-regulated Nod 19 protein                    85.5    1e-15   Medicago truncatula
gb|AFK39438.1|  unknown                                               80.9    1e-15   Medicago truncatula
ref|XP_009335863.1|  PREDICTED: uncharacterized protein LOC103928535  84.0    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_003594549.1|  MtN19 protein                                    85.5    1e-15   
gb|KHN25868.1|  hypothetical protein glysoja_018722                   84.0    1e-15   Glycine soja [wild soybean]
ref|NP_001240902.1|  uncharacterized protein LOC100784767 precursor   84.0    1e-15   Glycine max [soybeans]
ref|XP_011465272.1|  PREDICTED: uncharacterized protein LOC101300825  84.0    1e-15   Fragaria vesca subsp. vesca
gb|KEH31350.1|  stress up-regulated Nod 19 protein                    84.0    2e-15   Medicago truncatula
gb|EMS67414.1|  hypothetical protein TRIUR3_30255                     83.2    2e-15   Triticum urartu
ref|XP_011073598.1|  PREDICTED: uncharacterized protein LOC105158513  83.2    2e-15   Sesamum indicum [beniseed]
ref|XP_008367082.1|  PREDICTED: uncharacterized protein LOC103430711  83.2    2e-15   
ref|XP_009373664.1|  PREDICTED: uncharacterized protein LOC103962646  83.2    2e-15   
ref|XP_006659641.1|  PREDICTED: uncharacterized protein LOC102706312  82.8    4e-15   Oryza brachyantha
ref|XP_011073281.1|  PREDICTED: uncharacterized protein LOC105158280  83.2    4e-15   Sesamum indicum [beniseed]
ref|NP_001148097.1|  LOC100281705                                     80.9    4e-15   
gb|EMS67244.1|  hypothetical protein TRIUR3_19124                     82.8    4e-15   Triticum urartu
gb|EEC83958.1|  hypothetical protein OsI_30065                        82.8    4e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001062371.1|  Os08g0538600                                     82.8    4e-15   
ref|XP_002445785.1|  hypothetical protein SORBIDRAFT_07g025770        82.8    4e-15   Sorghum bicolor [broomcorn]
dbj|BAE71234.1|  hypothetical protein                                 82.4    4e-15   Trifolium pratense [peavine clover]
ref|XP_004974041.1|  PREDICTED: uncharacterized protein LOC101778...  82.4    6e-15   Setaria italica
ref|XP_003531077.1|  PREDICTED: uncharacterized protein LOC100803...  82.0    7e-15   
ref|XP_008453441.1|  PREDICTED: uncharacterized protein LOC103494146  80.1    8e-15   Cucumis melo [Oriental melon]
ref|XP_006374583.1|  hypothetical protein POPTR_0015s12020g           81.6    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004974037.1|  PREDICTED: uncharacterized protein LOC101776...  81.3    1e-14   Setaria italica
gb|KEH31351.1|  stress up-regulated Nod 19 protein                    80.9    1e-14   Medicago truncatula
gb|ACG30313.1|  mtN19-like protein                                    80.9    2e-14   Zea mays [maize]
tpg|DAA48291.1|  TPA: hypothetical protein ZEAMMB73_362863            80.9    2e-14   
tpg|DAA48290.1|  TPA: mtN19-like protein                              80.9    2e-14   
ref|NP_001148306.1|  mtN19-like protein precursor                     80.9    2e-14   
gb|KEH26244.1|  stress up-regulated Nod 19 protein                    80.9    2e-14   Medicago truncatula
gb|AFK43962.1|  unknown                                               80.9    2e-14   Medicago truncatula
ref|XP_011465273.1|  PREDICTED: uncharacterized protein LOC101300539  80.5    2e-14   Fragaria vesca subsp. vesca
gb|ACJ85863.1|  unknown                                               80.5    3e-14   Medicago truncatula
ref|XP_007158977.1|  hypothetical protein PHAVU_002G197800g           80.5    3e-14   Phaseolus vulgaris [French bean]
gb|KEH31348.1|  stress up-regulated Nod 19 protein                    80.5    3e-14   Medicago truncatula
gb|ACJ85534.1|  unknown                                               80.1    3e-14   Medicago truncatula
ref|XP_007158975.1|  hypothetical protein PHAVU_002G197800g           80.1    3e-14   Phaseolus vulgaris [French bean]
gb|AGV54779.1|  MtN19-like protein                                    80.1    3e-14   Phaseolus vulgaris [French bean]
ref|XP_003594550.1|  MtN19 protein                                    79.7    3e-14   
gb|KHN25867.1|  hypothetical protein glysoja_018721                   76.6    7e-14   Glycine soja [wild soybean]
gb|KHN14319.1|  hypothetical protein glysoja_012357                   75.5    7e-14   Glycine soja [wild soybean]
ref|XP_008453438.1|  PREDICTED: uncharacterized protein LOC103494145  79.0    8e-14   Cucumis melo [Oriental melon]
ref|XP_009360277.1|  PREDICTED: uncharacterized protein LOC103950768  78.2    1e-13   Pyrus x bretschneideri [bai li]
gb|KEH26246.1|  stress up-regulated Nod 19 protein                    78.6    1e-13   Medicago truncatula
ref|XP_003546270.2|  PREDICTED: uncharacterized protein LOC100815629  79.3    1e-13   
gb|AFK45617.1|  unknown                                               78.2    1e-13   Medicago truncatula
ref|XP_007147472.1|  hypothetical protein PHAVU_006G127400g           77.8    2e-13   Phaseolus vulgaris [French bean]
ref|XP_007147471.1|  hypothetical protein PHAVU_006G127300g           77.8    2e-13   Phaseolus vulgaris [French bean]
gb|KJB07929.1|  hypothetical protein B456_001G053600                  77.0    3e-13   Gossypium raimondii
ref|XP_006586844.1|  PREDICTED: uncharacterized protein LOC100791925  77.0    3e-13   Glycine max [soybeans]
ref|XP_004974040.1|  PREDICTED: uncharacterized protein LOC101777764  77.4    3e-13   Setaria italica
ref|XP_004160448.1|  PREDICTED: uncharacterized protein LOC101226527  76.6    6e-13   
gb|KGN63844.1|  hypothetical protein Csa_1G024275                     76.6    6e-13   Cucumis sativus [cucumbers]
ref|XP_008375421.1|  PREDICTED: uncharacterized protein LOC103438661  75.9    8e-13   Malus domestica [apple tree]
gb|KEH41600.1|  stress up-regulated Nod 19 protein                    75.9    9e-13   Medicago truncatula
gb|ACU22964.1|  unknown                                               75.5    1e-12   Glycine max [soybeans]
gb|KEH16840.1|  stress up-regulated Nod 19 protein                    74.7    2e-12   Medicago truncatula
emb|CDY71894.1|  BnaCnng74970D                                        72.4    2e-12   Brassica napus [oilseed rape]
ref|XP_004974890.1|  PREDICTED: uncharacterized protein LOC101770076  74.7    2e-12   Setaria italica
ref|XP_006844651.1|  hypothetical protein AMTR_s00016p00236400        73.2    6e-12   
emb|CDY53158.1|  BnaCnng24580D                                        73.6    7e-12   Brassica napus [oilseed rape]
ref|XP_004160447.1|  PREDICTED: uncharacterized protein LOC101226295  70.9    8e-12   
ref|XP_006394466.1|  hypothetical protein EUTSA_v10004123mg           72.8    1e-11   
ref|XP_010546109.1|  PREDICTED: uncharacterized protein LOC104818287  72.4    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_008453443.1|  PREDICTED: uncharacterized protein LOC103494148  72.0    2e-11   Cucumis melo [Oriental melon]
ref|XP_006394469.1|  hypothetical protein EUTSA_v10004141mg           72.0    2e-11   Eutrema salsugineum [saltwater cress]
emb|CAA75589.1|  MtN19                                                71.6    2e-11   Medicago truncatula
gb|KGN43818.1|  hypothetical protein Csa_7G069440                     71.6    3e-11   Cucumis sativus [cucumbers]
ref|XP_004163909.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  71.2    3e-11   
emb|CDY71873.1|  BnaCnng74880D                                        68.6    3e-11   Brassica napus [oilseed rape]
ref|XP_002960633.1|  hypothetical protein SELMODRAFT_437681           70.1    8e-11   
ref|XP_002983409.1|  hypothetical protein SELMODRAFT_118146           69.7    9e-11   
ref|XP_008455078.1|  PREDICTED: uncharacterized protein LOC103495342  70.1    9e-11   Cucumis melo [Oriental melon]
ref|XP_002960630.1|  hypothetical protein SELMODRAFT_75188            69.3    1e-10   
ref|XP_002983406.1|  hypothetical protein SELMODRAFT_422686           69.3    1e-10   Selaginella moellendorffii
ref|XP_002960632.1|  hypothetical protein SELMODRAFT_437681           69.3    2e-10   Selaginella moellendorffii
ref|XP_006844648.1|  hypothetical protein AMTR_s00016p00235580        69.3    2e-10   Amborella trichopoda
ref|XP_002983404.1|  hypothetical protein SELMODRAFT_43474            68.2    3e-10   
ref|XP_010457791.1|  PREDICTED: uncharacterized protein LOC104739210  68.6    3e-10   
emb|CDY42880.1|  BnaAnng07050D                                        64.3    4e-10   Brassica napus [oilseed rape]
ref|XP_010444016.1|  PREDICTED: uncharacterized protein LOC104726775  65.1    4e-10   Camelina sativa [gold-of-pleasure]
ref|NP_200990.2|  uncharacterized protein                             67.8    5e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAL91170.1|  putative protein                                      67.8    5e-10   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI63593.1|  MtN19 protein                                        67.8    5e-10   Lotus japonicus
ref|XP_009130176.1|  PREDICTED: uncharacterized protein LOC103854962  67.8    5e-10   Brassica rapa
ref|XP_002960631.1|  hypothetical protein SELMODRAFT_270236           67.4    7e-10   
ref|XP_004137076.1|  PREDICTED: uncharacterized protein LOC101210001  67.4    8e-10   
dbj|BAB10082.1|  MtN19-like protein                                   67.4    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457823.1|  PREDICTED: uncharacterized protein LOC104739234  66.6    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009150119.1|  PREDICTED: uncharacterized protein LOC103873465  66.6    1e-09   Brassica rapa
ref|XP_002983407.1|  hypothetical protein SELMODRAFT_118200           66.2    2e-09   
ref|XP_008453444.1|  PREDICTED: uncharacterized protein LOC103494150  65.9    2e-09   Cucumis melo [Oriental melon]
ref|XP_010444012.1|  PREDICTED: uncharacterized protein LOC104726772  65.9    2e-09   
ref|XP_006279767.1|  hypothetical protein CARUB_v10027779mg           65.9    3e-09   Capsella rubella
ref|XP_004137324.1|  PREDICTED: uncharacterized protein LOC101215981  65.5    3e-09   Cucumis sativus [cucumbers]
ref|XP_004160434.1|  PREDICTED: uncharacterized protein LOC101223324  65.1    3e-09   
ref|XP_010483864.1|  PREDICTED: uncharacterized protein LOC104762...  65.1    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010477840.1|  PREDICTED: uncharacterized protein LOC104756879  65.1    5e-09   
ref|XP_010457781.1|  PREDICTED: uncharacterized protein LOC104739202  64.7    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004513390.1|  PREDICTED: uncharacterized protein LOC101513345  64.3    6e-09   
ref|XP_004497967.1|  PREDICTED: uncharacterized protein LOC101492762  64.7    7e-09   
ref|XP_010483862.1|  PREDICTED: uncharacterized protein LOC104762299  64.3    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010483865.1|  PREDICTED: uncharacterized protein LOC104762...  63.9    8e-09   
gb|AFK34663.1|  unknown                                               63.5    1e-08   Medicago truncatula
ref|XP_003594548.1|  MtN19 protein                                    63.5    1e-08   
gb|AES64799.2|  stress up-regulated Nod 19 protein                    63.5    1e-08   Medicago truncatula
ref|XP_002866457.1|  hypothetical protein ARALYDRAFT_496351           63.5    1e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_004510129.1|  PREDICTED: uncharacterized protein LOC101508405  63.2    2e-08   
ref|XP_007134081.1|  hypothetical protein PHAVU_010G017900g           63.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_007134079.1|  hypothetical protein PHAVU_010G0178001g          60.1    2e-08   Phaseolus vulgaris [French bean]
ref|XP_007134300.1|  hypothetical protein PHAVU_010G035700g           62.8    2e-08   Phaseolus vulgaris [French bean]
ref|XP_006579112.1|  PREDICTED: uncharacterized protein LOC100799740  62.4    3e-08   
gb|KHN44115.1|  hypothetical protein glysoja_039253                   59.3    3e-08   Glycine soja [wild soybean]
ref|XP_007134075.1|  hypothetical protein PHAVU_010G017500g           62.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_007132991.1|  hypothetical protein PHAVU_011G142100g           62.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_007134138.1|  hypothetical protein PHAVU_010G022500g           62.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_007137902.1|  hypothetical protein PHAVU_009G165400g           62.0    4e-08   Phaseolus vulgaris [French bean]
ref|XP_006574192.1|  PREDICTED: uncharacterized protein LOC100820275  62.4    4e-08   
ref|XP_006574191.1|  PREDICTED: uncharacterized protein LOC100818138  60.8    5e-08   
gb|KHN44114.1|  hypothetical protein glysoja_039252                   61.2    6e-08   Glycine soja [wild soybean]
ref|XP_007134084.1|  hypothetical protein PHAVU_010G018100g           61.2    6e-08   Phaseolus vulgaris [French bean]
ref|XP_010444011.1|  PREDICTED: uncharacterized protein LOC104726771  61.6    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007134136.1|  hypothetical protein PHAVU_010G022300g           61.2    8e-08   Phaseolus vulgaris [French bean]
ref|XP_007133892.1|  hypothetical protein PHAVU_010G000800g           60.8    9e-08   Phaseolus vulgaris [French bean]
ref|XP_006577651.1|  PREDICTED: uncharacterized protein LOC100806449  60.5    1e-07   
ref|XP_004506757.1|  PREDICTED: uncharacterized protein LOC101509765  60.5    1e-07   
ref|XP_006280401.1|  hypothetical protein CARUB_v10026327mg           60.5    1e-07   Capsella rubella
gb|KHN18974.1|  hypothetical protein glysoja_039898                   60.1    2e-07   Glycine soja [wild soybean]
ref|XP_004497966.1|  PREDICTED: uncharacterized protein LOC101492429  60.1    2e-07   Cicer arietinum [garbanzo]
ref|XP_007134296.1|  hypothetical protein PHAVU_010G0353000g          56.2    2e-07   Phaseolus vulgaris [French bean]
ref|XP_006577556.1|  PREDICTED: uncharacterized protein LOC102664794  59.3    3e-07   
gb|KHN15503.1|  hypothetical protein glysoja_049065                   59.3    3e-07   Glycine soja [wild soybean]
ref|XP_006577555.1|  PREDICTED: uncharacterized protein LOC102664678  58.9    4e-07   
ref|XP_003522144.2|  PREDICTED: uncharacterized protein LOC100792489  59.3    4e-07   Glycine max [soybeans]
ref|XP_010457757.1|  PREDICTED: uncharacterized protein LOC104739180  58.5    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006574193.1|  PREDICTED: uncharacterized protein LOC102666323  57.0    1e-06   
gb|KHN17845.1|  hypothetical protein glysoja_047764                   57.8    1e-06   Glycine soja [wild soybean]
ref|XP_006577472.1|  PREDICTED: uncharacterized protein LOC100779893  53.1    8e-06   
gb|KHN42509.1|  hypothetical protein glysoja_031445                   52.8    9e-06   Glycine soja [wild soybean]
ref|XP_004512657.1|  PREDICTED: uncharacterized protein LOC101515735  54.3    1e-05   Cicer arietinum [garbanzo]
gb|EJK60813.1|  hypothetical protein THAOC_18774                      54.3    2e-05   Thalassiosira oceanica



>ref|XP_009610723.1| PREDICTED: uncharacterized protein LOC104104364 [Nicotiana tomentosiformis]
Length=466

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG++KI++GE++T++SNYSS Q HTGVMGLFY+LVA+P P   SFL S 
Sbjct  360  YIVGMSSCYPRPGSIKISEGETVTLISNYSSAQRHTGVMGLFYLLVAEPSPTPNSFLHSA  419

Query  413  IKGGEMMILPNAILILAFVGIAVL-GVAVIMSRRRGERENDYEPIVM  276
               GE++IL NA+ +LA  GIA+L G AVI  RR    E  YE ++M
Sbjct  420  DGTGEIVILHNAVGVLAVFGIALLVGAAVIYQRRNQREEEGYESVLM  466



>ref|XP_009786123.1| PREDICTED: uncharacterized protein LOC104234287 [Nicotiana sylvestris]
Length=466

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG++KI++GE++T++SNYSS Q HTGVMGLFY+LV +P P   SFL S 
Sbjct  360  YIVGMSSCYPKPGSIKISEGETVTLISNYSSAQRHTGVMGLFYLLVTEPSPTPNSFLHST  419

Query  413  IKGGEMMILPNAILILAFVGIAVL-GVAVIMSRRRGERENDYEPIVM  276
               GE++IL NA+ +LA  GIAVL G AVI  RR    E  YE ++M
Sbjct  420  DGTGEIVILHNAVGVLAVFGIAVLVGAAVIYQRRNQREEEGYESVLM  466



>ref|XP_006346625.1| PREDICTED: uncharacterized protein LOC102590754 [Solanum tuberosum]
Length=463

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG++KI++GE++T++SNYS+ Q HTGVMGLFY+LVA+P P+  S L S 
Sbjct  356  YIVGMSTCYPRPGSIKISEGETVTLLSNYSNAQRHTGVMGLFYLLVAEPSPKPNSILHST  415

Query  413  IKGGEMMILPNAILILAFV-GIAVL-GVAVIMSRRRGERENDYEPIVM  276
             + GE++IL NAI  LA V GIA+L G AVI  RR    +  YE I+M
Sbjct  416  DETGEIVILQNAIGALAAVFGIALLVGAAVIYQRRNQRDQEGYESILM  463



>ref|XP_006346626.1| PREDICTED: uncharacterized protein LOC102591330 [Solanum tuberosum]
Length=471

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG++KI++GE++T++SNYS+ Q HTGVMGLFY+LVA+P P+  S L S 
Sbjct  364  YIVGMSTCYPRPGSIKISEGETVTLLSNYSNAQRHTGVMGLFYLLVAEPSPKPNSILHST  423

Query  413  IKGGEMMILPNAILILAFV-GIAVL-GVAVIMSRRRGERENDYEPIVM  276
             + GE++IL NAI  LA V GIA+L G AVI  RR    +  YE I+M
Sbjct  424  DETGEIVILQNAIGALAAVFGIALLVGAAVIYQRRNQRDQEGYESILM  471



>dbj|BAF47117.1| MtN19 like protein [Nicotiana tabacum]
Length=118

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG++KI++GE++T++SNYSS Q HTGVMGLFY+LVA+P P   SFL S 
Sbjct  31   YIVGMSSCYPRPGSIKISEGETVTLISNYSSAQRHTGVMGLFYLLVAEPSPTPNSFLHST  90

Query  413  IKGGEMMILPNAILILAFVGIAVL  342
               GE++IL NA+ +LA  GIA+L
Sbjct  91   DGTGEIVILHNAVGVLAVFGIALL  114



>ref|XP_004252289.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
 ref|XP_010314239.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
Length=462

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG++KI+ GE++T++SNYS+ Q HTGVMGLFY+LVA+P P+  S L S 
Sbjct  356  YIVGMSSCYPRPGSIKISAGETVTLLSNYSNAQRHTGVMGLFYLLVAEPSPKPNSILHST  415

Query  413  IKGGEMMILPNAILILAFVGIA-VLGVAVIMSRRRGERENDYEPIVM  276
             + GE++IL +AI  LA  GIA V+G AVI  RR    +  YE I++
Sbjct  416  DETGEIVILQSAIGALAVFGIALVVGAAVIYQRRNQRDQEGYESILI  462



>ref|XP_006368006.1| PREDICTED: uncharacterized protein LOC102587597 [Solanum tuberosum]
Length=458

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI++GE+LT++SNYSS Q HTGVMGLFYILV+    +S S L S+
Sbjct  356  YIVGMSTCYPRPGSVKISEGETLTLLSNYSSDQRHTGVMGLFYILVSG---QSSSILHSR  412

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
               G+++IL NA+L LA  GIA L  A +  + + ERE   E I+M
Sbjct  413  DNMGDIVILHNAVLALAGFGIAALVAATVSYQHQSEREEGCESILM  458



>ref|XP_004242193.1| PREDICTED: uncharacterized protein LOC101264834 [Solanum lycopersicum]
Length=465

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG+VKI+ GE+LT++SNYS  Q HTGVMGLFY+LVA+   +S S L S+
Sbjct  360  YIVGMSSCYPRPGSVKISKGETLTLLSNYSCDQRHTGVMGLFYLLVAEMSRQSSSILHSK  419

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
               G+++IL NA+  LA  GIA L  A +  + + ERE   E I+M
Sbjct  420  DNIGDIVILHNAVWALAGFGIAALVAATVTYQHQSEREEGCESILM  465



>ref|XP_009802236.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802237.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802238.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802239.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802240.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
Length=473

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI++GE+LT+VS YSS Q HTGVMGLFYILVA+P  + RS L S 
Sbjct  359  YIVGMSTCYPKPGSVKISNGETLTLVSKYSSAQRHTGVMGLFYILVAEPPHKPRSILHST  418

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYE  288
               GE++IL NA+  +A  GIA +  A +  +R+  RE  YE
Sbjct  419  DSTGEIVILHNAVRAIAGFGIAAVVAAAVTFQRQSGREEGYE  460



>ref|XP_009596902.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596903.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596904.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
Length=457

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI+ GE+LT VS YSS Q HTGVMGLFYILVA+P  +  S L S 
Sbjct  356  YIVGMSTCYPKPGSVKISKGETLTFVSKYSSAQRHTGVMGLFYILVAEPSQKRSSILHST  415

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERE  300
               GE++IL NA+  +A  GIA L  A   +  + ER+
Sbjct  416  DSTGEIVILHNAVWAIAGFGIAALVAACSCNFSKSERK  453



>emb|CDO98292.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR--SFLR  420
            YIVGM+TCYPQPG+VKI++GE+LT+ S YSS Q HTGVMGLFYILVAD    ++  S   
Sbjct  357  YIVGMSTCYPQPGSVKISNGETLTVKSYYSSEQGHTGVMGLFYILVADSDSSAKLNSSQH  416

Query  419  SQIKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            + +   + ++  + I+ +A +GIAVL   ++  +RR +R ++YEPI M
Sbjct  417  APVGIHKRVLTLDFIVGMALLGIAVLAAVIVAYQRRNQRGDNYEPITM  464



>ref|XP_006346659.1| PREDICTED: uncharacterized protein LOC102603832 [Solanum tuberosum]
Length=468

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++ YP+PG++KI++GE++T++SNYS+ Q  TGV+GLFY+LVA+P P+  S L S 
Sbjct  362  YIVGMSSFYPRPGSIKISEGETITLLSNYSNDQRQTGVLGLFYLLVAEPSPKPNSILHSA  421

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGEREND-YEPIVM  276
               GE++IL NAI  LA  GIA+L  A ++ + R +R+ + YE I+M
Sbjct  422  DGTGEIVILQNAIGALAVFGIALLLGADVIYQCRNQRDQEGYESILM  468



>ref|XP_006376936.1| hypothetical protein POPTR_0012s11240g, partial [Populus trichocarpa]
 gb|ERP54733.1| hypothetical protein POPTR_0012s11240g, partial [Populus trichocarpa]
Length=182

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FY+LVA+  P   +FL S 
Sbjct  77   YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYVLVAERTPNPTNFLHSP  136

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ V +    ++G RE  YEPI+
Sbjct  137  IHIHEKMKVSTSALAIVALLGLAVVAVGLRYRLKKG-REEGYEPIM  181



>ref|XP_011043019.1| PREDICTED: uncharacterized protein LOC105138584 isoform X2 [Populus 
euphratica]
Length=155

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FYILVA+  P   +FL S 
Sbjct  50   YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYILVAERTPNPTNFLHSP  109

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ V +    ++G RE  Y+PI+
Sbjct  110  IHIHEKMKVSASALAIVALLGLAVVAVGLRYRLKKG-REEGYQPIM  154



>ref|XP_011043018.1| PREDICTED: uncharacterized protein LOC105138584 isoform X1 [Populus 
euphratica]
Length=177

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FYILVA+  P   +FL S 
Sbjct  72   YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYILVAERTPNPTNFLHSP  131

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ V +    ++G RE  Y+PI+
Sbjct  132  IHIHEKMKVSASALAIVALLGLAVVAVGLRYRLKKG-REEGYQPIM  176



>gb|KDO37888.1| hypothetical protein CISIN_1g033184mg [Citrus sinensis]
Length=125

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG ++I D E+L + SNYSS   HTGVMGLFYILVAD VPES SFL   
Sbjct  20   YIVGMSTCYPKPGFLRITDKETLIVESNYSSSHDHTGVMGLFYILVADRVPESSSFLDVF  79

Query  413  IKGGEMMILPNAILILAFV--GIAVLGVAVIMSRRRGERENDYEPIVM  276
             K     I  +A +  AFV  G+A+   AV   RR  + E+ Y+PI++
Sbjct  80   NKMYN-DINHSAFVWGAFVLAGVAITAAAVGYWRRN-KYEDGYQPIMI  125



>emb|CBI15775.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYPQPG+VKI+DGE+L + SNYSS Q HTGVMGLFYILVA+P P     L S 
Sbjct  121  YIVGMSTCYPQPGSVKISDGETLILESNYSSTQKHTGVMGLFYILVAEPSPNPSLLLHSP  180

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
                    + N++  +A +G+A+    V++ RRR E E  YE +V+
Sbjct  181  FDMHANSKVYNSVSAVALLGLAIAAAIVVVYRRRKETEYGYEALVV  226



>gb|KDO57643.1| hypothetical protein CISIN_1g041033mg, partial [Citrus sinensis]
Length=118

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I DGE+L + S+YSS + HTGVMGLFYILVAD VPES SFL   
Sbjct  13   YIVGMSTCYPKPGSLRITDGETLIVESSYSSSREHTGVMGLFYILVADRVPESSSFL-DV  71

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS-RRRGERENDYEPIVM  276
                +  I  +A +  AFV   V  +A  +  RRR + E+ Y+PI++
Sbjct  72   FNKMDSDINHSAFVWGAFVLAGVAVIAAAVGYRRRNKYEDGYQPIMI  118



>ref|XP_006374581.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
 gb|ERP52378.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
Length=466

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I  GE+L + SNY+S Q HTGVMGLFYILVAD  P   +FL S 
Sbjct  360  YIVGMSTCYPEPGSIQITAGENLLLESNYNSTQKHTGVMGLFYILVADRTPNPTNFLHSP  419

Query  413  IK-GGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I     + +   A+ I+A  G+A+     ++SR +  RE  Y+PI+
Sbjct  420  IHIHKNIKVSTPAVAIVALFGLAMAIAVGLLSRMKKGREEGYQPIM  465



>ref|XP_007038175.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22676.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
Length=544

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYPQPGTVKI+ GE+L + SNYSS   HTGVMGLFYILVAD +P+    LR  
Sbjct  438  YIVGMSTCYPQPGTVKISKGETLILESNYSSIGHHTGVMGLFYILVADALPKPMRTLRVV  497

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS-----RRRGERENDYEPIVM  276
            ++  + +IL    L + +  +A++GV  +++     + + ERE+ YE I+M
Sbjct  498  VQTQDSIIL----LTILWAAVALMGVVTVVAVAIRYQLKHEREDGYEAIMM  544



>emb|CDO98291.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG++KI+ GESLT+VSNYS+ Q HTGVMGLFYILVAD  P+  S   + 
Sbjct  411  YIVGMSTCYPKPGSIKISSGESLTLVSNYSNAQRHTGVMGLFYILVAD--PDQHSPNATS  468

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
                    LP+ + ++  +  A L +A++++ RR  R++ YE I 
Sbjct  469  APHASKTRLPHYVWVVILLFQAALVLALVITYRRKCRKSGYESIA  513



>ref|XP_002284739.2| PREDICTED: uncharacterized protein LOC100243857 isoform X1 [Vitis 
vinifera]
Length=465

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYPQPG+VKI+DGE+L + SNYSS Q HTGVMGLFYILVA+P P     L S 
Sbjct  360  YIVGMSTCYPQPGSVKISDGETLILESNYSSTQKHTGVMGLFYILVAEPSPNPSLLLHSP  419

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
                    + N++  +A +G+A+    V++ RRR E E  YE +V+
Sbjct  420  FDMHANSKVYNSVSAVALLGLAIAAAIVVVYRRRKETEYGYEALVV  465



>ref|XP_007038174.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22675.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
Length=570

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYPQPGTVKI+ GE+L + SNYSS   HTGVMGLFYILVAD +P+    LR  
Sbjct  464  YIVGMSTCYPQPGTVKISKGETLILESNYSSIGHHTGVMGLFYILVADALPKPMRTLRVV  523

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS-----RRRGERENDYEPIVM  276
            ++  + +IL    L + +  +A++GV  +++     + + ERE+ YE I+M
Sbjct  524  VQTQDSIIL----LTILWAAVALMGVVTVVAVAIRYQLKHEREDGYEAIMM  570



>ref|XP_011016694.1| PREDICTED: uncharacterized protein LOC105120200 [Populus euphratica]
Length=467

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FYILVA+  P   +FL S 
Sbjct  362  YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYILVAERTPNPTNFLHSP  421

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ V +    ++G RE  Y+PI+
Sbjct  422  IHIHEKMKVSASALAIVALLGLAVVAVGLRYRLKKG-REEGYQPIM  466



>ref|XP_011003519.1| PREDICTED: uncharacterized protein LOC105110237 [Populus euphratica]
Length=467

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FYILVA+  P   +FL S 
Sbjct  362  YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYILVAERTPNPTNFLHSP  421

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ V +    ++G RE  Y+PI+
Sbjct  422  IHIHEKMKVSASALAIVALLGLAVVAVGLRYRLKKG-REEGYQPIM  466



>ref|XP_006376935.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
 gb|ERP54732.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
Length=467

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP+PG+++I  GE+L + S YSS Q HTGVMG+FY+LVA+  P   +FL S 
Sbjct  362  YVVGMSTCYPEPGSIQITAGENLVLESYYSSTQKHTGVMGIFYVLVAERTPNPTNFLHSP  421

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I   E M +  +A+ I+A +G+AV+ + +    ++G RE  YEPI+
Sbjct  422  IHIHEKMKVSASALAIVALLGLAVVALGLRHRLKKG-REEGYEPIM  466



>ref|XP_009411808.1| PREDICTED: uncharacterized protein LOC103993457 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 6/109 (6%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+V++ DGE LT+ SNYSS+Q+HTGVMGLFY+LVA+ VP+S++ L   
Sbjct  357  YIVGMSTCYPKPGSVQVVDGEMLTLESNYSSNQAHTGVMGLFYVLVAEAVPKSKTMLFLS  416

Query  413  IKGGEMMILPNAILILAFVG---IAVLGVAVIMSRRRGERENDYEPIVM  276
              G   + L          G    A+ G++ +   +RG R+  Y+P+V+
Sbjct  417  FPGSLDLGLTKHTWSFVLAGGMLTAIFGISYLC--KRGRRK-PYQPLVL  462



>ref|XP_002511073.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51675.1| conserved hypothetical protein [Ricinus communis]
Length=463

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 5/108 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG++KIADGE+L + S YS  Q HTGVMGLFYILVAD VPE   F+ S 
Sbjct  357  YIVGMSTCYPKPGSIKIADGENLILESRYSRAQEHTGVMGLFYILVADRVPERMPFIESL  416

Query  413  IKGGEMMILPNA--ILILAFVGIA-VLGVAVIMSRRRGERENDYEPIV  279
            +   E M  P+A    I+  +G+A  L VAV    ++G +++ Y+PI+
Sbjct  417  VYVHENM-EPSAYRWAIVVLLGLATTLAVAVGSWLKKG-KDDGYQPIL  462



>ref|XP_011040291.1| PREDICTED: uncharacterized protein LOC105136589 [Populus euphratica]
Length=466

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I  GE+L + SNY+S Q HTGVMGLFYILV D  P   +FL S 
Sbjct  360  YIVGMSTCYPEPGSIQITAGENLLLESNYNSTQKHTGVMGLFYILVEDRTPNPTNFLPSP  419

Query  413  IK-GGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I     + +   A+ I+A  G+A+     ++SR +  RE  Y+PI+
Sbjct  420  IHIHKNIKVSTPAVAIVALFGLAMAIAVGLLSRMKKGREEGYQPIM  465



>ref|XP_002321764.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
 gb|EEF05891.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
Length=466

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I  GE L + SNYS  Q+HTGVMGLFYILVAD  P   S L + 
Sbjct  360  YIVGMSTCYPEPGSIQITAGEKLVLESNYSRDQNHTGVMGLFYILVADRTPNPTSLLHAP  419

Query  413  IKGG-EMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I     M     A+ I+A  G+A+     + SR +  RE  Y+P++
Sbjct  420  IHMHVNMKGSTYAVAIIALFGMAIAVAVTVHSRLKKGREEGYQPML  465



>ref|XP_010255828.1| PREDICTED: uncharacterized protein LOC104596392 isoform X3 [Nelumbo 
nucifera]
Length=465

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+ CYP PG+V+++ GE+LT+ SNYSS Q HTGVMGLFYILVADP PES   L++ 
Sbjct  362  YIVGMSACYPHPGSVQVSSGETLTLESNYSSTQKHTGVMGLFYILVADPPPESMLLLQNS  421

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            +   E M        L  +G  V  +  +    R +RE  Y+ +V+
Sbjct  422  VH--ESMRFSKYSWGLLAIGAVVAFIVGVGYYSRNKREEQYQSLVI  465



>ref|XP_010255827.1| PREDICTED: uncharacterized protein LOC104596392 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+ CYP PG+V+++ GE+LT+ SNYSS Q HTGVMGLFYILVADP PES   L++ 
Sbjct  440  YIVGMSACYPHPGSVQVSSGETLTLESNYSSTQKHTGVMGLFYILVADPPPESMLLLQNS  499

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            +   E M        L  +G  V  +  +    R +RE  Y+ +V+
Sbjct  500  VH--ESMRFSKYSWGLLAIGAVVAFIVGVGYYSRNKREEQYQSLVI  543



>ref|XP_010255826.1| PREDICTED: uncharacterized protein LOC104596392 isoform X1 [Nelumbo 
nucifera]
Length=574

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+ CYP PG+V+++ GE+LT+ SNYSS Q HTGVMGLFYILVADP PES   L++ 
Sbjct  471  YIVGMSACYPHPGSVQVSSGETLTLESNYSSTQKHTGVMGLFYILVADPPPESMLLLQNS  530

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            +   E M        L  +G  V  +  +    R +RE  Y+ +V+
Sbjct  531  VH--ESMRFSKYSWGLLAIGAVVAFIVGVGYYSRNKREEQYQSLVI  574



>ref|XP_010036842.1| PREDICTED: uncharacterized protein LOC104425754 [Eucalyptus grandis]
 gb|KCW48501.1| hypothetical protein EUGRSUZ_K02186 [Eucalyptus grandis]
Length=460

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 10/107 (9%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI DGE L + SNYS  Q+HTGVMGLFY+LVA  +P S    R+ 
Sbjct  361  YIVGMSTCYPRPGSVKINDGEILVLESNYSKSQNHTGVMGLFYLLVARDLPSSVQMQRN-  419

Query  413  IKGGEMMILPN-AILILAFVGIAVLGVAVIMS-RRRGERENDYEPIV  279
                  M LP+    IL F+G+ V+ +AV +S +RR +RE  YE ++
Sbjct  420  ------MALPHFGGAILTFLGV-VIAIAVGISLKRRKQREEGYESLM  459



>ref|XP_006485063.1| PREDICTED: uncharacterized protein LOC102618549 [Citrus sinensis]
Length=462

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I DGE+L + S+YSS + HTGVMGLFYILVAD VPES SFL   
Sbjct  357  YIVGMSTCYPKPGSLRITDGETLIVESSYSSSREHTGVMGLFYILVADRVPESSSFL-DV  415

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS-RRRGERENDYEPIVM  276
                +  I  +A +  AFV   V  +A  +  RRR + E+ Y+PI++
Sbjct  416  FNKMDSDINHSAFVWGAFVLAGVAVIAAAVGYRRRNKYEDGYQPIMI  462



>ref|XP_006436986.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 ref|XP_006436987.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50226.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50227.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
Length=462

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I DGE+L + S+YSS + HTGVMGLFYILVAD VPES SFL   
Sbjct  357  YIVGMSTCYPKPGSLRITDGETLIVESSYSSSREHTGVMGLFYILVADRVPESSSFL-DV  415

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS-RRRGERENDYEPIVM  276
                +  I  +A +  AFV   V  +A  +  RRR + E+ Y+PI++
Sbjct  416  FNKMDSDINHSAFVWGAFVLAGVAVIAAAVGYRRRNKYEDGYQPIMI  462



>gb|EYU21767.1| hypothetical protein MIMGU_mgv1a005580mg [Erythranthe guttata]
Length=478

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 11/116 (9%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP PG+VKI+DGE+LT+VSNYSS Q+HTGVMGLFY+LV+D  PE  + ++S 
Sbjct  362  YIVGMSTCYPSPGSVKISDGETLTLVSNYSSTQTHTGVMGLFYLLVSDSSPERDNLVQSY  421

Query  413  IKGGEMMILPNAILILAFV---------GIAVLGVAVIMSRR--RGERENDYEPIV  279
                       +     FV          ++ L +AV+   R   G R   YEPI+
Sbjct  422  PAQENHKSSTKSNFNWGFVLFGVGLVSVVVSALSIAVVSLLRGTSGRRNEGYEPII  477



>ref|XP_006436984.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 ref|XP_006436985.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50224.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50225.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
Length=462

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 12/112 (11%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG ++I D E+L + SNYSS + HTGVMGLFYILVAD VPES SFL   
Sbjct  357  YIVGMSTCYPKPGFLRITDKETLIVESNYSSSRDHTGVMGLFYILVADRVPESSSFLDVF  416

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS------RRRGERENDYEPIVM  276
             K      + N I   AFV  A +   V +       RRR + E+ Y+PI++
Sbjct  417  SK------MYNDINHSAFVWGAFVLAGVAVIAAAVGYRRRNKYEDGYQPIMI  462



>ref|XP_011040294.1| PREDICTED: uncharacterized protein LOC105136594 [Populus euphratica]
Length=466

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+++I  GE L + SNYS  Q+HTGVMGLFY+LVAD  P   S L++ 
Sbjct  360  YIVGMSTCYPEPGSIQITAGEKLVLESNYSRDQNHTGVMGLFYMLVADRTPNPTSLLQAP  419

Query  413  IKGG-EMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
            I     M     A+ I+A  G+A+     + SR +  R   Y+P++
Sbjct  420  IHMHVNMKGSTYAVAIIALFGMAIAVAVTVHSRLKKGRGEGYQPML  465



>ref|XP_011073280.1| PREDICTED: uncharacterized protein LOC105158279 [Sesamum indicum]
Length=457

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP PG+VKIA GE+LT+VSNYSS Q HTGVMGLFY+L++D   +  + L + 
Sbjct  352  YIVGMSTCYPSPGSVKIAAGETLTLVSNYSSSQRHTGVMGLFYLLISDSSAKPDAVLHAP  411

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIV  279
             +  +  ++ ++   +A  G+ ++ +A+ +     +R + Y  I 
Sbjct  412  AEAHKSRMISDSDWAVALFGVGLVVLAIFVFYGNSKRGDGYGAIT  456



>gb|KJB53255.1| hypothetical protein B456_008G211400 [Gossypium raimondii]
 gb|KJB53259.1| hypothetical protein B456_008G211400 [Gossypium raimondii]
Length=465

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I++GE+L +  NYS  + HTGVMGLFYILVAD +P+    LR+ 
Sbjct  361  YIVGMTTCYPKPGTVEISEGETLILEFNYSRIRHHTGVMGLFYILVADDLPKPMHTLRTV  420

Query  413  IKGGEMMILPNAILILAFVG-IAVLGVAVIMSRRRGERENDYEPIVM  276
            ++   +M++      +A +G +AV+ +AV    +R E E+ YE I M
Sbjct  421  VQ-DSIMVVTVLWAAVALIGVVAVIALAVHYQFKR-EGEDGYEAIGM  465



>gb|KJB53254.1| hypothetical protein B456_008G211400 [Gossypium raimondii]
Length=467

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I++GE+L +  NYS  + HTGVMGLFYILVAD +P+    LR+ 
Sbjct  363  YIVGMTTCYPKPGTVEISEGETLILEFNYSRIRHHTGVMGLFYILVADDLPKPMHTLRTV  422

Query  413  IKGGEMMILPNAILILAFVG-IAVLGVAVIMSRRRGERENDYEPIVM  276
            ++   +M++      +A +G +AV+ +AV    +R E E+ YE I M
Sbjct  423  VQ-DSIMVVTVLWAAVALIGVVAVIALAVHYQFKR-EGEDGYEAIGM  467



>ref|XP_009373663.1| PREDICTED: uncharacterized protein LOC103962645 [Pyrus x bretschneideri]
Length=418

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            YIVGM+TCYPQPG+VKI DGE+LT+VSNYSS Q+HTGVM LFYILVAD +P+S
Sbjct  357  YIVGMSTCYPQPGSVKINDGETLTLVSNYSSSQTHTGVMDLFYILVADYLPKS  409



>gb|KJB53256.1| hypothetical protein B456_008G211400 [Gossypium raimondii]
Length=467

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I++GE+L +  NYS  + HTGVMGLFYILVAD +P+    LR+ 
Sbjct  361  YIVGMTTCYPKPGTVEISEGETLILEFNYSRIRHHTGVMGLFYILVADDLPKPMHTLRTV  420

Query  413  IKGGE-MMILPNAILILAFVG-IAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++      +A +G +AV+ +AV    +R E E+ YE I M
Sbjct  421  VQTQDSIMVVTVLWAAVALIGVVAVIALAVHYQFKR-EGEDGYEAIGM  467



>gb|KJB53258.1| hypothetical protein B456_008G211400 [Gossypium raimondii]
Length=476

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I++GE+L +  NYS  + HTGVMGLFYILVAD +P+    LR+ 
Sbjct  370  YIVGMTTCYPKPGTVEISEGETLILEFNYSRIRHHTGVMGLFYILVADDLPKPMHTLRTV  429

Query  413  IKGGE-MMILPNAILILAFVG-IAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++      +A +G +AV+ +AV    +R E E+ YE I M
Sbjct  430  VQTQDSIMVVTVLWAAVALIGVVAVIALAVHYQFKR-EGEDGYEAIGM  476



>ref|XP_008360160.1| PREDICTED: uncharacterized protein LOC103423859 [Malus domestica]
Length=229

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            YIV M+TCYPQPG+VKI DGE+LT+VSNYSS Q+HTGVM LFYILVAD +P+S + 
Sbjct  168  YIVXMSTCYPQPGSVKINDGETLTLVSNYSSAQTHTGVMDLFYILVADYLPKSAAL  223



>ref|XP_002511074.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51676.1| conserved hypothetical protein [Ricinus communis]
Length=467

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM+TCYP+PG+VKIADGE+LT+ SNYSS Q+HTGVMGLFYILVAD  P 
Sbjct  357  YIVGMSTCYPKPGSVKIADGENLTLESNYSSTQTHTGVMGLFYILVADQTPN  408



>ref|XP_010663820.1| PREDICTED: uncharacterized protein LOC100243857 isoform X2 [Vitis 
vinifera]
Length=422

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRS  417
            YIVGM+TCYPQPG+VKI+DGE+L + SNYSS Q HTGVMGLFYILVA+P P     L S
Sbjct  360  YIVGMSTCYPQPGSVKISDGETLILESNYSSTQKHTGVMGLFYILVAEPSPNPSLLLHS  418



>gb|AFK39203.1| unknown [Lotus japonicus]
Length=87

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRS  417
            YIVGM+TCYPQPG+VK+ DGE++T+ SNYSS Q H+GVMGLFY+LVA+ +P  + F+ S
Sbjct  16   YIVGMSTCYPQPGSVKVFDGETVTLESNYSSSQRHSGVMGLFYLLVAEQLPH-QHFIHS  73



>gb|AFA26164.1| hypothetical protein, partial [Lolium perenne]
Length=98

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            YIVGM+TCYP+PG++K++D E LT+VSNYSS + HTGVMGLFYILVA+P
Sbjct  23   YIVGMSTCYPKPGSIKVSDSEVLTVVSNYSSDRQHTGVMGLFYILVAEP  71



>gb|KEH31349.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=435

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI DGE+LT+VSNYSS + HTGVMGLFY+LVA+ +P+     R  
Sbjct  362  YIVGMSTCYPKPGSVKIVDGETLTLVSNYSSTKEHTGVMGLFYLLVAEQLPDQH--FRHS  419

Query  413  IKGGEMMILPNAIL  372
             +    M + N +L
Sbjct  420  TRSSFFMDINNMLL  433



>gb|KHG10977.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=465

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I+ GE+L + SNYS  + HTGVMGLFYILVAD +P+    L + 
Sbjct  359  YIVGMTTCYPKPGTVEISKGETLILESNYSRIRHHTGVMGLFYILVADKLPKPMQALHTV  418

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++      +A +G+  + V  +  R + E E+ YE I M
Sbjct  419  VQTQDSIMVVTILWAAVALIGVVAVIVVAVHYRLKSEGEDGYEAIGM  465



>ref|XP_008375426.1| PREDICTED: uncharacterized protein LOC103438663 [Malus domestica]
Length=410

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            YIVGM++CYP+PG+++I DGE+LT+VSNYSS Q+HTGVMGLFYILVAD +P S
Sbjct  356  YIVGMSSCYPRPGSIRINDGETLTLVSNYSSTQTHTGVMGLFYILVADYLPNS  408



>ref|XP_006844650.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
 gb|ERN06325.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
Length=465

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VK+ DGE+LT+ S YS    HTGVMGLFYILVA+P   S + ++  
Sbjct  352  YIVGMSTCYPEPGSVKVKDGETLTLESRYSGATMHTGVMGLFYILVAEPTGNSLASIQG-  410

Query  413  IKGGEMMILPNAILILAFVGIA---VLGVAVIMSRRRGERENDYEPI  282
            ++  +   L    L    VG+A   VLG A ++  +  E E  YE I
Sbjct  411  VQSVQQAKLNVYFLTFVLVGVALALVLGFAYVLKTK--EEEQAYESI  455



>ref|XP_009360279.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360280.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360286.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
 ref|XP_009360287.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
Length=417

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            YIVGM++CYP+PG+++I DGE+LT+VSNYSS Q+HTGVMGLFYILVAD +P S
Sbjct  356  YIVGMSSCYPRPGSIRINDGETLTLVSNYSSTQTHTGVMGLFYILVADYLPTS  408



>gb|KJB46718.1| hypothetical protein B456_008G2113001 [Gossypium raimondii]
Length=465

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I+ GE+L + SNYS  + HTGVMGLFYILVAD +P+    L + 
Sbjct  359  YIVGMTTCYPKPGTVEISKGETLILESNYSRIRHHTGVMGLFYILVADELPKPMHALHTV  418

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++      +A +G+  +    +  R + E E+ YE I M
Sbjct  419  VQTQDSIMVVTILWAAVALIGVVAVIAVAVHYRLKREGEDGYEAIGM  465



>gb|KJB46717.1| hypothetical protein B456_008G2113001, partial [Gossypium raimondii]
Length=466

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I+ GE+L + SNYS  + HTGVMGLFYILVAD +P+    L + 
Sbjct  360  YIVGMTTCYPKPGTVEISKGETLILESNYSRIRHHTGVMGLFYILVADELPKPMHALHTV  419

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++      +A +G+  +    +  R + E E+ YE I M
Sbjct  420  VQTQDSIMVVTILWAAVALIGVVAVIAVAVHYRLKREGEDGYEAIGM  466



>ref|XP_010099538.1| hypothetical protein L484_011611 [Morus notabilis]
 gb|EXB79418.1| hypothetical protein L484_011611 [Morus notabilis]
Length=420

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGMTTCYPQPG+VKI DGE++ + SNYSS Q HTGVMGLFYILVAD +P
Sbjct  360  YIVGMTTCYPQPGSVKILDGETMILESNYSSSQPHTGVMGLFYILVADKLP  410



>ref|XP_010099537.1| hypothetical protein L484_011610 [Morus notabilis]
 gb|EXB79417.1| hypothetical protein L484_011610 [Morus notabilis]
Length=420

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGMTTCYPQPG+VKI DGE++ + SNYSS Q HTGVMGLFYILVAD +P
Sbjct  360  YIVGMTTCYPQPGSVKILDGETMILESNYSSSQPHTGVMGLFYILVADKLP  410



>ref|XP_011073282.1| PREDICTED: uncharacterized protein LOC105158282 [Sesamum indicum]
Length=461

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP PG++KIA GE+LT+VSNY+S + HTGVMGLFY+L++D      S     
Sbjct  361  YVVGMSTCYPSPGSIKIAAGETLTLVSNYNSARRHTGVMGLFYLLISD-----SSTKLDA  415

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPI  282
             +  +  ++ N   ++A  G+ ++ + + M   + ER + YE I
Sbjct  416  TEAHKSRLMSNFGWLVALFGVGLVVLVIFMFYGKSERGDGYEAI  459



>ref|XP_003574848.1| PREDICTED: uncharacterized protein LOC100825842 [Brachypodium 
distachyon]
Length=404

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            Y+VGM+TCYP+PG+VK++DGE LT+VSNYSS++ HTGVMGLFYILVA+P
Sbjct  353  YVVGMSTCYPKPGSVKVSDGEVLTVVSNYSSYRRHTGVMGLFYILVAEP  401



>dbj|BAJ88316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PGTVK++DGE LTIVSNYSS + HTGVMG FYILVAD
Sbjct  225  YIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQHTGVMGHFYILVAD  272



>ref|XP_006374582.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
 gb|ERP52379.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
Length=446

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI  GE+LT+ SNY S   HTGVMG FYI +A+  P + +F  + 
Sbjct  341  YIVGMSTCYPEPGSVKITAGENLTLESNYDSTNKHTGVMGFFYIYIAEQAP-NVTFSHAP  399

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYE  288
            ++  E + +   A  I+ F+G+AV     + S  +  RE  Y+
Sbjct  400  VQMHESIKVKTCAWSIVVFIGLAVTAAVSVHSWLKKRREGGYK  442



>gb|KHN25869.1| hypothetical protein glysoja_018723 [Glycine soja]
Length=245

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM+TCYP+PG+VKI DGE+LT+ SNYSS + HTGVMGLFY+LVA+ +P+
Sbjct  174  YIVGMSTCYPRPGSVKIIDGETLTLESNYSSSREHTGVMGLFYLLVAEQLPD  225



>gb|KEH31347.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=437

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI DGE+LT+VSNYS+ + HTGVMGLFY+LVA+ +P      R  
Sbjct  364  YIVGMSTCYPKPGSVKIIDGETLTLVSNYSNSKEHTGVMGLFYLLVAEQLPYQH--FRHS  421

Query  413  IKGGEMMILPNAIL  372
             +    M + N +L
Sbjct  422  TRSSFFMDINNMLL  435



>ref|XP_010099536.1| hypothetical protein L484_011609 [Morus notabilis]
 gb|EXB79416.1| hypothetical protein L484_011609 [Morus notabilis]
Length=420

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGMTTCYPQPG+VKI DGE+L + SNYSS Q HTGVMGLFYILVA+ +P
Sbjct  360  YIVGMTTCYPQPGSVKILDGETLILESNYSSSQPHTGVMGLFYILVAEKLP  410



>ref|XP_008808814.1| PREDICTED: uncharacterized protein LOC103720742 isoform X2 [Phoenix 
dactylifera]
Length=472

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 69/110 (63%), Gaps = 5/110 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YI+GM+TCYP+ G+V++ADGE LT+ SNYS  Q HTGVMGLFYILVA+P P+ ++     
Sbjct  361  YIIGMSTCYPEAGSVRVADGEVLTLESNYSRTQMHTGVMGLFYILVAEPQPQPKTLHDHS  420

Query  413  I---KGGEMMILPNAILILAFVGIAVLGVAVIMSR--RRGERENDYEPIV  279
                +G E++    A ++   +   ++GV+       R+ + +  Y+ +V
Sbjct  421  FPISRGFELLKYTWACVLAGAILAVIIGVSYCWVSYCRKHDGDEGYQTLV  470



>ref|XP_008808813.1| PREDICTED: uncharacterized protein LOC103720742 isoform X1 [Phoenix 
dactylifera]
Length=487

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 69/110 (63%), Gaps = 5/110 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YI+GM+TCYP+ G+V++ADGE LT+ SNYS  Q HTGVMGLFYILVA+P P+ ++     
Sbjct  376  YIIGMSTCYPEAGSVRVADGEVLTLESNYSRTQMHTGVMGLFYILVAEPQPQPKTLHDHS  435

Query  413  I---KGGEMMILPNAILILAFVGIAVLGVAVIMSR--RRGERENDYEPIV  279
                +G E++    A ++   +   ++GV+       R+ + +  Y+ +V
Sbjct  436  FPISRGFELLKYTWACVLAGAILAVIIGVSYCWVSYCRKHDGDEGYQTLV  485



>ref|XP_011073597.1| PREDICTED: uncharacterized protein LOC105158512 [Sesamum indicum]
Length=417

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLR  420
            YIVGM+TCYP PG+VKIA GE+LT+VSNYSS Q+HTGVMGLFY+L++D   +  +FL 
Sbjct  360  YIVGMSTCYPSPGSVKIAAGETLTLVSNYSSTQNHTGVMGLFYLLISDSSAKPNAFLH  417



>dbj|BAJ87916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PGTVK++DGE LTIVSNYSS + HTGVMG FYILVAD
Sbjct  345  YIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQHTGVMGHFYILVAD  392



>dbj|BAJ86815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PGTVK++DGE LTIVSNYSS + HTGVMG FYILVAD
Sbjct  345  YIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQHTGVMGHFYILVAD  392



>ref|XP_011040295.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
 ref|XP_011040296.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
Length=467

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG+VK+  GE+LT+ SNY+S   HTGVMGLFYI VA+  P + +F +++
Sbjct  358  YIVGMSSCYPKPGSVKLTAGENLTLESNYNSTNKHTGVMGLFYIYVAEQAP-NVTFSQAR  416

Query  413  IKGGEMMILPN-AILILAFVGIAVL----GVAVIMSRRRGERENDYEPI  282
            ++  E + + N A  I+ F+G+A+         + S  +  RE  Y+P+
Sbjct  417  VQMHESIKVKNYAWSIVVFIGLALTIAVAVAVAVHSWLKKRREGSYKPV  465



>ref|XP_011040297.1| PREDICTED: uncharacterized protein LOC105136595 isoform X2 [Populus 
euphratica]
Length=462

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG+VK+  GE+LT+ SNY+S   HTGVMGLFYI VA+  P + +F +++
Sbjct  353  YIVGMSSCYPKPGSVKLTAGENLTLESNYNSTNKHTGVMGLFYIYVAEQAP-NVTFSQAR  411

Query  413  IKGGEMMILPN-AILILAFVGIAVL----GVAVIMSRRRGERENDYEPI  282
            ++  E + + N A  I+ F+G+A+         + S  +  RE  Y+P+
Sbjct  412  VQMHESIKVKNYAWSIVVFIGLALTIAVAVAVAVHSWLKKRREGSYKPV  460



>dbj|BAJ53113.1| JHL07K02.3 [Jatropha curcas]
 gb|KDP22519.1| hypothetical protein JCGZ_26350 [Jatropha curcas]
Length=409

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            YIVGM+TCYP+PG+VKI+DGE+L + S YSS Q HTGVMGLFYILVAD  P    F
Sbjct  354  YIVGMSTCYPKPGSVKISDGENLILESKYSSAQRHTGVMGLFYILVADRTPRHSPF  409



>ref|XP_003574847.1| PREDICTED: uncharacterized protein LOC100825330 [Brachypodium 
distachyon]
Length=421

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            YIVGM+TCYP+PG+VK++DGE LT VSNYSS + HTGVMGLFYILVA+P
Sbjct  345  YIVGMSTCYPKPGSVKVSDGEVLTQVSNYSSDRQHTGVMGLFYILVAEP  393



>gb|EMS55330.1| hypothetical protein TRIUR3_10894 [Triticum urartu]
Length=419

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TCYP+PGTVK++DGE LTIVSNYSS + HTGVMG FYILVAD
Sbjct  342  YVVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQHTGVMGHFYILVAD  389



>ref|XP_004504713.1| PREDICTED: uncharacterized protein LOC101499286 [Cicer arietinum]
Length=431

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRS  417
            YIVGM+TCYPQPG+VKI DGE+LT+ S+Y++ Q HTGVMGLFY+LVA+ +P  + F  S
Sbjct  364  YIVGMSTCYPQPGSVKIIDGETLTLESSYNNSQEHTGVMGLFYLLVAEQLPYQQYFRHS  422



>gb|EYU24544.1| hypothetical protein MIMGU_mgv1a007758mg [Erythranthe guttata]
Length=396

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP PG++KI+ GE LT+VSNYS+ QSHTGVMG FY+L+AD  P+S 
Sbjct  288  YVVGMSTCYPTPGSLKISSGEKLTLVSNYSNAQSHTGVMGFFYLLIADSSPKSN  341



>gb|KEH31355.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=433

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP--ESRSFLR  420
            YIVGM+TCYP+PG+VKI DGE+LT+ SNY+S + HTGVMGLFYILVA+ +P  + R F R
Sbjct  362  YIVGMSTCYPKPGSVKIIDGETLTLESNYNSTKEHTGVMGLFYILVAEQLPYQQLRLFSR  421

Query  419  S  417
            S
Sbjct  422  S  422



>gb|KHG23950.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=467

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMTTCYP+PGTV+I++GE+L +  NYS  + HTGVMGLFYILVAD +P+    LR+ 
Sbjct  361  YIVGMTTCYPKPGTVEISEGETLILEFNYSRIRHHTGVMGLFYILVADDLPKPMHRLRTV  420

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPIVM  276
            ++  + +M++       A +G+  +    +  + + E E+ YE I M
Sbjct  421  VQTQDSIMVVAILWAAAALIGVVAVIALAVHYQFKCEGEDGYEAIGM  467



>gb|KEH31354.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=352

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI DGE+LT+ SNY+S + HTGVMGLFY+LVA+ +P  +  L S+
Sbjct  281  YIVGMSTCYPKPGSVKIIDGETLTLESNYNSTREHTGVMGLFYLLVAEQLPYQQLRLTSR  340



>gb|KHN39141.1| hypothetical protein glysoja_027946 [Glycine soja]
Length=701

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+V I DGE+LT+ SNYSS + HTGVMGLFY+LVA+ +P
Sbjct  630  YIVGMSTCYPRPGSVNIIDGETLTLESNYSSSREHTGVMGLFYLLVAEQLP  680



>ref|XP_010668152.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668153.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668154.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            YIVGM+TCYP PG++KI DGE+L + SNYSS + HTGVMGLFYILVA+ +P  +S 
Sbjct  355  YIVGMSTCYPDPGSIKIYDGETLVLESNYSSSRKHTGVMGLFYILVAEQLPTQKSL  410



>ref|XP_003524108.1| PREDICTED: uncharacterized protein LOC100785991 [Glycine max]
Length=429

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            YIVGM+TCYP+PG+VKI DGE+LT+ SNYSS + HTGVMGLFY+LVA+ +P+  
Sbjct  358  YIVGMSTCYPRPGSVKIIDGETLTLESNYSSSREHTGVMGLFYLLVAEQLPDQH  411



>gb|EMT11028.1| hypothetical protein F775_20874 [Aegilops tauschii]
Length=441

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TCYP+PGTVK++DGE LT+VSNYSS + HTGVMG FYILVAD
Sbjct  364  YVVGMSTCYPEPGTVKVSDGEVLTMVSNYSSERQHTGVMGHFYILVAD  411



>gb|EMT06228.1| hypothetical protein F775_26753 [Aegilops tauschii]
Length=422

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            YIVGM+TCYP+PG++K++DGE LTIVSNYSS + HTGVMGL YILVA+P
Sbjct  347  YIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSDRQHTGVMGLVYILVAEP  395



>gb|AAU14999.2| MtN19-like protein [Pisum sativum]
Length=435

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG++KI DGE+LT+ SNY+S + HTGVMGLFYILVA+ +P     LR  
Sbjct  362  YIVGMSTCYPKPGSMKIMDGETLTLESNYNSTKEHTGVMGLFYILVAEQLPYQH--LRHS  419

Query  413  IKGGEMMILPNAIL  372
             +    M   N +L
Sbjct  420  TRSSFFMDSNNMLL  433



>gb|AES64800.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=826

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG++KI DGE+LT+ SNYSS+ SH+GVMGLFY LVA+ +P
Sbjct  360  YIVGMSTCYPKPGSIKIFDGETLTLESNYSSNISHSGVMGLFYFLVAEKLP  410


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP PG++KI DGE LT+ +N+SS+  ++GVMGLFY LVA+ +P  R
Sbjct  772  YVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIRYSGVMGLFYFLVAEKLPPYR  825



>gb|AFK39438.1| unknown [Medicago truncatula]
Length=158

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+ G+VKI DGE+LT+ SNY+S + HTGVMGLFY+LVA+ +P      R  
Sbjct  85   YIVGMSTCYPKSGSVKIIDGETLTLESNYNSTKEHTGVMGLFYLLVAEQLP--YQHFRHS  142

Query  413  IKGGEMMILPNAIL  372
             +    M + N +L
Sbjct  143  TRSSFFMDINNILL  156



>ref|XP_009335863.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
 ref|XP_009335864.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
Length=406

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YI+GMTTCYP+PG+VKI DGE+LT+VSNY S Q H+GVMGLFYILVA+
Sbjct  357  YIIGMTTCYPRPGSVKIKDGETLTVVSNYESAQMHSGVMGLFYILVAE  404



>ref|XP_003594549.1| MtN19 protein [Medicago truncatula]
Length=882

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG++KI DGE+LT+ SNYSS+ SH+GVMGLFY LVA+ +P
Sbjct  416  YIVGMSTCYPKPGSIKIFDGETLTLESNYSSNISHSGVMGLFYFLVAEKLP  466


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP PG++KI DGE LT+ +N+SS+  ++GVMGLFY LVA+ +P  R
Sbjct  828  YVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIRYSGVMGLFYFLVAEKLPPYR  881



>gb|KHN25868.1| hypothetical protein glysoja_018722 [Glycine soja]
Length=434

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM+TCYPQPG+VKI DGE++T+ SNYSS + HTGVMGLFY+LVA+ +P 
Sbjct  363  YIVGMSTCYPQPGSVKIIDGETITLESNYSSSRGHTGVMGLFYLLVAEQLPH  414



>ref|NP_001240902.1| uncharacterized protein LOC100784767 precursor [Glycine max]
 gb|ACU17750.1| unknown [Glycine max]
Length=434

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM+TCYPQPG+VKI DGE++T+ SNYSS + HTGVMGLFY+LVA+ +P 
Sbjct  363  YIVGMSTCYPQPGSVKIIDGETITLESNYSSSRGHTGVMGLFYLLVAEQLPH  414



>ref|XP_011465272.1| PREDICTED: uncharacterized protein LOC101300825 [Fragaria vesca 
subsp. vesca]
Length=420

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM+TCYP+PG+VKI DGE+L + SNYSS Q HTGVMGLFYILVA+ +P+
Sbjct  359  YIVGMSTCYPRPGSVKINDGETLVVGSNYSSSQPHTGVMGLFYILVAENLPK  410



>gb|KEH31350.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=425

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+PG+VKI DGE+LT+ SNY+S + HTGVMGLFY+LVA+ +P      R  
Sbjct  352  YIVGMSTCYPKPGSVKIIDGETLTLESNYNSTKEHTGVMGLFYLLVAEQLP--YQHFRHS  409

Query  413  IKGGEMMILPNAIL  372
             +    M + N +L
Sbjct  410  TRSSFFMDINNILL  423



>gb|EMS67414.1| hypothetical protein TRIUR3_30255 [Triticum urartu]
Length=424

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            YIVGM+TCYP+PG++K++DGE LTIVSNYSS   HTGVMGL YILVA+P
Sbjct  356  YIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSDCEHTGVMGLVYILVAEP  404



>ref|XP_011073598.1| PREDICTED: uncharacterized protein LOC105158513 [Sesamum indicum]
Length=418

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRS  417
            YIVGM+TCYP PG+VKIA GE+LT+VSNYSS Q+HTGVMGLFY+L++D   +  + L +
Sbjct  360  YIVGMSTCYPSPGSVKIAAGETLTLVSNYSSTQNHTGVMGLFYLLISDSSAKPDAVLHA  418



>ref|XP_008367082.1| PREDICTED: uncharacterized protein LOC103430711 [Malus domestica]
Length=406

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGMTTCYP PG+VKI DGE+LT+VSNY S Q H+GVMGLFYILVA+
Sbjct  357  YIVGMTTCYPWPGSVKIKDGETLTVVSNYESTQLHSGVMGLFYILVAE  404



>ref|XP_009373664.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
 ref|XP_009373665.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
Length=406

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y++GMTTCYP+PG+VKI DGE+LT+VSNY S Q H+GVMGLFYILVA+
Sbjct  357  YVIGMTTCYPRPGSVKIKDGETLTVVSNYESTQMHSGVMGLFYILVAE  404



>ref|XP_006659641.1| PREDICTED: uncharacterized protein LOC102706312 [Oryza brachyantha]
Length=424

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD---PVPE  438
            YIVGM+TCYP+PG+VK++DGE LT+VSNYSS + HTGVMGL YILVA+   P P+
Sbjct  349  YIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQHTGVMGLLYILVAENEQPAPK  403



>ref|XP_011073281.1| PREDICTED: uncharacterized protein LOC105158280 [Sesamum indicum]
Length=460

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 5/104 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TCYP PG+VKI+ GE+LT+VSNY+S + HTGVMGLFY+L++D      S     
Sbjct  360  YVVGMSTCYPSPGSVKISTGETLTLVSNYNSARRHTGVMGLFYLLISD-----SSTKLDT  414

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPI  282
             +  +  ++ +   ++A  G+ ++ + + M   +  R + YE I
Sbjct  415  TEAHKSRLMSDFGWLVALFGVGLVVLVIFMFYGKSGRGDGYEAI  458



>ref|NP_001148097.1| LOC100281705 [Zea mays]
 gb|ACG29711.1| mtN19-like protein [Zea mays]
Length=235

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG V + DGE LT+VS YSS + HTGVMGLFYILVAD
Sbjct  159  YIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRHTGVMGLFYILVAD  206



>gb|EMS67244.1| hypothetical protein TRIUR3_19124 [Triticum urartu]
Length=434

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADP  447
            YIVGM+TCYP+PG++K++DGE LTIVSNYSS + HTGVMGL YILVA+P
Sbjct  349  YIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSVRQHTGVMGLVYILVAEP  397



>gb|EEC83958.1| hypothetical protein OsI_30065 [Oryza sativa Indica Group]
Length=424

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD---PVPE  438
            YIVGM+TCYP+PG+VK++DGE LT+VSNYSS + HTGVMGL YILVA+   P P+
Sbjct  349  YIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQHTGVMGLLYILVAEQEQPAPK  403



>ref|NP_001062371.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAD01246.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAD33139.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAF24285.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAG90628.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55136.1| hypothetical protein OsJ_02924 [Oryza sativa Japonica Group]
Length=424

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD---PVPE  438
            YIVGM+TCYP+PG+VK++DGE LT+VSNYSS + HTGVMGL YILVA+   P P+
Sbjct  349  YIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQHTGVMGLLYILVAEQEQPAPK  403



>ref|XP_002445785.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
 gb|EES15280.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
Length=436

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG VK+ DGE+LT+VS YSS + HTGVMGLFYILVA+
Sbjct  359  YIVGMSTCYPKPGDVKVRDGEALTVVSRYSSERRHTGVMGLFYILVAE  406



>dbj|BAE71234.1| hypothetical protein [Trifolium pratense]
Length=404

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYPQPG+VKI DGE+LT+ SNY++ + HTGVMGLFY+LVA+ +P
Sbjct  350  YIVGMSTCYPQPGSVKIIDGETLTLESNYNNIKEHTGVMGLFYLLVAEQLP  400



>ref|XP_004974041.1| PREDICTED: uncharacterized protein LOC101778177 isoform X1 [Setaria 
italica]
 ref|XP_004974042.1| PREDICTED: uncharacterized protein LOC101778177 isoform X2 [Setaria 
italica]
 ref|XP_004974043.1| PREDICTED: uncharacterized protein LOC101778177 isoform X3 [Setaria 
italica]
Length=433

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TCYP+PG V + DGE LT+VSNYSSHQ HTG MG FYILVA+
Sbjct  350  YVVGMSTCYPKPGAVTVRDGEVLTVVSNYSSHQQHTGAMGQFYILVAE  397



>ref|XP_003531077.1| PREDICTED: uncharacterized protein LOC100803184 isoform X1 [Glycine 
max]
 ref|XP_006585010.1| PREDICTED: uncharacterized protein LOC100803184 isoform X2 [Glycine 
max]
 ref|XP_006585011.1| PREDICTED: uncharacterized protein LOC100803184 isoform X3 [Glycine 
max]
 ref|XP_006585012.1| PREDICTED: uncharacterized protein LOC100803184 isoform X4 [Glycine 
max]
Length=429

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            YIVGM+TCYP+PG+V I DGE+LT+ SNYSS + HTGVMGLFY+LVA+ +P   
Sbjct  358  YIVGMSTCYPRPGSVNIIDGETLTLESNYSSSREHTGVMGLFYLLVAEQLPHQH  411



>ref|XP_008453441.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
 ref|XP_008453442.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
Length=292

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGMTTCYPQPG++KI  GE +T VSNYSS  +H GVMG+F+I VAD + +S S L  +
Sbjct  224  YVVGMTTCYPQPGSMKINKGEMVTFVSNYSSTPTHRGVMGIFHIFVADKIFKSSSALSEE  283

Query  413  IKGGEMMIL  387
            +     +++
Sbjct  284  VGNNNTIVM  292



>ref|XP_006374583.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
 gb|ERP52380.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
Length=465

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+PG+VKI  GE+LT+ SNY+S   HTGVMGLFYI +A+  P + +F ++ 
Sbjct  358  YIVGMSSCYPEPGSVKITAGENLTLESNYNSTNKHTGVMGLFYIYIAEQAP-NVTFSQAP  416

Query  413  IKGGE-MMILPNAILILAFVGIAVLGVAVIM--SRRRGERENDYEPI  282
            ++  E + +   A  I+ F+G+AV     +   S  +  RE  Y+P+
Sbjct  417  VQMHESIKVTTYAWSIVVFIGLAVTIAVAVAVHSWLKKRREGGYKPV  463



>ref|XP_004974037.1| PREDICTED: uncharacterized protein LOC101776668 isoform X1 [Setaria 
italica]
 ref|XP_004974038.1| PREDICTED: uncharacterized protein LOC101776668 isoform X2 [Setaria 
italica]
Length=433

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD---PVPES  435
            YIVGM+TCYP+PG V + DGE LT+VS YSSHQ HTGVMGL YILVA+   P P+ 
Sbjct  350  YIVGMSTCYPKPGAVTVRDGEVLTVVSKYSSHQQHTGVMGLVYILVAEHGQPQPQQ  405



>gb|KEH31351.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=420

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM+TCYP+PG++KI DGE+LT+ SNY++ Q HTGVMG FY+LVA+    S  F+
Sbjct  362  YIVGMSTCYPKPGSIKIIDGETLTLESNYNNSQEHTGVMGFFYLLVAEHSTRSSFFM  418



>gb|ACG30313.1| mtN19-like protein [Zea mays]
Length=419

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG V + DGE LT+VS YSS + HTGVMGLFYILVAD
Sbjct  343  YIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRHTGVMGLFYILVAD  390



>tpg|DAA48291.1| TPA: hypothetical protein ZEAMMB73_362863 [Zea mays]
Length=412

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG V + DGE LT+VS YSS + HTGVMGLFYILVAD
Sbjct  342  YIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRHTGVMGLFYILVAD  389



>tpg|DAA48290.1| TPA: mtN19-like protein [Zea mays]
Length=418

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG V + DGE LT+VS YSS + HTGVMGLFYILVAD
Sbjct  342  YIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRHTGVMGLFYILVAD  389



>ref|NP_001148306.1| mtN19-like protein precursor [Zea mays]
 gb|ACG30513.1| mtN19-like protein [Zea mays]
Length=426

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PG V + DGE LT+VS YSS + HTGVMGLFYILVAD
Sbjct  350  YIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRHTGVMGLFYILVAD  397



>gb|KEH26244.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=421

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+VKI DGE LT+ SNY++ + HTGVMGLFY+LVA+ +P
Sbjct  356  YIVGMSTCYPKPGSVKINDGEILTLESNYTNTKDHTGVMGLFYLLVAEELP  406



>gb|AFK43962.1| unknown [Medicago truncatula]
Length=425

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+ G+VKI DGE+LT+ SNY+S + HTGVMGLFY+LVA+ +P      R  
Sbjct  352  YIVGMSTCYPKSGSVKIIDGETLTLESNYNSTKEHTGVMGLFYLLVAEQLP--YQHFRHS  409

Query  413  IKGGEMMILPNAIL  372
             +    M + N +L
Sbjct  410  TRSSFFMDINNILL  423



>ref|XP_011465273.1| PREDICTED: uncharacterized protein LOC101300539 [Fragaria vesca 
subsp. vesca]
Length=420

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP PG++KI DGE+L + SNYSS Q HTGVMGLFYILVA+
Sbjct  359  YIVGMSTCYPHPGSIKINDGETLVVGSNYSSSQRHTGVMGLFYILVAE  406



>gb|ACJ85863.1| unknown [Medicago truncatula]
 gb|AFK38198.1| unknown [Medicago truncatula]
Length=430

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            YIVGM+TCYP+PG++KI DGE+LT+VS Y++ Q H GVMGLFY+LVA+ +P+  
Sbjct  363  YIVGMSTCYPKPGSIKIIDGETLTLVSIYNNSQEHNGVMGLFYLLVAEQLPDQH  416



>ref|XP_007158977.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30971.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=439

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+VKI  GE+LT+ SNYSS   HTGVMGLFY+LVA+ +P
Sbjct  368  YIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHGHTGVMGLFYLLVAEQLP  418



>gb|KEH31348.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=430

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            YIVGM+TCYP+PG++KI DGE+LT+VS Y++ Q H GVMGLFY+LVA+ +P+  
Sbjct  363  YIVGMSTCYPKPGSIKIIDGETLTLVSIYNNSQEHNGVMGLFYLLVAEQLPDQH  416



>gb|ACJ85534.1| unknown [Medicago truncatula]
Length=420

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            YIVGM+TCYP+PG++KI DGE+LT+ SNY++ Q HTGVMG FY+LVA+    S  F
Sbjct  362  YIVGMSTCYPKPGSIKIIDGETLTLESNYNNSQEHTGVMGFFYLLVAEHSTRSSFF  417



>ref|XP_007158975.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30969.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=425

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+VKI  GE+LT+ SNYSS   HTGVMGLFY+LVA+ +P
Sbjct  354  YIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHGHTGVMGLFYLLVAEQLP  404



>gb|AGV54779.1| MtN19-like protein [Phaseolus vulgaris]
Length=466

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+VKI  GE+LT+ SNYSS   HTGVMGLFY+LVA+ +P
Sbjct  369  YIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHGHTGVMGLFYLLVAEQLP  419



>ref|XP_003594550.1| MtN19 protein [Medicago truncatula]
 gb|AES64801.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=391

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            Y+VGM+TCYP+PG++KI DGE+LT+ +NYSS+  H+GVMGLFY LVA+ +P
Sbjct  337  YVVGMSTCYPKPGSIKIFDGENLTLETNYSSNIRHSGVMGLFYFLVAEKLP  387



>gb|KHN25867.1| hypothetical protein glysoja_018721 [Glycine soja]
Length=196

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            YIVGM+TCYP PG+VKI DG++ T+ SNYSS   HTGVMG+FY+LVA+ +P   
Sbjct  132  YIVGMSTCYPPPGSVKIIDGKTFTMESNYSSSPGHTGVMGIFYLLVAEQLPHQH  185



>gb|KHN14319.1| hypothetical protein glysoja_012357 [Glycine soja]
Length=136

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP+PGT+KI DGE+LT+   YS+ + H+GVMGLFYILVA+ +P   
Sbjct  81   YVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEMHSGVMGLFYILVAEQLPHQH  134



>ref|XP_008453438.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453439.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453440.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
Length=431

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+ GMTTCYPQPG++KI  GE +T VSNYSS  +H GVMG+F+I VAD + +S S L  +
Sbjct  363  YVTGMTTCYPQPGSMKIKKGEMVTFVSNYSSTMTHRGVMGIFHIFVADKIFKSSSPLSEE  422

Query  413  IKGGEMMIL  387
            +     +++
Sbjct  423  VGNNNTIVM  431



>ref|XP_009360277.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360278.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360288.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
 ref|XP_009360289.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
Length=406

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGMTTCYP PG+VKI + ESLT+VS+Y+S Q H+GVMGLFYILVA+
Sbjct  357  YIVGMTTCYPWPGSVKIKNAESLTLVSSYNSTQMHSGVMGLFYILVAE  404



>gb|KEH26246.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=432

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PG+VKI DGE LT  SNY++ + HTGVMGLFY+LVA+ +P
Sbjct  362  YIVGMSTCYPKPGSVKIIDGEILTHESNYNNTKEHTGVMGLFYLLVAEQLP  412



>ref|XP_003546270.2| PREDICTED: uncharacterized protein LOC100815629 [Glycine max]
Length=742

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            Y+VGM+TCYP+PGT+KI DGE+LT+   YS+ + H+GVMGLFYILVA+ +P
Sbjct  687  YVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEMHSGVMGLFYILVAEQLP  737



>gb|AFK45617.1| unknown [Medicago truncatula]
Length=420

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            YIVGM+TCYP+PG++ I DGE+LT+ SNY++ Q HTGVMG FY+LVA+    S  F
Sbjct  362  YIVGMSTCYPKPGSINIIDGETLTLESNYNNSQEHTGVMGFFYLLVAEHSTRSSFF  417



>ref|XP_007147472.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
 gb|ESW19466.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
Length=404

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PGT+KI DGE++T+   Y++ Q H+GVMGLFYILVA+ +P
Sbjct  353  YIVGMSTCYPKPGTIKIKDGETITLEIKYNNSQMHSGVMGLFYILVAEQLP  403



>ref|XP_007147471.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
 gb|ESW19465.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
Length=404

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM+TCYP+PGT+KI DGE++T+   Y++ Q H+GVMGLFYILVA+ +P
Sbjct  353  YIVGMSTCYPKPGTIKIKDGETITLEIKYNNSQMHSGVMGLFYILVAEQLP  403



>gb|KJB07929.1| hypothetical protein B456_001G053600 [Gossypium raimondii]
Length=412

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGM+TCYP+PGT KI+ GE+L + SNYSS + HTGVMGLFYILVA+
Sbjct  362  YIVGMSTCYPKPGTKKISKGETLILESNYSSIKQHTGVMGLFYILVAE  409



>ref|XP_006586844.1| PREDICTED: uncharacterized protein LOC100791925 [Glycine max]
 gb|KHN23013.1| hypothetical protein glysoja_030683 [Glycine soja]
Length=408

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP+ GT+KI DGE+LT+   YS++QSH+GVMGLFYILVA+ +P   
Sbjct  353  YVVGMSTCYPRRGTIKIKDGETLTLEIIYSNNQSHSGVMGLFYILVAEQLPHQH  406



>ref|XP_004974040.1| PREDICTED: uncharacterized protein LOC101777764 [Setaria italica]
Length=432

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM++CYP+PGTVK+ DGE+LT+VSNY+  +  TGVMG FYILVA+
Sbjct  347  YVVGMSSCYPEPGTVKVRDGEALTVVSNYTGERRRTGVMGHFYILVAE  394



>ref|XP_004160448.1| PREDICTED: uncharacterized protein LOC101226527 [Cucumis sativus]
Length=431

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y++GMTTCYP+PG++KI  GE +T VSNYSS  +H GVMG+F+I+VAD + +  S L  +
Sbjct  362  YVIGMTTCYPKPGSIKINKGEMVTFVSNYSSTLTHRGVMGIFHIIVADRIFKPSSTLSEE  421

Query  413  IKGGEMMIL  387
            +     +++
Sbjct  422  VGNNNTIVM  430



>gb|KGN63844.1| hypothetical protein Csa_1G024275 [Cucumis sativus]
Length=461

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y++GMTTCYP+PG++KI  GE +T VSNYSS  +H GVMG+F+I+VAD + +  S L  +
Sbjct  392  YVIGMTTCYPKPGSIKINKGEMVTFVSNYSSTLTHRGVMGIFHIIVADRIFKPSSTLSEE  451

Query  413  IKGGEMMIL  387
            +     +++
Sbjct  452  VGNNNTIVM  460



>ref|XP_008375421.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
 ref|XP_008375422.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
Length=406

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            YIVGMTTCYP PG+VKI + E LT+VS Y+S Q H+GVMGLFYILVA+
Sbjct  357  YIVGMTTCYPWPGSVKIKNAEPLTLVSTYNSTQMHSGVMGLFYILVAE  404



>gb|KEH41600.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGMTTCYPQPG++KI +GE+L +  NY++ + H+GVMGLFY LVA+ +P   
Sbjct  358  YVVGMTTCYPQPGSIKILNGETLILEVNYNNSRRHSGVMGLFYFLVAEKLPHQH  411



>gb|ACU22964.1| unknown [Glycine max]
 gb|KHN14320.1| hypothetical protein glysoja_012358 [Glycine soja]
Length=406

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP+PGT+KI DGE+LT+   YS+ + H+GVMGLFYILVA+ +P   
Sbjct  351  YVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEMHSGVMGLFYILVAEQLPHQH  404



>gb|KEH16840.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYPQPG++KI +GE+LT+  NY++ + H+GVMGLFY LV + +P  
Sbjct  358  YVVGMSTCYPQPGSIKIFNGETLTLEVNYNNSRRHSGVMGLFYFLVEEKLPHQ  410



>emb|CDY71894.1| BnaCnng74970D [Brassica napus]
Length=225

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM++CYP+P  VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE  S L
Sbjct  158  YIVGMSSCYPEP--VKVSSGETLTLEFNYSSAVGHTGVMGLFYILVAQQLPEPESSL  212



>ref|XP_004974890.1| PREDICTED: uncharacterized protein LOC101770076 [Setaria italica]
Length=442

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 6/62 (10%)
 Frame = -2

Query  593  YIVGMTTCYPQPG-TVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD-----PVPESR  432
            Y+VGM+ CYP+PG   ++  GE+LT+VSNYSS + HTGVMG FYILVAD     P PE +
Sbjct  359  YVVGMSACYPEPGGAARVRGGEALTVVSNYSSERQHTGVMGHFYILVADEQEQLPAPEKQ  418

Query  431  SF  426
              
Sbjct  419  QL  420



>ref|XP_006844651.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
 gb|ERN06326.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
Length=392

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVA  453
            Y+VGM+TCYP+PG++KI DGE+L + S Y+S   HTGVMGLFYILVA
Sbjct  346  YVVGMSTCYPEPGSMKIKDGETLVLESTYNSATLHTGVMGLFYILVA  392



>emb|CDY53158.1| BnaCnng24580D [Brassica napus]
Length=494

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+P  VK+  GE+LT+  NYSS   HTGVMGLFYILVA  +PE  S L + 
Sbjct  392  YIVGMSSCYPEP--VKVTSGETLTLEFNYSSAVGHTGVMGLFYILVAQQLPEPESSLPAL  449

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPI  282
             +  E  +   + L    V   V+ +A ++ RR+ +RE+ Y+ +
Sbjct  450  FQAHEKDVSFLSFLAATVVVAVVVLIAAVVYRRQ-KREDGYQSL  492



>ref|XP_004160447.1| PREDICTED: uncharacterized protein LOC101226295 [Cucumis sativus]
Length=198

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSF  426
            Y++GMTTCYP+PG++ I  GE +T VSNYSS  +H GV G+F+I+VAD +  S + 
Sbjct  131  YVIGMTTCYPKPGSITINKGEMVTFVSNYSSTLTHRGVRGIFHIIVADKIKSSSTL  186



>ref|XP_006394466.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 ref|XP_006394467.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 dbj|BAJ33779.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31752.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 gb|ESQ31753.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
Length=476

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM++CYP+P  VK+  GE+LT+  NYS+   HTGVMGLFYILVA  +PE  S L
Sbjct  373  YIVGMSSCYPEP-AVKVTKGETLTLEFNYSTTNGHTGVMGLFYILVAQQLPEPESSL  428



>ref|XP_010546109.1| PREDICTED: uncharacterized protein LOC104818287 [Tarenaya hassleriana]
Length=492

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM+TCYP+P  VK+  GE+L   SNYSS   HTGVMGLFYI+VA  +P+  +   + 
Sbjct  390  YIVGMSTCYPEP--VKVTKGETLVFESNYSSAIGHTGVMGLFYIMVAQQLPDHGNSFPAL  447

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPI  282
            I+ G +  +  + L+     +A++ +A ++ RR+  +++ YEP+
Sbjct  448  IR-GNLKTVNLSGLVAVAGVVALVVIAAVVYRRQNRQQDGYEPL  490



>ref|XP_008453443.1| PREDICTED: uncharacterized protein LOC103494148 [Cucumis melo]
Length=430

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPV-PESRSFLRS  417
            Y++GMT CYP+PG++KI  GE +T VSNYSS  +H GV+GLF+I VAD +   S S L  
Sbjct  361  YMIGMTACYPKPGSMKINKGEMVTFVSNYSSTLTHRGVLGLFHIFVADEIFKSSSSTLSE  420

Query  416  QIKGGEMMIL  387
            ++    ++++
Sbjct  421  EVSNDNIIVM  430



>ref|XP_006394469.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
 gb|ESQ31755.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
Length=472

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM++CYP+P  V++ +GE+LT+  NYS+   HTGVMGLFYILVA  +PE  S L
Sbjct  370  YIVGMSSCYPEP--VRVTNGETLTLEFNYSNTHGHTGVMGLFYILVAQQLPEPESSL  424



>emb|CAA75589.1| MtN19 [Medicago truncatula]
Length=411

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+VGM+TCYP PG++KI DGE LT+ +N+SS+  ++GVMGLFY LVA+ +P  R
Sbjct  357  YVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIRYSGVMGLFYFLVAEKLPPYR  410



>gb|KGN43818.1| hypothetical protein Csa_7G069440 [Cucumis sativus]
Length=445

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+PG+VK+ + E LT++S Y   Q+H GVMGLF+I+VA  +P S
Sbjct  373  YVVGMSTCYPKPGSVKLNNKEMLTLISKYHPSQTHIGVMGLFHIMVAQKLPNS  425



>ref|XP_004163909.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231400 
[Cucumis sativus]
Length=402

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+PG+VK+ + E LT++S Y   Q+H GVMGLF+I+VA  +P S
Sbjct  330  YVVGMSTCYPKPGSVKLNNKEMLTLISKYHPSQTHIGVMGLFHIMVAQKLPNS  382



>emb|CDY71873.1| BnaCnng74880D [Brassica napus]
Length=148

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+P  VK+ +GE+L++  NYS+   HTGVMGLFYILVA  +P   S L++ 
Sbjct  50   YIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIGHTGVMGLFYILVAQQLPGPESSLQAH  107

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
                      +++  LAF+ + V    V++      RR  RE+ Y+ +
Sbjct  108  ---------SSSMSFLAFLAVTVAVAVVVLIVAVVYRRKNREDGYQSL  146



>ref|XP_002960633.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38172.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=430

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TC+P+PGTV +A GE L + S+YSS Q HTGVM LFY++++D
Sbjct  352  YVVGMSTCFPEPGTVTVASGEKLHLSSSYSSAQEHTGVMALFYLILSD  399



>ref|XP_002983409.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
 gb|EFJ15751.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
Length=405

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TC P+PGTV IA GE L + S+YSS Q HTGVMG FY++V D
Sbjct  334  YVVGMSTCTPEPGTVTIASGEKLRLSSSYSSAQEHTGVMGYFYLVVGD  381



>ref|XP_008455078.1| PREDICTED: uncharacterized protein LOC103495342 [Cucumis melo]
Length=448

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+V M+TCYP+PG+VKI + E LT++S Y   Q+H GVMGLF+I+VA  +P S
Sbjct  376  YVVEMSTCYPKPGSVKINNKEMLTLISKYDPSQTHIGVMGLFHIMVAQKLPNS  428



>ref|XP_002960630.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
 gb|EFJ38169.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
Length=405

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TC P+PGTV IA GE L + S+YSS Q HTGVMG FY++V D
Sbjct  334  YVVGMSTCSPEPGTVTIASGEKLHLSSSYSSAQEHTGVMGYFYLVVGD  381



>ref|XP_002983406.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
 gb|EFJ15748.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 13/91 (14%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TC P+PGT+ +A GE L   S+YSS Q HTGVMG+FY++V+D            
Sbjct  352  YVVGMSTCIPKPGTLMVASGEKLHFSSSYSSAQEHTGVMGIFYLMVSD---------NDT  402

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS  321
            +  GE+  + N + ++    +  LG+ V+++
Sbjct  403  VSLGEIKDVKNRVNVM----VVTLGIVVVLA  429



>ref|XP_002960632.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38171.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=452

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 13/91 (14%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TC P+PGT+ +A GE L   S+YSS Q HTGVMG+FY++V+D            
Sbjct  352  YVVGMSTCIPKPGTLMVASGEKLHFSSSYSSAQEHTGVMGIFYLMVSD---------NDT  402

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMS  321
            +  GE+  + N + ++    +  LG+ V+++
Sbjct  403  VSLGEIKDVKNRVNVM----VVTLGIVVVLA  429



>ref|XP_006844648.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
 gb|ERN06323.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
Length=416

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM TCYP+PG+VK+ DGE+L + S YS+   HTGVMGLF+I VA+
Sbjct  358  YVVGMGTCYPRPGSVKVKDGETLILESRYSATTMHTGVMGLFHIFVAE  405



>ref|XP_002983404.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
 gb|EFJ15746.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
Length=395

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVA  453
            Y+VGM+TC+P+PGTV +A GE L + S+YSS Q HTGVM LFY++V+
Sbjct  349  YVVGMSTCFPEPGTVTVASGEKLHLSSSYSSAQEHTGVMALFYLIVS  395



>ref|XP_010457791.1| PREDICTED: uncharacterized protein LOC104739210 [Camelina sativa]
Length=475

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMT+CYP    VK++ GE+LT+ SNYSS   HTGVMG+FY++VA  +PE  S L + 
Sbjct  372  YIVGMTSCYPAD-PVKVSYGETLTLESNYSSAVGHTGVMGIFYMIVAQQLPEPESSLPNL  430

Query  413  IKG  405
             +G
Sbjct  431  FQG  433



>emb|CDY42880.1| BnaAnng07050D [Brassica napus]
Length=110

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            YIVGM++CYP+P  VK+ +GE+L++  NYS+   HTGVMGLFYILV+  +P
Sbjct  16   YIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIGHTGVMGLFYILVSQQLP  64



>ref|XP_010444016.1| PREDICTED: uncharacterized protein LOC104726775 [Camelina sativa]
 ref|XP_010483866.1| PREDICTED: uncharacterized protein LOC104762303 [Camelina sativa]
Length=153

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM +CYP    VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE
Sbjct  50   YIVGMASCYPAD-PVKVSYGETLTMEFNYSSAVGHTGVMGLFYILVAQQLPE  100



>ref|NP_200990.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38804.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51266.1| unknown protein [Arabidopsis thaliana]
 gb|AED97522.1| uncharacterized protein AT5G61820 [Arabidopsis thaliana]
Length=475

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP    VK++ GE+LT+ SNYS+   HTGVMGLFYILVA  +PE  S L ++
Sbjct  370  YIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVGHTGVMGLFYILVAQQLPEPDSSLPNK  428



>gb|AAL91170.1| putative protein [Arabidopsis thaliana]
Length=475

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP    VK++ GE+LT+ SNYS+   HTGVMGLFYILVA  +PE  S L ++
Sbjct  370  YIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVGHTGVMGLFYILVAQQLPEPDSSLPNK  428



>dbj|BAI63593.1| MtN19 protein [Lotus japonicus]
Length=405

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+V M+TCYP+PG+ KI +GE+L++   Y++   HTGVMGLFYILVA+ +P 
Sbjct  351  YLVAMSTCYPRPGSEKIKNGETLSLEITYNNSIGHTGVMGLFYILVAEKLPH  402



>ref|XP_009130176.1| PREDICTED: uncharacterized protein LOC103854962 [Brassica rapa]
Length=455

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP+P  VK+ +GE+L++  NYS+   HTGVMGLFYILVA  +P   S L++ 
Sbjct  357  YIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIGHTGVMGLFYILVAQQLPGPESSLQAH  414

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
                      +++  LAF+ + V    V++      RR  RE+ Y+ +
Sbjct  415  ---------SSSMSFLAFLAVTVAVAVVVLIVAVVYRRKNREDGYQSL  453



>ref|XP_002960631.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
 gb|EFJ38170.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
Length=448

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 11/101 (11%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGM+TC P+PGT+ +A GE L   S+YSS Q HTGVM +FY++V+D            
Sbjct  349  YVVGMSTCIPEPGTLMVASGEKLHFSSSYSSAQEHTGVMAIFYLMVSD---------NDT  399

Query  413  IKGGEMMILPNAILILAF-VGI-AVLGVAVIMSRRRGEREN  297
            +  GE+  + N + ++A  +GI A++ + V  S    +RE+
Sbjct  400  VSLGEVKDVKNRVNVMAVTLGIVAMVALVVRFSIWNKKRES  440



>ref|XP_004137076.1| PREDICTED: uncharacterized protein LOC101210001 [Cucumis sativus]
Length=541

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+V M+TCYP+PG+VK+ + E LT++S Y   Q+H GVMG F+I+VA  +P S
Sbjct  469  YVVEMSTCYPKPGSVKLNNKEMLTLISKYHPSQTHIGVMGFFHIMVAQKLPNS  521



>dbj|BAB10082.1| MtN19-like protein [Arabidopsis thaliana]
Length=517

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP    VK++ GE+LT+ SNYS+   HTGVMGLFYILVA  +PE  S L ++
Sbjct  376  YIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVGHTGVMGLFYILVAQQLPEPDSSLPNK  434



>ref|XP_010457823.1| PREDICTED: uncharacterized protein LOC104739234 [Camelina sativa]
Length=465

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGMT+CYP    VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE
Sbjct  362  YIVGMTSCYPA-APVKVSYGETLTLEVNYSSAVGHTGVMGLFYILVAQQLPE  412



>ref|XP_009150119.1| PREDICTED: uncharacterized protein LOC103873465 [Brassica rapa]
 emb|CDY00232.1| BnaA06g21330D [Brassica napus]
Length=469

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM++CYP    VK+  GE+LT+  NYSS   HTGVMGLFYILV   +PE  S L
Sbjct  366  YIVGMSSCYPDE-PVKVTSGETLTLEFNYSSAVGHTGVMGLFYILVTQQLPEQESSL  421



>ref|XP_002983407.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
 gb|EFJ15749.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
Length=400

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVAD  450
            Y+VGM+TC P+PGT+ +A GE L   S+YSS Q HTGVM +FY++V+D
Sbjct  336  YVVGMSTCIPEPGTLMVASGEKLHFSSSYSSAQEHTGVMAIFYLMVSD  383



>ref|XP_008453444.1| PREDICTED: uncharacterized protein LOC103494150 [Cucumis melo]
Length=414

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLR  420
            Y+VGM+TCYP+ G VKI+ GE  ++VS Y   Q+HTGVMG+F I+VA  +P S S + 
Sbjct  356  YVVGMSTCYPRLGHVKISKGEIGSLVSKYDHTQNHTGVMGIFSIVVATKLPNSLSHME  413



>ref|XP_010444012.1| PREDICTED: uncharacterized protein LOC104726772 [Camelina sativa]
Length=474

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 10/108 (9%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            Y+VGMT+CYP    VK++ GE+L++  NYSS   HTGVMGLFYILVA  +PE  S L + 
Sbjct  371  YVVGMTSCYPA-DPVKVSYGETLSLEVNYSSVVGHTGVMGLFYILVAQQLPEPESSLPNL  429

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
             +         ++ +LAF+ + VL   V++      RR  RE+ Y+ +
Sbjct  430  FQA-----HAESVSVLAFLAVTVLVAVVVLIAAVVYRRQNREDGYQSL  472



>ref|XP_006279767.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
 gb|EOA12665.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
Length=477

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM+TCYP    V+++ GE+L +  NYSS   HTGVMGLFYI+VA  +P+  SFL
Sbjct  374  YIVGMSTCYPT-DPVEVSYGETLNVEFNYSSAVGHTGVMGLFYIVVAQQLPKPESFL  429



>ref|XP_004137324.1| PREDICTED: uncharacterized protein LOC101215981 [Cucumis sativus]
Length=416

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLR  420
            YIVGM+TCYP+ G VKI  GE  + VS Y   Q+HTGVMG+F I+VA  +P S S + 
Sbjct  358  YIVGMSTCYPKLGDVKINKGEIGSFVSKYDPTQNHTGVMGIFSIVVATKLPNSLSHME  415



>ref|XP_004160434.1| PREDICTED: uncharacterized protein LOC101223324 [Cucumis sativus]
Length=416

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLR  420
            YIVGM+TCYP+ G VKI  GE  + VS Y   Q+HTGVMG+F I+VA  +P S S + 
Sbjct  358  YIVGMSTCYPKLGDVKINKGEIGSFVSKYDPTQNHTGVMGIFSIVVATKLPNSLSHME  415



>ref|XP_010483864.1| PREDICTED: uncharacterized protein LOC104762302 isoform X1 [Camelina 
sativa]
Length=471

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 64/115 (56%), Gaps = 24/115 (21%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM +CYP    VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE        
Sbjct  368  YIVGMASCYPA-DPVKVSYGETLTMEFNYSSAVGHTGVMGLFYILVAQQLPEPE------  420

Query  413  IKGGEMMILPN-------AILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
                  + LPN       ++ +LAF+ + V+   V++      RR  RE+ Y+ +
Sbjct  421  ------LSLPNLFQEPARSVSVLAFLAVTVVVAVVVLIAAVVYRRQNREDGYQSL  469



>ref|XP_010477840.1| PREDICTED: uncharacterized protein LOC104756879 [Camelina sativa]
Length=543

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGMT+CYP    VK++ GE+LT+  NYSS   HTGVMGLF +LVA  +PE +S L   
Sbjct  414  YIVGMTSCYPA-DPVKVSYGETLTMEFNYSSAVGHTGVMGLFCLLVAQQLPEPKSSLL--  470

Query  413  IKGGEMMILP-NAILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
                ++   P  ++ +LAF+ + VL V V++      RR  RE+ Y+ +
Sbjct  471  ----DLFQAPAGSVSVLAFLAVTVLVVVVVLIAAVIYRRKNREDGYQSL  515



>ref|XP_010457781.1| PREDICTED: uncharacterized protein LOC104739202 [Camelina sativa]
Length=472

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGMT+CYP    VK++ GE+L +  NYSS   HTGVMGLFYILVA  +PE
Sbjct  369  YIVGMTSCYPA-DPVKVSYGETLNMEFNYSSAVGHTGVMGLFYILVAQQLPE  419



>ref|XP_004513390.1| PREDICTED: uncharacterized protein LOC101513345 [Cicer arietinum]
Length=409

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+PG++KI DGE +T+ S Y S    TGVMG  YI +AD +PE+
Sbjct  351  YVVGMSTCYPEPGSIKIKDGEIVTMESRYKS-GYRTGVMGHMYIYLADRLPEN  402



>ref|XP_004497967.1| PREDICTED: uncharacterized protein LOC101492762 [Cicer arietinum]
Length=718

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+PG++KI DGE +T+ S Y S    TGVMG  YI + D +PE+
Sbjct  660  YVVGMSTCYPEPGSIKIKDGEIVTMESRYKSGY-RTGVMGHMYIYLVDRLPEN  711



>ref|XP_010483862.1| PREDICTED: uncharacterized protein LOC104762299 [Camelina sativa]
Length=475

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM +CYP    VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE
Sbjct  372  YIVGMASCYPA-DPVKVSYGETLTMEFNYSSAVGHTGVMGLFYILVAQQLPE  422



>ref|XP_010483865.1| PREDICTED: uncharacterized protein LOC104762302 isoform X2 [Camelina 
sativa]
Length=436

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGM +CYP    VK++ GE+LT+  NYSS   HTGVMGLFYILVA  +PE
Sbjct  368  YIVGMASCYPA-DPVKVSYGETLTMEFNYSSAVGHTGVMGLFYILVAQQLPE  418



>gb|AFK34663.1| unknown [Medicago truncatula]
Length=412

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+TCYP+PG++K+ DGE LT+   Y++   HTGVMG  Y LVA+ +P 
Sbjct  358  YVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIMHTGVMGHMYFLVAEKLPH  409



>ref|XP_003594548.1| MtN19 protein [Medicago truncatula]
Length=404

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+TCYP+PG++K+ DGE LT+   Y++   HTGVMG  Y LVA+ +P 
Sbjct  350  YVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIMHTGVMGHMYFLVAEKLPH  401



>gb|AES64799.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+TCYP+PG++K+ DGE LT+   Y++   HTGVMG  Y LVA+ +P 
Sbjct  358  YVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIMHTGVMGHMYFLVAEKLPH  409



>ref|XP_002866457.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42716.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGM++CYP    VK++ GE+L +  NYS+   HTGVMGLFYILVA  +PE  + L
Sbjct  372  YIVGMSSCYPA-DPVKVSYGETLKLEFNYSNDVGHTGVMGLFYILVAQQLPEPENSL  427



>ref|XP_004510129.1| PREDICTED: uncharacterized protein LOC101508405 [Cicer arietinum]
Length=423

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+PG++KI DGE +T+ S Y S    TG MG  YI +AD +PE+
Sbjct  365  YVVGMSTCYPEPGSIKIKDGEIVTMESRYKS-GYRTGAMGHMYIYLADRLPEN  416



>ref|XP_007134081.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
 gb|ESW06075.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
Length=413

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P+ 
Sbjct  358  YLVGMSVCYPKPGSIKIKDGEVLTLESIYEN-KFRTGAMGHFYIYLADQIPKK  409



>ref|XP_007134079.1| hypothetical protein PHAVU_010G0178001g, partial [Phaseolus vulgaris]
 gb|ESW06073.1| hypothetical protein PHAVU_010G0178001g, partial [Phaseolus vulgaris]
Length=149

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG +G FYI +AD +P+ 
Sbjct  94   YLVGMSVCYPKPGSIKIKDGEVLTLESIYEN-KFRTGAIGHFYIYLADQIPKK  145



>ref|XP_007134300.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
 gb|ESW06294.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
Length=413

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +A+ +P  
Sbjct  358  YLVGMSVCYPKPGSIKIKDGEILTVESRYEN-KFRTGAMGHFYIYLAEQIPNK  409



>ref|XP_006579112.1| PREDICTED: uncharacterized protein LOC100799740 [Glycine max]
Length=405

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM+ CYPQPG++KI DGE LT+ S Y + +  TG MG FYI +A+ +P+
Sbjct  355  YLIGMSVCYPQPGSIKIHDGEILTLESRYKN-EFRTGAMGHFYIYLAEELPQ  405



>gb|KHN44115.1| hypothetical protein glysoja_039253 [Glycine soja]
Length=124

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM  CYPQPG++KI D E LT+ S Y + + HTG M  FYI +A+ +P+
Sbjct  74   YVIGMFVCYPQPGSIKIHDAEILTLESKYKN-EFHTGAMRHFYIYLAEELPQ  124



>ref|XP_007134075.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
 gb|ESW06069.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
Length=425

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P +
Sbjct  370  YLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNN  421



>ref|XP_007132991.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
 gb|ESW04985.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
Length=389

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P  
Sbjct  334  YLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNK  385



>ref|XP_007134138.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
 gb|ESW06132.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
Length=413

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P  
Sbjct  358  YLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNK  409



>ref|XP_007137902.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
 gb|ESW09896.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
Length=399

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P  
Sbjct  344  YLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNK  395



>ref|XP_006574192.1| PREDICTED: uncharacterized protein LOC100820275 [Glycine max]
Length=562

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM+ CYPQPG++KI DGE LT+ S Y + +  TG MG FYI +A+ +P+
Sbjct  512  YLIGMSVCYPQPGSIKIHDGEILTLESRYKN-EFRTGAMGHFYIYLAEELPQ  562



>ref|XP_006574191.1| PREDICTED: uncharacterized protein LOC100818138, partial [Glycine 
max]
Length=282

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM+ CYPQPG +KI DGE LT+ S Y + +  TG MG FYI +A+ +P+
Sbjct  232  YLIGMSICYPQPGPIKIHDGEILTLESRYKN-EFRTGAMGHFYIYLAEELPQ  282



>gb|KHN44114.1| hypothetical protein glysoja_039252, partial [Glycine soja]
Length=347

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM+ CYPQPG +KI DGE LT+ S Y + +  TG MG FYI +A+ +P+
Sbjct  297  YLIGMSICYPQPGPIKIHDGEILTLESRYKN-EFRTGAMGHFYIYLAEELPQ  347



>ref|XP_007134084.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
 gb|ESW06078.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
Length=399

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y++GM+ CYP+PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P  
Sbjct  344  YLIGMSVCYPKPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNK  395



>ref|XP_010444011.1| PREDICTED: uncharacterized protein LOC104726771 [Camelina sativa]
Length=475

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFL  423
            YIVGMT+C P    VK++ GE+LT+  NYSS   HTGVMG+FY++VA  +PE  S L
Sbjct  372  YIVGMTSCNPA-DPVKVSYGETLTLEVNYSSAVGHTGVMGIFYMIVAQQLPEPESSL  427



>ref|XP_007134136.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
 gb|ESW06130.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
Length=413

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP PG++KI DGE LT+ S Y + +  TG MG FYI +AD +P  
Sbjct  358  YLVGMSVCYPTPGSIKIKDGEILTLESIYEN-KFRTGAMGHFYIYLADQIPNK  409



>ref|XP_007133892.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
 gb|ESW05886.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
Length=407

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y++GM+ CYPQPG++KI DGE LT+ S Y + +  TG MG FYI +A+ +P+
Sbjct  357  YLIGMSICYPQPGSIKINDGEILTLESRYVN-EFRTGAMGHFYIYLAENLPQ  407



>ref|XP_006577651.1| PREDICTED: uncharacterized protein LOC100806449 [Glycine max]
Length=460

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG++KI DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  410  YLVGMSGCYPKPGSIKIKDGEILTLETRYQN-KFRTGAMGFFYIHLAEQLPN  460



>ref|XP_004506757.1| PREDICTED: uncharacterized protein LOC101509765 [Cicer arietinum]
Length=423

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESR  432
            Y+V M+TCYP+PG++KI D E +T+ S Y S    TG MG  YI +AD +PE+R
Sbjct  365  YVVRMSTCYPEPGSIKIKDDEIVTMESRYKS-GYRTGAMGHMYIYLADRLPENR  417



>ref|XP_006280401.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
 gb|EOA13299.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
Length=477

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 10/108 (9%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YIVGM++CYP    VK+  GE+ T+  NYS+   HTGVMGLFYI+V+  +PE  S L + 
Sbjct  374  YIVGMSSCYPA-DPVKVDYGETFTLEVNYSNVVGHTGVMGLFYIVVSQQLPEPESSLPNL  432

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSR----RRGERENDYEPI  282
             +        +++  LAF+ + V+   V++      RR  RE+ Y+ +
Sbjct  433  FQA-----PASSVSFLAFLAVTVVVAVVVLISAVIYRRQNREDGYQSL  475



>gb|KHN18974.1| hypothetical protein glysoja_039898 [Glycine soja]
Length=414

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG++KI DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  364  YLVGMSGCYPKPGSIKIKDGEILTLETRYQN-KFRTGAMGFFYIHLAEQLPN  414



>ref|XP_004497966.1| PREDICTED: uncharacterized protein LOC101492429 [Cicer arietinum]
Length=423

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+TCYP+ G++KI DGE +T+ S Y S    TGVMG  YI +AD +PE+
Sbjct  365  YVVGMSTCYPELGSIKIKDGEIVTMESRYKS-GYRTGVMGHMYIYLADRLPEN  416



>ref|XP_007134296.1| hypothetical protein PHAVU_010G0353000g, partial [Phaseolus vulgaris]
 gb|ESW06290.1| hypothetical protein PHAVU_010G0353000g, partial [Phaseolus vulgaris]
Length=100

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVA  453
            Y+VGM+ CYP+PG+++I DGE LTI S Y + +  TG MG FYI +A
Sbjct  55   YLVGMSVCYPKPGSIQIKDGEILTIESRYEN-KFRTGAMGHFYIYLA  100



>ref|XP_006577556.1| PREDICTED: uncharacterized protein LOC102664794 [Glycine max]
 ref|XP_006577557.1| PREDICTED: uncharacterized protein LOC102664925 [Glycine max]
Length=411

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG+V+I DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  357  YLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KFRTGAMGFFYIHLAEQLPN  407



>gb|KHN15503.1| hypothetical protein glysoja_049065 [Glycine soja]
Length=404

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG+V+I DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  350  YLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KFRTGAMGFFYIHLAEQLPN  400



>ref|XP_006577555.1| PREDICTED: uncharacterized protein LOC102664678 [Glycine max]
Length=411

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG+V+I DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  357  YLVGMSGCYPKPGSVEIKDGEILTLETTYQN-KFRTGAMGFFYIHLAEQLPN  407



>ref|XP_003522144.2| PREDICTED: uncharacterized protein LOC100792489 [Glycine max]
Length=523

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            Y+VGM+ CYP+PG+V+I DGE LT+ + Y + +  TG MG FYI +A+ +P 
Sbjct  469  YLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KFRTGAMGFFYIHLAEQLPN  519



>ref|XP_010457757.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457764.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457771.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
Length=466

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            YIVGMT+CYP    VK++  E+LT+  NYSS   HTGVMGLF+I V   +PE
Sbjct  363  YIVGMTSCYPA-DPVKVSYEETLTLEVNYSSAVGHTGVMGLFHIFVVQQLPE  413



>ref|XP_006574193.1| PREDICTED: uncharacterized protein LOC102666323 [Glycine max]
Length=249

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  590  IVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPE  438
            ++GM+ CYPQPG++KI DGE LT+ S Y + +  TG MG F I +A+ +P+
Sbjct  200  LIGMSICYPQPGSIKIHDGEILTLESRYKN-EFRTGAMGHFNIYLAEELPQ  249



>gb|KHN17845.1| hypothetical protein glysoja_047764 [Glycine soja]
Length=405

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y+VGM+ CYP+PG+V+I DGE LT+ + Y + +  TG MG F+I +A+ +P  
Sbjct  350  YLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KFRTGAMGFFHIHLAEQLPNK  401



>ref|XP_006577472.1| PREDICTED: uncharacterized protein LOC100779893 [Glycine max]
Length=164

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            Y++GM  CYPQPG++KI DGE L + S Y + +  +G M  FYI +A+ +P
Sbjct  115  YLIGMFVCYPQPGSIKIHDGEILALESRYKN-EFCSGAMRHFYIYLAEELP  164



>gb|KHN42509.1| hypothetical protein glysoja_031445, partial [Glycine soja]
Length=153

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVP  441
            Y++GM  CYPQPG++KI DGE L + S Y + +  +G M  FYI +A+ +P
Sbjct  104  YLIGMFVCYPQPGSIKIHDGEILALESRYKN-EFCSGAMRHFYIYLAEELP  153



>ref|XP_004512657.1| PREDICTED: uncharacterized protein LOC101515735 [Cicer arietinum]
Length=415

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPES  435
            Y VGM+ CYP+P ++KI DGE +T+ S Y + +  TG MG  YI +AD +P +
Sbjct  363  YAVGMSVCYPKPDSIKINDGEIVTVESRYKN-EFLTGAMGHMYIYLADRLPHT  414



>gb|EJK60813.1| hypothetical protein THAOC_18774 [Thalassiosira oceanica]
Length=480

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 11/104 (11%)
 Frame = -2

Query  593  YIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLFYILVADPVPESRSFLRSQ  414
            YI  M++C   P  V +   E + +V  Y+S + H GVM LFYI V+D +P+    +RS+
Sbjct  380  YINSMSSCTFDPPLV-LRTTEKIRVVGKYNSSEPHQGVMSLFYIAVSD-MPQEPGDVRSR  437

Query  413  IKGGEMMILPNAILILAFVGIAVLGVAVIMSRRRGERENDYEPI  282
              GG       ++L+   VG+A+L  A I+  RR ++   Y+ +
Sbjct  438  THGG-------SVLVAMAVGLALL--AAILHWRRYDKRRQYDAV  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395