BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041P15

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011022825.1|  PREDICTED: lanC-like protein GCL1                  275   3e-87   Populus euphratica
emb|CDP01505.1|  unnamed protein product                                273   4e-86   Coffea canephora [robusta coffee]
ref|XP_002306296.2|  hypothetical protein POPTR_0005s07360g             272   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006466262.1|  PREDICTED: lanC-like protein GCL1-like             271   2e-85   Citrus sinensis [apfelsine]
ref|XP_002309963.2|  hypothetical protein POPTR_0007s05070g             270   3e-85   Populus trichocarpa [western balsam poplar]
ref|XP_011031065.1|  PREDICTED: lanC-like protein GCL1                  270   3e-85   Populus euphratica
gb|KDO60700.1|  hypothetical protein CISIN_1g013959mg                   269   9e-85   Citrus sinensis [apfelsine]
ref|XP_006426333.1|  hypothetical protein CICLE_v10025657mg             269   1e-84   Citrus clementina [clementine]
ref|XP_008387575.1|  PREDICTED: lanC-like protein GCL1                  269   1e-84   
ref|XP_004288166.1|  PREDICTED: lanC-like protein GCL1                  266   2e-83   Fragaria vesca subsp. vesca
ref|XP_007047870.1|  GCR2-like 1                                        264   7e-83   
gb|KDO60699.1|  hypothetical protein CISIN_1g013959mg                   264   9e-83   Citrus sinensis [apfelsine]
gb|KJB48858.1|  hypothetical protein B456_008G090400                    261   3e-82   Gossypium raimondii
emb|CAN83415.1|  hypothetical protein VITISV_029722                     262   5e-82   Vitis vinifera
gb|KDP29724.1|  hypothetical protein JCGZ_18659                         262   5e-82   Jatropha curcas
ref|XP_010652678.1|  PREDICTED: lanC-like protein GCL1 isoform X1       262   6e-82   Vitis vinifera
ref|XP_002268951.3|  PREDICTED: lanC-like protein GCL1                  262   6e-82   Vitis vinifera
ref|XP_002262692.1|  PREDICTED: lanC-like protein GCL1 isoform X2       262   6e-82   Vitis vinifera
ref|XP_009339587.1|  PREDICTED: lanC-like protein GCL1                  261   7e-82   Pyrus x bretschneideri [bai li]
ref|XP_008453808.1|  PREDICTED: lanC-like protein GCL1                  261   9e-82   Cucumis melo [Oriental melon]
ref|XP_002531667.1|  catalytic, putative                                261   1e-81   Ricinus communis
gb|KJB48857.1|  hypothetical protein B456_008G090400                    261   1e-81   Gossypium raimondii
ref|XP_009800854.1|  PREDICTED: lanC-like protein GCL1                  261   1e-81   Nicotiana sylvestris
ref|XP_004146876.1|  PREDICTED: lanC-like protein 2-like                261   1e-81   Cucumis sativus [cucumbers]
ref|XP_007207244.1|  hypothetical protein PRUPE_ppa006265m2g            252   3e-81   
emb|CBI33140.3|  unnamed protein product                                261   3e-81   Vitis vinifera
gb|KHG19988.1|  LanC-like protein 2                                     259   8e-81   Gossypium arboreum [tree cotton]
ref|XP_009605819.1|  PREDICTED: lanC-like protein GCL1                  259   8e-81   Nicotiana tomentosiformis
ref|XP_009365826.1|  PREDICTED: lanC-like protein GCL1                  259   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_008358138.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    258   2e-80   
ref|XP_004250112.1|  PREDICTED: lanC-like protein GCL1                  257   4e-80   Solanum lycopersicum
ref|XP_010025417.1|  PREDICTED: lanC-like protein GCL1                  257   4e-80   Eucalyptus grandis [rose gum]
ref|XP_010267103.1|  PREDICTED: lanC-like protein GCL1                  256   6e-80   
ref|XP_010680997.1|  PREDICTED: lanC-like protein GCL1                  256   1e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|ADU04157.1|  hypothetical protein                                    256   1e-79   Gossypium hirsutum [American cotton]
gb|ADU04150.1|  hypothetical protein                                    256   2e-79   Gossypium hirsutum [American cotton]
gb|KCW62074.1|  hypothetical protein EUGRSUZ_H04744                     256   2e-79   Eucalyptus grandis [rose gum]
ref|XP_011100038.1|  PREDICTED: lanC-like protein GCL1                  255   2e-79   Sesamum indicum [beniseed]
gb|AAF75794.1|AF272710_1  putative 7-transmembrane G-protein-coup...    254   5e-79   Solanum chacoense
ref|XP_006353211.1|  PREDICTED: lanC-like protein 2-like                254   6e-79   Solanum tuberosum [potatoes]
ref|XP_008235076.1|  PREDICTED: lanC-like protein GCL1                  254   6e-79   Prunus mume [ume]
emb|CDY08803.1|  BnaA06g24210D                                          253   1e-78   Brassica napus [oilseed rape]
gb|EYU30985.1|  hypothetical protein MIMGU_mgv1a006900mg                252   3e-78   Erythranthe guttata [common monkey flower]
ref|XP_002866662.1|  hypothetical protein ARALYDRAFT_358729             252   4e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_010519354.1|  PREDICTED: lanC-like protein GCL1                  251   7e-78   Tarenaya hassleriana [spider flower]
gb|KHN31391.1|  LanC-like protein 2                                     251   1e-77   Glycine soja [wild soybean]
emb|CDY55165.1|  BnaCnng28300D                                          247   1e-77   Brassica napus [oilseed rape]
ref|XP_009150615.1|  PREDICTED: lanC-like protein GCL1                  250   2e-77   Brassica rapa
ref|XP_010463250.1|  PREDICTED: lanC-like protein GCL1                  250   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_007163665.1|  hypothetical protein PHAVU_001G253500g             249   4e-77   Phaseolus vulgaris [French bean]
ref|XP_003552029.2|  PREDICTED: lanC-like protein GCL1-like             250   6e-77   Glycine max [soybeans]
ref|XP_010484384.1|  PREDICTED: lanC-like protein GCL1                  248   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010444546.1|  PREDICTED: lanC-like protein GCL1                  247   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006591493.1|  PREDICTED: lanC-like protein 2-like isoform X4     244   6e-76   Glycine max [soybeans]
ref|XP_006280490.1|  hypothetical protein CARUB_v10026430mg             246   6e-76   
ref|XP_003538606.1|  PREDICTED: lanC-like protein 2-like isoform X1     246   7e-76   Glycine max [soybeans]
ref|XP_006591491.1|  PREDICTED: lanC-like protein 2-like isoform X2     246   8e-76   Glycine max [soybeans]
gb|KHN44353.1|  LanC-like protein 2                                     246   8e-76   Glycine soja [wild soybean]
ref|XP_003601926.1|  G protein-coupled receptor-like protein            246   9e-76   Medicago truncatula
gb|KFK28210.1|  hypothetical protein AALP_AA8G486800                    243   2e-74   Arabis alpina [alpine rockcress]
ref|NP_201331.1|  protein GCR2-like 1                                   242   3e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96841.1|  G protein-coupled receptor-like protein                 242   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394052.1|  hypothetical protein EUTSA_v10004256mg             242   4e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004502406.1|  PREDICTED: lanC-like protein 2-like                241   4e-74   Cicer arietinum [garbanzo]
ref|XP_010937380.1|  PREDICTED: lanC-like protein GCL1                  233   1e-70   Elaeis guineensis
gb|ACU17850.1|  unknown                                                 209   8e-64   Glycine max [soybeans]
gb|ABK24484.1|  unknown                                                 214   1e-63   Picea sitchensis
emb|CBI38513.3|  unnamed protein product                                189   1e-57   Vitis vinifera
ref|XP_001776967.1|  predicted protein                                  190   2e-54   
ref|XP_001758715.1|  predicted protein                                  185   1e-52   
ref|XP_002982067.1|  hypothetical protein SELMODRAFT_115837             179   2e-52   
gb|KDO74128.1|  hypothetical protein CISIN_1g015433mg                   176   5e-51   Citrus sinensis [apfelsine]
ref|XP_004172119.1|  PREDICTED: lanC-like protein 2-like                177   1e-50   
ref|XP_002966453.1|  hypothetical protein SELMODRAFT_86123              180   1e-50   
gb|KDO74127.1|  hypothetical protein CISIN_1g015433mg                   176   4e-50   Citrus sinensis [apfelsine]
ref|XP_004141231.1|  PREDICTED: lanC-like protein 2-like                178   7e-50   Cucumis sativus [cucumbers]
ref|XP_006451926.1|  hypothetical protein CICLE_v10008488mg             177   2e-49   Citrus clementina [clementine]
gb|KDO74125.1|  hypothetical protein CISIN_1g015433mg                   177   2e-49   Citrus sinensis [apfelsine]
ref|XP_006464716.1|  PREDICTED: lanC-like protein GCR2-like             176   3e-49   Citrus sinensis [apfelsine]
gb|KDP27026.1|  hypothetical protein JCGZ_20961                         176   3e-49   Jatropha curcas
gb|KJB84322.1|  hypothetical protein B456_N018400                       173   4e-49   Gossypium raimondii
gb|KJB84323.1|  hypothetical protein B456_N018400                       173   9e-49   Gossypium raimondii
ref|XP_006827807.1|  hypothetical protein AMTR_s00009p00267750          174   1e-48   
gb|KFK35758.1|  hypothetical protein AALP_AA4G032600                    174   2e-48   Arabis alpina [alpine rockcress]
gb|KJB84324.1|  hypothetical protein B456_N018400                       174   2e-48   Gossypium raimondii
ref|XP_002534246.1|  catalytic, putative                                174   3e-48   Ricinus communis
ref|XP_003540453.1|  PREDICTED: lanC-like protein GCR2-like             173   4e-48   Glycine max [soybeans]
ref|XP_002284781.1|  PREDICTED: lanC-like protein GCR2                  173   4e-48   Vitis vinifera
gb|KHN28043.1|  LanC-like protein 2                                     173   4e-48   Glycine soja [wild soybean]
ref|XP_004244211.1|  PREDICTED: lanC-like protein GCL2                  173   5e-48   Solanum lycopersicum
ref|XP_003574129.2|  PREDICTED: lanC-like protein GCR2 isoform X2       174   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_010234867.1|  PREDICTED: lanC-like protein GCR2 isoform X1       174   5e-48   Brachypodium distachyon [annual false brome]
gb|KJB84326.1|  hypothetical protein B456_N018400                       173   5e-48   Gossypium raimondii
ref|XP_007021343.1|  G protein coupled receptor                         173   6e-48   
ref|XP_010918435.1|  PREDICTED: lanC-like protein GCL2 isoform X2       172   6e-48   
gb|KHG14999.1|  LanC-like protein 2                                     172   9e-48   Gossypium arboreum [tree cotton]
ref|XP_010918434.1|  PREDICTED: lanC-like protein GCL2 isoform X1       171   2e-47   Elaeis guineensis
ref|XP_007149603.1|  hypothetical protein PHAVU_005G083500g             172   3e-47   Phaseolus vulgaris [French bean]
ref|XP_008366750.1|  PREDICTED: lanC-like protein GCL2                  171   3e-47   Malus domestica [apple tree]
ref|XP_011042485.1|  PREDICTED: lanC-like protein GCR2                  171   5e-47   Populus euphratica
emb|CDP05888.1|  unnamed protein product                                170   6e-47   Coffea canephora [robusta coffee]
ref|XP_010099009.1|  hypothetical protein L484_025669                   170   7e-47   Morus notabilis
ref|XP_006661914.1|  PREDICTED: lanC-like protein GCR2-like             170   9e-47   
ref|XP_006348233.1|  PREDICTED: lanC-like protein 2-like                170   1e-46   Solanum tuberosum [potatoes]
ref|XP_006370294.1|  hypothetical protein POPTR_0001s41360g             170   1e-46   Populus trichocarpa [western balsam poplar]
gb|EMS68258.1|  LanC-like protein 2                                     170   1e-46   Triticum urartu
ref|XP_004244212.1|  PREDICTED: lanC-like protein GCR2                  169   2e-46   Solanum lycopersicum
ref|XP_006348234.1|  PREDICTED: lanC-like protein 2-like                169   2e-46   Solanum tuberosum [potatoes]
ref|XP_011098332.1|  PREDICTED: lanC-like protein GCR2                  169   3e-46   
gb|KEH38770.1|  G protein coupled receptor                              169   3e-46   Medicago truncatula
ref|XP_004291663.1|  PREDICTED: lanC-like protein GCR2                  168   3e-46   Fragaria vesca subsp. vesca
emb|CAJ86377.1|  OSIGBa0155K17.4                                        169   3e-46   Oryza sativa [red rice]
gb|ABB47829.2|  Lanthionine synthetase C-like protein, expressed        168   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007212308.1|  hypothetical protein PRUPE_ppa006721mg             168   3e-46   Prunus persica
ref|NP_001174024.1|  Os04g0529600                                       169   3e-46   
gb|KFK40450.1|  hypothetical protein AALP_AA3G374700                    168   3e-46   Arabis alpina [alpine rockcress]
gb|AES74528.2|  G protein coupled receptor                              169   3e-46   Medicago truncatula
ref|XP_011085355.1|  PREDICTED: lanC-like protein GCL2                  169   4e-46   Sesamum indicum [beniseed]
gb|ABB47830.2|  Lanthionine synthetase C-like protein, expressed        168   4e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EYU26400.1|  hypothetical protein MIMGU_mgv1a007259mg                168   4e-46   Erythranthe guttata [common monkey flower]
ref|XP_008452476.1|  PREDICTED: lanC-like protein GCL2 isoform X2       168   4e-46   Cucumis melo [Oriental melon]
ref|XP_008452475.1|  PREDICTED: lanC-like protein GCL2 isoform X1       168   5e-46   Cucumis melo [Oriental melon]
ref|XP_004514463.1|  PREDICTED: lanC-like protein 2-like                169   5e-46   
ref|XP_003618310.1|  LanC-like protein                                  169   6e-46   
gb|ABQ14360.1|  abscisic acid ABA receptor                              168   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_007132705.1|  hypothetical protein PHAVU_011G117700g             167   7e-46   Phaseolus vulgaris [French bean]
ref|XP_004487685.1|  PREDICTED: lanC-like protein 2-like                167   7e-46   Cicer arietinum [garbanzo]
gb|AAL58268.1|AC068923_10  putative lanthionine synthetase              168   8e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26581.1|  LanC-like protein 2                                     170   9e-46   
ref|NP_001149305.1|  LOC100282928                                       167   9e-46   
ref|NP_001064963.1|  Os10g0497900                                       168   1e-45   
tpg|DAA49457.1|  TPA: LOW QUALITY PROTEIN: lanC-like protein 2          167   1e-45   
gb|EAZ16566.1|  hypothetical protein OsJ_32039                          168   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009766748.1|  PREDICTED: lanC-like protein GCL2                  167   2e-45   Nicotiana sylvestris
ref|XP_002517941.1|  catalytic, putative                                167   2e-45   Ricinus communis
gb|AGV54199.1|  lanC-like protein                                       167   2e-45   Phaseolus vulgaris [French bean]
ref|XP_004982728.1|  PREDICTED: lanC-like protein 2-like                167   2e-45   
ref|XP_010462143.1|  PREDICTED: lanC-like protein GCR2                  166   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010245303.1|  PREDICTED: lanC-like protein GCL2                  166   3e-45   Nelumbo nucifera [Indian lotus]
gb|ACN31611.1|  unknown                                                 166   3e-45   Zea mays [maize]
ref|XP_008676974.1|  PREDICTED: LOC100282928 isoform X1                 166   3e-45   Zea mays [maize]
tpg|DAA49459.1|  TPA: hypothetical protein ZEAMMB73_373795              166   4e-45   
gb|KCW89517.1|  hypothetical protein EUGRSUZ_A01805                     160   4e-45   Eucalyptus grandis [rose gum]
ref|XP_008781994.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    162   5e-45   
ref|XP_008226665.1|  PREDICTED: lanC-like protein GCR2                  165   6e-45   Prunus mume [ume]
ref|XP_003539910.1|  PREDICTED: lanC-like protein GCL2-like             165   9e-45   Glycine max [soybeans]
ref|XP_002894411.1|  predicted protein                                  164   1e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_008809400.1|  PREDICTED: lanC-like protein GCL2                  164   1e-44   Phoenix dactylifera
ref|XP_009400288.1|  PREDICTED: lanC-like protein GCL2                  164   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009588409.1|  PREDICTED: lanC-like protein GCL2                  164   2e-44   Nicotiana tomentosiformis
ref|XP_010062888.1|  PREDICTED: lanC-like protein GCR2                  163   3e-44   Eucalyptus grandis [rose gum]
gb|KHG20582.1|  LanC-like protein 2                                     163   4e-44   Gossypium arboreum [tree cotton]
ref|XP_010542278.1|  PREDICTED: lanC-like protein GCR2                  163   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010675629.1|  PREDICTED: lanC-like protein GCR2                  162   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010500915.1|  PREDICTED: lanC-like protein GCR2                  162   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009400289.1|  PREDICTED: lanC-like protein GCL2                  162   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009343572.1|  PREDICTED: lanC-like protein GCR2                  162   6e-44   Pyrus x bretschneideri [bai li]
ref|XP_002884221.1|  hypothetical protein ARALYDRAFT_480913             162   7e-44   
emb|CDP14758.1|  unnamed protein product                                162   9e-44   Coffea canephora [robusta coffee]
ref|XP_006409014.1|  hypothetical protein EUTSA_v10002001mg             162   1e-43   Eutrema salsugineum [saltwater cress]
gb|AAG52264.1|AC019018_1  putative G protein-coupled receptor; 80...    161   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215460.1|  hypothetical protein PRUPE_ppa006408mg             162   1e-43   Prunus persica
ref|XP_006303704.1|  hypothetical protein CARUB_v10011802mg             161   1e-43   Capsella rubella
ref|XP_007043561.1|  GCR2-like 2 isoform 3                              159   1e-43   
ref|NP_175700.2|  G-protein coupled receptor 2                          161   1e-43   Arabidopsis thaliana [mouse-ear cress]
pdb|3T33|A  Chain A, Crystal Structure Of Arabidopsis Gcr2              161   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002263345.1|  PREDICTED: lanC-like protein GCL2                  160   3e-43   Vitis vinifera
ref|XP_010051804.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    161   3e-43   Eucalyptus grandis [rose gum]
gb|AGV54697.1|  lanC-like protein 2                                     160   3e-43   Phaseolus vulgaris [French bean]
gb|EYU26156.1|  hypothetical protein MIMGU_mgv1a007017mg                160   3e-43   Erythranthe guttata [common monkey flower]
emb|CAN64758.1|  hypothetical protein VITISV_008093                     160   3e-43   Vitis vinifera
gb|KDP24150.1|  hypothetical protein JCGZ_25807                         160   3e-43   Jatropha curcas
ref|XP_006299729.1|  hypothetical protein CARUB_v10015922mg             160   4e-43   Capsella rubella
gb|AAD20918.1|  hypothetical protein                                    158   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007043559.1|  GCR2-like 2 isoform 1                              159   1e-42   
ref|NP_850003.1|  protein GCR2-LIKE 2                                   159   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147647.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    159   2e-42   Brassica rapa
gb|KJB79968.1|  hypothetical protein B456_013G075200                    158   2e-42   Gossypium raimondii
ref|XP_009357824.1|  PREDICTED: lanC-like protein GCL2                  158   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_008229171.1|  PREDICTED: lanC-like protein GCL2                  157   5e-42   Prunus mume [ume]
ref|XP_010241999.1|  PREDICTED: lanC-like protein GCL2 isoform X3       156   9e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010241998.1|  PREDICTED: lanC-like protein GCL2 isoform X2       156   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010241996.1|  PREDICTED: lanC-like protein GCL2 isoform X1       156   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009767465.1|  PREDICTED: lanC-like protein GCL2 isoform X1       156   2e-41   Nicotiana sylvestris
ref|XP_009767466.1|  PREDICTED: lanC-like protein GCL2 isoform X2       156   2e-41   Nicotiana sylvestris
ref|XP_006392852.1|  hypothetical protein EUTSA_v10011533mg             155   2e-41   Eutrema salsugineum [saltwater cress]
emb|CDY05791.1|  BnaC07g00120D                                          152   2e-41   
ref|XP_010248544.1|  PREDICTED: lanC-like protein GCL1                  147   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008381258.1|  PREDICTED: lanC-like protein GCL2                  155   3e-41   
ref|XP_004248157.1|  PREDICTED: lanC-like protein GCL2 isoform X1       154   7e-41   Solanum lycopersicum
ref|XP_010555129.1|  PREDICTED: lanC-like protein GCL2                  154   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_010555131.1|  PREDICTED: lanC-like protein GCL2                  154   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_011045509.1|  PREDICTED: lanC-like protein GCL2                  154   1e-40   Populus euphratica
ref|XP_002467007.1|  hypothetical protein SORBIDRAFT_01g018190          153   4e-40   
ref|XP_010267752.1|  PREDICTED: uncharacterized protein LOC104604881    146   6e-40   
ref|XP_009617548.1|  PREDICTED: lanC-like protein GCL2 isoform X1       150   2e-39   Nicotiana tomentosiformis
ref|XP_009617549.1|  PREDICTED: lanC-like protein GCL2 isoform X2       150   2e-39   Nicotiana tomentosiformis
ref|XP_009102106.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    150   3e-39   Brassica rapa
ref|XP_010686440.1|  PREDICTED: lanC-like protein GCL2                  144   6e-37   Beta vulgaris subsp. vulgaris [field beet]
emb|CBG76444.1|  OO_Ba0013J05-OO_Ba0033A15.31                           140   3e-34   Oryza officinalis
gb|EFN72970.1|  LanC-like protein 1                                     129   9e-32   Camponotus floridanus
ref|XP_011268961.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    129   1e-31   
ref|XP_005658651.1|  PREDICTED: lanC-like protein 2-like                128   3e-31   
ref|XP_006757252.1|  PREDICTED: lanC-like protein 2                     124   5e-30   Myotis davidii
ref|XP_004018608.1|  PREDICTED: lanC-like protein 2                     124   7e-30   
ref|XP_006912141.1|  PREDICTED: lanC-like protein 2                     124   8e-30   
ref|XP_004602091.1|  PREDICTED: lanC-like protein 2                     124   8e-30   Sorex araneus [Eurasian shrew]
gb|ELK12680.1|  LanC-like protein 2                                     124   1e-29   Pteropus alecto
ref|XP_007463743.1|  PREDICTED: lanC-like protein 2                     123   1e-29   Lipotes vexillifer [baiji]
ref|XP_003744937.1|  PREDICTED: lanC-like protein 2-like                123   1e-29   
ref|XP_007118424.1|  PREDICTED: lanC-like protein 2                     124   1e-29   
emb|CDY26028.1|  BnaC06g05960D                                          123   1e-29   Brassica napus [oilseed rape]
ref|XP_006634360.1|  PREDICTED: lanC-like protein 2-like                123   2e-29   Lepisosteus oculatus
ref|XP_011215196.1|  PREDICTED: lanC-like protein 2 isoform X2          123   2e-29   
ref|XP_005695556.1|  PREDICTED: lanC-like protein 2                     124   2e-29   
ref|XP_011369800.1|  PREDICTED: lanC-like protein 2                     123   2e-29   Pteropus vampyrus
ref|XP_008701796.1|  PREDICTED: lanC-like protein 2                     123   2e-29   Ursus maritimus [white bear]
ref|XP_006074845.1|  PREDICTED: lanC-like protein 2                     123   2e-29   
ref|XP_002930203.1|  PREDICTED: lanC-like protein 2 isoform X1          123   2e-29   Ailuropoda melanoleuca
gb|EFB24809.1|  hypothetical protein PANDA_020566                       123   2e-29   Ailuropoda melanoleuca
ref|NP_001095726.1|  lanC-like protein 2                                123   2e-29   Bos taurus [bovine]
emb|CDY53809.1|  BnaA06g01740D                                          122   2e-29   Brassica napus [oilseed rape]
ref|XP_005904454.1|  PREDICTED: lanC-like protein 2                     123   2e-29   Bos mutus
ref|XP_005975688.1|  PREDICTED: lanC-like protein 2                     122   3e-29   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008148865.1|  PREDICTED: lanC-like protein 2                     122   4e-29   Eptesicus fuscus
ref|XP_797679.2|  PREDICTED: lanC-like protein 2-like                   121   7e-29   
ref|XP_004283055.1|  PREDICTED: lanC-like protein 2                     121   8e-29   Orcinus orca [Orca]
ref|NP_001133442.1|  LanC-like protein 2                                121   8e-29   Salmo salar
ref|XP_007187727.1|  PREDICTED: lanC-like protein 2                     120   1e-28   Balaenoptera acutorostrata scammoni
ref|XP_004668898.1|  PREDICTED: lanC-like protein 2                     120   1e-28   
gb|AAH04887.2|  LANCL2 protein                                          118   1e-28   Homo sapiens [man]
ref|XP_008506329.1|  PREDICTED: lanC-like protein 2                     120   1e-28   Equus przewalskii [Przewalski horse]
ref|XP_006219526.1|  PREDICTED: lanC-like protein 2-like                120   1e-28   
ref|XP_005609226.1|  PREDICTED: lanC-like protein 2                     120   1e-28   
ref|XP_007535283.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    120   2e-28   Erinaceus europaeus [common hedgehog]
ref|XP_010967451.1|  PREDICTED: lanC-like protein 2                     120   2e-28   Camelus bactrianus [camel]
ref|XP_008825772.1|  PREDICTED: lanC-like protein 2                     120   2e-28   Nannospalax galili
ref|XP_010995335.1|  PREDICTED: lanC-like protein 2                     120   2e-28   Camelus dromedarius [camel]
ref|XP_011173044.1|  PREDICTED: lanC-like protein 1 isoform X2          120   2e-28   Solenopsis invicta [imported red fire ant]
ref|XP_003406133.1|  PREDICTED: lanC-like protein 1 isoform X1          120   2e-28   Loxodonta africana [African bush elephant]
gb|EFZ09548.1|  hypothetical protein SINV_11015                         120   2e-28   
ref|XP_011173043.1|  PREDICTED: lanC-like protein 1 isoform X1          120   2e-28   Solenopsis invicta [imported red fire ant]
ref|XP_011173045.1|  PREDICTED: lanC-like protein 1 isoform X3          120   2e-28   Solenopsis invicta [imported red fire ant]
ref|XP_007423495.1|  PREDICTED: lanC-like protein 2                     120   2e-28   Python bivittatus
ref|XP_005676543.1|  PREDICTED: lanC-like protein 1 isoform X1          120   3e-28   
ref|XP_004004942.1|  PREDICTED: lanC-like protein 1                     119   3e-28   
ref|XP_004417378.1|  PREDICTED: lanC-like protein 2                     120   3e-28   Odobenus rosmarus divergens
ref|XP_005631064.1|  PREDICTED: lanC-like protein 2                     121   3e-28   Canis lupus familiaris [dogs]
ref|XP_006192458.1|  PREDICTED: lanC-like protein 2-like                120   3e-28   
ref|XP_009965174.1|  PREDICTED: lanC-like protein 1                     115   3e-28   Tyto alba [Schleiereule]
gb|KFR03137.1|  LanC-like 1                                             115   3e-28   Opisthocomus hoazin [hoatzin]
ref|XP_004739432.1|  PREDICTED: lanC-like protein 2 isoform X2          120   3e-28   Mustela putorius furo [black ferret]
gb|ABQ22465.1|  LanC-like protein 1-like protein                        116   3e-28   Callithrix jacchus [common marmoset]
ref|XP_007633708.1|  PREDICTED: lanC-like protein 2 isoform X2          119   3e-28   
ref|XP_009942935.1|  PREDICTED: lanC-like protein 1                     115   3e-28   Opisthocomus hoazin [hoatzin]
gb|ELU13947.1|  hypothetical protein CAPTEDRAFT_174165                  119   4e-28   Capitella teleta
ref|XP_005360945.1|  PREDICTED: lanC-like protein 2                     119   4e-28   Microtus ochrogaster [prairie voles]
ref|XP_006729895.1|  PREDICTED: lanC-like protein 2                     119   4e-28   Leptonychotes weddellii
ref|XP_010884003.1|  PREDICTED: lanC-like protein 2                     119   4e-28   Esox lucius
ref|XP_003470156.1|  PREDICTED: lanC-like protein 2                     119   4e-28   Cavia porcellus [guinea pig]
ref|XP_004694568.1|  PREDICTED: lanC-like protein 2                     119   4e-28   Condylura cristata
gb|ERE66398.1|  lanC-like protein 2                                     119   4e-28   Cricetulus griseus [Chinese hamsters]
gb|EGV91649.1|  LanC-like protein 2                                     119   5e-28   Cricetulus griseus [Chinese hamsters]
ref|XP_003378436.1|  conserved hypothetical protein                     119   5e-28   Trichinella spiralis
ref|XP_006236643.1|  PREDICTED: lanC-like protein 2 isoform X2          118   5e-28   Rattus norvegicus [brown rat]
ref|NP_598498.1|  lanC-like protein 2                                   119   6e-28   Mus musculus [mouse]
ref|XP_008143428.1|  PREDICTED: lanC-like protein 1                     119   6e-28   Eptesicus fuscus
ref|XP_007094861.1|  PREDICTED: lanC-like protein 2                     119   6e-28   Panthera tigris altaica
ref|XP_005672215.1|  PREDICTED: lanC-like protein 1-like                114   6e-28   
gb|KFV50828.1|  LanC-like 1                                             115   6e-28   Tyto alba [Schleiereule]
ref|XP_003504936.1|  PREDICTED: lanC-like protein 2 isoform X1          119   6e-28   Cricetulus griseus [Chinese hamsters]
ref|XP_003982670.1|  PREDICTED: lanC-like protein 2                     119   7e-28   Felis catus [cat]
ref|XP_008111107.1|  PREDICTED: lanC-like protein 2                     119   7e-28   Anolis carolinensis [Carolina anole]
ref|XP_005549615.1|  PREDICTED: lanC-like protein 2 isoform X2          118   7e-28   Macaca fascicularis [crab eating macaque]
gb|EHH52121.1|  Testis-specific adriamycin sensitivity protein          118   8e-28   Macaca fascicularis [crab eating macaque]
ref|XP_006236642.2|  PREDICTED: lanC-like protein 2 isoform X1          118   8e-28   
gb|KFO54122.1|  LanC-like 1                                             118   8e-28   Corvus brachyrhynchos
gb|EHH17302.1|  Testis-specific adriamycin sensitivity protein          118   8e-28   Macaca mulatta [rhesus macaque]
ref|XP_006148979.1|  PREDICTED: lanC-like protein 2                     118   9e-28   
ref|XP_004085762.1|  PREDICTED: lanC-like protein 2                     116   9e-28   
ref|NP_001039268.1|  LanC lantibiotic synthetase component C-like 2     118   9e-28   
ref|NP_001014209.1|  lanC-like protein 2                                118   9e-28   
ref|XP_010406143.1|  PREDICTED: lanC-like protein 1                     118   9e-28   
ref|XP_005049050.1|  PREDICTED: lanC-like protein 1 isoform X1          118   1e-27   
emb|CAD28471.1|  hypothetical protein                                   118   1e-27   
dbj|BAG63209.1|  unnamed protein product                                118   1e-27   
ref|XP_007979469.1|  PREDICTED: lanC-like protein 2 isoform X1          118   1e-27   
ref|XP_002197149.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
ref|XP_006050069.1|  PREDICTED: lanC-like protein 1 isoform X1          118   1e-27   
ref|XP_003896011.1|  PREDICTED: lanC-like protein 2 isoform X1          118   1e-27   
ref|XP_008260063.1|  PREDICTED: lanC-like protein 2 isoform X2          118   1e-27   
gb|AAI35989.1|  LOC734145 protein                                       118   1e-27   
dbj|BAG53147.1|  unnamed protein product                                118   1e-27   
ref|XP_008641803.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
ref|NP_061167.1|  lanC-like protein 2                                   118   1e-27   
gb|AAH70049.1|  LanC lantibiotic synthetase component C-like 2 (b...    118   1e-27   
ref|XP_004045515.1|  PREDICTED: lanC-like protein 2                     118   1e-27   
ref|XP_003318497.1|  PREDICTED: lanC-like protein 2                     118   1e-27   
ref|XP_002833100.1|  PREDICTED: lanC-like protein 2                     118   1e-27   
ref|XP_011137224.1|  PREDICTED: lanC-like protein 1 isoform X2          118   1e-27   
ref|XP_008068662.1|  PREDICTED: lanC-like protein 2                     117   1e-27   
ref|NP_001248105.1|  lanC-like protein 2                                118   1e-27   
ref|XP_011137223.1|  PREDICTED: lanC-like protein 1 isoform X1          118   1e-27   
ref|XP_003815868.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    118   1e-27   
ref|XP_010859418.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
ref|XP_005428015.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
ref|XP_006205316.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
gb|KFP61249.1|  LanC-like 1                                             117   1e-27   
ref|XP_005889054.1|  PREDICTED: lanC-like protein 1                     118   1e-27   
ref|XP_010330054.1|  PREDICTED: lanC-like protein 2 isoform X2          117   1e-27   
ref|NP_001069695.1|  lanC-like protein 1                                117   1e-27   
gb|ELR61273.1|  LanC-like protein 1                                     117   1e-27   
ref|XP_007939437.1|  PREDICTED: lanC-like protein 2                     118   2e-27   
ref|XP_006779000.1|  PREDICTED: lanC-like protein 1                     117   2e-27   
ref|XP_005969890.1|  PREDICTED: lanC-like protein 1 isoform X1          117   2e-27   
ref|XP_004582540.1|  PREDICTED: lanC-like protein 2                     117   2e-27   
ref|XP_008260062.1|  PREDICTED: lanC-like protein 2 isoform X1          117   2e-27   
ref|XP_004646693.1|  PREDICTED: lanC-like protein 2                     117   2e-27   
ref|XP_003943908.1|  PREDICTED: lanC-like protein 2 isoform X1          117   2e-27   
ref|XP_009704758.1|  PREDICTED: lanC-like protein 1                     117   2e-27   
ref|XP_005486943.1|  PREDICTED: lanC-like protein 1                     117   2e-27   
ref|XP_006861978.1|  PREDICTED: lanC-like protein 2                     117   2e-27   
ref|XP_001634261.1|  predicted protein                                  117   2e-27   
ref|XP_010711417.1|  PREDICTED: lanC-like protein 2                     117   2e-27   
gb|EOB04765.1|  LanC-like protein 2                                     117   2e-27   
gb|KFO85868.1|  LanC-like 1                                             115   2e-27   
ref|XP_007567618.1|  PREDICTED: lanC-like protein 1                     117   3e-27   
ref|XP_002196480.2|  PREDICTED: lanC-like protein 2                     113   3e-27   
dbj|BAE00722.1|  unnamed protein product                                116   3e-27   
ref|XP_010143672.1|  PREDICTED: lanC-like protein 1                     115   3e-27   
ref|XP_004384021.1|  PREDICTED: lanC-like protein 2                     117   3e-27   
ref|XP_008919586.1|  PREDICTED: lanC-like protein 2                     117   3e-27   
gb|KFP32110.1|  LanC-like 1                                             116   3e-27   
gb|KFW84735.1|  LanC-like 1                                             117   3e-27   
ref|XP_010201115.1|  PREDICTED: lanC-like protein 1                     116   3e-27   
ref|XP_006022339.1|  PREDICTED: lanC-like protein 1                     117   3e-27   
ref|XP_005014987.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    117   3e-27   
ref|XP_003733613.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    117   3e-27   
ref|XP_005802594.1|  PREDICTED: lanC-like protein 1-like                117   3e-27   
ref|XP_418874.2|  PREDICTED: lanC-like protein 2                        117   3e-27   
gb|KFP82892.1|  LanC-like 1                                             116   3e-27   
ref|XP_006190570.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_007124103.1|  PREDICTED: lanC-like protein 1-like                115   4e-27   
ref|XP_011356968.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_006992062.1|  PREDICTED: lanC-like protein 2-like                117   4e-27   
ref|XP_001605213.2|  PREDICTED: lanC-like protein 1 isoform X1          117   4e-27   
ref|XP_007500444.1|  PREDICTED: lanC-like protein 2                     117   4e-27   
ref|XP_002613417.1|  hypothetical protein BRAFLDRAFT_93787              116   4e-27   
ref|XP_007666849.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_008926719.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_003275065.1|  PREDICTED: lanC-like protein 2                     116   4e-27   
ref|XP_009565204.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_006276713.1|  PREDICTED: lanC-like protein 1                     116   4e-27   
ref|XP_003424467.1|  PREDICTED: lanC-like protein 2 isoform X2          116   4e-27   
ref|XP_009966730.1|  PREDICTED: lanC-like protein 2                     116   4e-27   
ref|XP_009980699.1|  PREDICTED: lanC-like protein 1                     116   5e-27   
ref|XP_004438431.1|  PREDICTED: lanC-like protein 2                     116   5e-27   
ref|XP_009075666.1|  PREDICTED: lanC-like protein 1                     116   5e-27   
gb|KFV14132.1|  LanC-like 1                                             116   6e-27   
ref|XP_004839897.1|  PREDICTED: lanC-like protein 2 isoform X2          115   6e-27   
ref|XP_010084089.1|  PREDICTED: lanC-like protein 1                     115   6e-27   
ref|XP_005874242.1|  PREDICTED: lanC-like protein 1                     116   6e-27   
ref|XP_001364295.2|  PREDICTED: lanC-like protein 1 isoform X1          116   6e-27   
ref|XP_005170667.1|  PREDICTED: lanC-like protein 2 isoform X1          116   6e-27   
ref|XP_005501752.1|  PREDICTED: lanC-like protein 1                     115   6e-27   
ref|XP_004262814.1|  PREDICTED: lanC-like protein 1                     115   6e-27   
ref|XP_006082817.1|  PREDICTED: lanC-like protein 1                     115   7e-27   
gb|KFO80625.1|  LanC-like 1                                             115   7e-27   
ref|XP_009810346.1|  PREDICTED: lanC-like protein 1                     115   7e-27   
gb|KGL84870.1|  LanC-like 1                                             115   7e-27   
ref|XP_009942928.1|  PREDICTED: lanC-like protein 1                     115   7e-27   
ref|XP_009491749.1|  PREDICTED: lanC-like protein 1                     115   7e-27   
ref|XP_010017204.1|  PREDICTED: lanC-like protein 2                     115   8e-27   
ref|XP_005528946.1|  PREDICTED: lanC-like protein 1                     115   8e-27   
gb|KFV99741.1|  LanC-like 1                                             115   8e-27   
ref|XP_007059434.1|  PREDICTED: lanC-like protein 2                     115   8e-27   
gb|EPY76822.1|  lanC-like protein                                       115   8e-27   
ref|XP_008997665.1|  PREDICTED: lanC-like protein 1 isoform X2          115   8e-27   
gb|KFQ56523.1|  LanC-like 1                                             115   8e-27   
gb|KFV02516.1|  LanC-like 1                                             115   9e-27   
ref|XP_007470076.1|  PREDICTED: lanC-like protein 1                     115   9e-27   
gb|KFV53555.1|  LanC-like 1                                             115   9e-27   
ref|XP_010311253.1|  PREDICTED: lanC-like protein 2                     115   9e-27   
ref|XP_009887721.1|  PREDICTED: lanC-like protein 2                     115   9e-27   
ref|NP_001076472.1|  lanC-like protein 2                                115   9e-27   
ref|XP_004033195.1|  PREDICTED: lanC-like protein 1 isoform 1           115   9e-27   
ref|XP_003215180.1|  PREDICTED: lanC-like protein 1                     115   9e-27   
emb|CAG12678.1|  unnamed protein product                                115   9e-27   
ref|XP_009896607.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
ref|XP_008489494.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
ref|XP_002749787.2|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
gb|KGL96810.1|  LanC-like 2                                             115   1e-26   
gb|KFR03138.1|  LanC-like 1                                             115   1e-26   
ref|XP_005144230.1|  PREDICTED: lanC-like protein 1                     115   1e-26   
ref|XP_007501858.1|  PREDICTED: lanC-like protein 1 isoform X2          115   1e-26   
ref|XP_006006846.1|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
ref|XP_007187922.1|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
ref|XP_004877353.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
gb|KFZ53917.1|  LanC-like 1                                             114   1e-26   
ref|XP_009566764.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
ref|XP_004839896.1|  PREDICTED: lanC-like protein 2 isoform X1          115   1e-26   
ref|XP_009501831.1|  PREDICTED: lanC-like protein 1                     114   1e-26   
ref|XP_003254074.1|  PREDICTED: lanC-like protein 1 isoform 1           115   1e-26   
ref|XP_010137609.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
ref|XP_005287377.1|  PREDICTED: lanC-like protein 2 isoform X4          115   1e-26   
gb|KFW90395.1|  LanC-like 1                                             115   1e-26   
ref|XP_003925633.1|  PREDICTED: lanC-like protein 1                     115   1e-26   
ref|XP_010224061.1|  PREDICTED: lanC-like protein 1                     115   1e-26   
ref|XP_010170999.1|  PREDICTED: lanC-like protein 1                     114   1e-26   
gb|KFQ34021.1|  LanC-like 1                                             113   1e-26   
ref|XP_010181071.1|  PREDICTED: lanC-like protein 1                     113   1e-26   
ref|XP_003762577.1|  PREDICTED: lanC-like protein 2                     115   1e-26   
gb|ETE64372.1|  LanC-like protein 1                                     115   1e-26   
ref|XP_004767073.1|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
ref|XP_004470258.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    115   1e-26   
gb|KFQ04380.1|  LanC-like 1                                             114   1e-26   
gb|KFP49501.1|  LanC-like 1                                             114   1e-26   
ref|XP_010159797.1|  PREDICTED: lanC-like protein 1                     114   1e-26   
ref|XP_004794591.1|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
ref|XP_005246300.1|  PREDICTED: lanC-like protein 1 isoform X1          115   1e-26   
gb|KFZ50821.1|  LanC-like 1                                             114   1e-26   
ref|XP_008167878.1|  PREDICTED: lanC-like protein 2 isoform X3          115   1e-26   
emb|CAG46576.1|  LANCL1                                                 115   1e-26   
dbj|BAG35299.1|  unnamed protein product                                115   1e-26   
gb|AAV38168.1|  LanC lantibiotic synthetase component C-like 1 (b...    115   2e-26   
ref|NP_006046.1|  lanC-like protein 1                                   115   2e-26   
ref|XP_006124173.1|  PREDICTED: lanC-like protein 2                     115   2e-26   
gb|AAX37077.1|  LanC lantibiotic synthetase component C-like 1          115   2e-26   
ref|XP_006872805.1|  PREDICTED: lanC-like protein 1                     115   2e-26   
ref|XP_003396315.1|  PREDICTED: lanC-like protein 2-like                115   2e-26   
pdb|3E6U|A  Chain A, Crystal Structure Of Human Lancl1                  115   2e-26   
ref|XP_007071974.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    115   2e-26   
ref|XP_005337466.1|  PREDICTED: lanC-like protein 2                     115   2e-26   
ref|XP_006908547.1|  PREDICTED: lanC-like protein 1 isoform X1          114   2e-26   
ref|XP_009575790.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_006127522.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_007524577.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_007233451.1|  PREDICTED: lanC-like protein 2                     115   2e-26   
ref|XP_005287375.1|  PREDICTED: lanC-like protein 2 isoform X2          115   2e-26   
gb|KFM08745.1|  LanC-like 1                                             114   2e-26   
ref|XP_010281072.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_009885875.1|  PREDICTED: lanC-like protein 1 isoform X2          114   2e-26   
ref|XP_006898659.1|  PREDICTED: lanC-like protein 2-like                115   2e-26   
ref|NP_001279355.1|  LanC lantibiotic synthetase component C-like 1     114   2e-26   
ref|XP_006022221.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
ref|XP_009877458.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
gb|AFK11162.1|  lanC-like protein 1                                     114   2e-26   
ref|XP_003491656.1|  PREDICTED: lanC-like protein 2-like                114   2e-26   
gb|KFQ71604.1|  LanC-like 1                                             114   2e-26   
gb|KFW04656.1|  LanC-like 1                                             114   2e-26   
gb|KFQ83337.1|  LanC-like 1                                             114   2e-26   
ref|XP_008576884.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
gb|KFP88412.1|  LanC-like 2                                             114   2e-26   
ref|XP_005041412.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
ref|XP_009460226.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
gb|KFQ90951.1|  LanC-like 1                                             114   2e-26   
ref|XP_010179314.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
ref|XP_009086433.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_005287374.1|  PREDICTED: lanC-like protein 2 isoform X1          114   2e-26   
ref|XP_006275683.1|  PREDICTED: lanC-like protein 2 isoform X2          114   2e-26   
ref|XP_010309333.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|XP_005941324.1|  PREDICTED: lanC-like protein 2-like isoform X2     114   2e-26   
ref|XP_003907950.1|  PREDICTED: lanC-like protein 1 isoform X2          114   2e-26   
ref|XP_005279741.1|  PREDICTED: lanC-like protein 1                     114   2e-26   
ref|NP_001245050.1|  lanC-like protein 1                                114   2e-26   
ref|XP_009677694.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
ref|XP_009080741.1|  PREDICTED: lanC-like protein 2                     114   2e-26   
gb|KFO33010.1|  LanC-like protein 2                                     114   2e-26   
ref|XP_005147051.1|  PREDICTED: lanC-like protein 2                     115   2e-26   
ref|XP_005574229.1|  PREDICTED: lanC-like protein 1 isoform X2          114   2e-26   
gb|KFV83634.1|  LanC-like 2                                             114   3e-26   
ref|XP_009946789.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009279358.1|  PREDICTED: lanC-like protein 1                     114   3e-26   
ref|XP_005747530.1|  PREDICTED: lanC-like protein 2-like isoform X3     114   3e-26   
ref|XP_009181236.1|  PREDICTED: lanC-like protein 1 isoform X1          114   3e-26   
gb|KFO15126.1|  LanC-like 1                                             114   3e-26   
ref|XP_008578632.1|  PREDICTED: lanC-like protein 1                     114   3e-26   
ref|XP_010114065.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009987546.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009820748.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009885874.1|  PREDICTED: lanC-like protein 1 isoform X1          114   3e-26   
ref|XP_005574228.1|  PREDICTED: lanC-like protein 1 isoform X1          114   3e-26   
ref|XP_010085360.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
gb|KGL95390.1|  LanC-like 1                                             114   3e-26   
gb|KFW01635.1|  LanC-like 2                                             114   3e-26   
ref|XP_010353221.1|  PREDICTED: lanC-like protein 1                     114   3e-26   
ref|XP_009941337.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009484901.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009572443.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
gb|KFU97310.1|  LanC-like 2                                             114   3e-26   
ref|XP_003455790.1|  PREDICTED: lanC-like protein 2 isoform X1          114   3e-26   
ref|XP_009703975.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
gb|KFP67740.1|  LanC-like 2                                             114   3e-26   
ref|XP_010148638.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_005674140.1|  PREDICTED: LanC lantibiotic synthetase compo...    114   3e-26   
ref|XP_009643058.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009500817.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_010162821.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_008934094.1|  PREDICTED: lanC-like protein 2                     114   3e-26   
ref|XP_009863709.1|  PREDICTED: lanC-like protein 2                     114   3e-26   



>ref|XP_011022825.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=423

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRF HSGNYP SEGNPRDKLVQW HGATG+ ITLCKAS++FPNDREFRDAAIE
Sbjct  265  TLRYMMSNRFCHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASEMFPNDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYHNA  ++  
Sbjct  325  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASGLVTI  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADHAYSLFQGLAG ACLWFDL+ P NSRFPGYE+
Sbjct  385  GHARG-ADHAYSLFQGLAGTACLWFDLLKPENSRFPGYEL  423



>emb|CDP01505.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYPVSEGNPRDKLVQWCHGATGIGITLCKAS+V P DREFR+AAIE
Sbjct  267  TLRYMMSNRFPRSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASEVLPTDREFRNAAIE  326

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY++RA+AF + LYH+  +    
Sbjct  327  AGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEDRAKAFANCLYHDQRNATTS  386

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            S   G ADHAYSLFQGLAGVACLWFDL+AP  S+FPGYEI
Sbjct  387  SPSTG-ADHAYSLFQGLAGVACLWFDLLAPEKSKFPGYEI  425



>ref|XP_002306296.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
 gb|EEE93292.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
Length=421

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKAS++FPNDREFR+AAIE
Sbjct  263  TLRYMMSNRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASEMFPNDREFRNAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY+ERA AF SFLYHNA +++  
Sbjct  323  AGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNASELVTI  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G A+HAYSLFQGLAG ACLWFDL+ P +SRFPGYE+
Sbjct  383  GDARG-ANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>ref|XP_006466262.1| PREDICTED: lanC-like protein GCL1-like [Citrus sinensis]
Length=431

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYPVSEGNPRDKLVQW HGATG+ ITLCKASQVFP+DREFRDAAIE
Sbjct  273  TLRYMMSNRFPQSGNYPVSEGNPRDKLVQWSHGATGVAITLCKASQVFPSDREFRDAAIE  332

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGNAYA LSLYRLTGE+IY ERA AF SFLYHNA +++  
Sbjct  333  AGEVVWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTS  392

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADH YSLFQGLAG AC+WFDL+ P N+RFPGYE+
Sbjct  393  GHAHG-ADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_002309963.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
 gb|EEE90413.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
Length=423

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRF HSGNYP SEGNPRDKLVQW HGATG+ ITLCKAS++FPNDREFRDAAIE
Sbjct  265  TLRYMMSNRFRHSGNYPSSEGNPRDKLVQWSHGATGMVITLCKASEMFPNDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKK GLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYHNA  ++  
Sbjct  325  AGEVVWKSGLVKKAGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASGLVTI  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADHAYSLFQGLAG ACLWFDL+ P +SRFPGYE+
Sbjct  385  GHARG-ADHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  423



>ref|XP_011031065.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=421

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYP SEGNPRDKLVQW HGAT + ITLCKAS++FPNDREFR+AAIE
Sbjct  263  TLRYMMSNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLCKASEMFPNDREFRNAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTGESIY+ERA AF SFLYHNA +++  
Sbjct  323  AGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNASELVTI  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G A+HAYSLFQGLAG ACLWFDL+ P +SRFPGYE+
Sbjct  383  GDARG-ANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>gb|KDO60700.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=431

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYPVSEGNPRDKLVQW HGATG+ ITLCKASQVFP+DREFRDAAIE
Sbjct  273  TLRYMMSNRFPQSGNYPVSEGNPRDKLVQWSHGATGVAITLCKASQVFPSDREFRDAAIE  332

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEV+WK+GLVKKVGLADG AGNAYA LSLYRLTGE+IY ERA AF SFLYHNA +++  
Sbjct  333  AGEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTS  392

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADH YSLFQGLAG AC+WFDL+ P N+RFPGYE+
Sbjct  393  GHTRG-ADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_006426333.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
 gb|ESR39573.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
Length=431

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYPVSEGNPRDKLVQW HGATG+ ITLCKASQVFP+DREFRDAAIE
Sbjct  273  TLRYMMSNRFPQSGNYPVSEGNPRDKLVQWSHGATGVAITLCKASQVFPSDREFRDAAIE  332

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEV+WK+GLVKKVGLADG AGNAYA LSLYRLTGE+IY ERA AF SFLYHNA +++  
Sbjct  333  AGEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTS  392

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADH YSLFQGLAG AC+WFDL+ P N+RFPGYE+
Sbjct  393  GHTRG-ADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_008387575.1| PREDICTED: lanC-like protein GCL1 [Malus domestica]
Length=423

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK VQW HGA G+ ITLCKASQVFP DREFRDAAIE
Sbjct  265  TLRYMMANRFPHSGNYPSSEGNPRDKFVQWSHGAAGMAITLCKASQVFPGDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGESIY+ERARAF SFLYHNAG+    
Sbjct  325  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERARAFASFLYHNAGEFATA  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G A++AYSLFQGLAG ACLWFDL  P NSRFPGYE+
Sbjct  385  GHTHG-AEYAYSLFQGLAGTACLWFDLYIPENSRFPGYEL  423



>ref|XP_004288166.1| PREDICTED: lanC-like protein GCL1 [Fragaria vesca subsp. vesca]
Length=427

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK VQW HGA G+ ITLCKASQVF  DR+FRDAAIE
Sbjct  268  TLRYMMANRFPHSGNYPSSEGNPRDKFVQWSHGAAGMAITLCKASQVFSGDRDFRDAAIE  327

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYHNA  ++  
Sbjct  328  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNARQLVTA  387

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q    A+HAYSLFQGLAG ACLWFD+  P NSRFPGYE+
Sbjct  388  GQTTHGAEHAYSLFQGLAGTACLWFDVHVPENSRFPGYEL  427



>ref|XP_007047870.1| GCR2-like 1 [Theobroma cacao]
 gb|EOX92027.1| GCR2-like 1 [Theobroma cacao]
Length=424

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+P++REFRDAAIE
Sbjct  266  TLRYMMSNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPSEREFRDAAIE  325

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGNAYA LSLYRLTGE+IY+ERA+AF SFLYHNA  ++  
Sbjct  326  AGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRLTGETIYEERAKAFASFLYHNARKLVNV  385

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G ADHAYSLFQGLAG ACLWFDL+ P NS+FPG+E+
Sbjct  386  GHACG-ADHAYSLFQGLAGTACLWFDLLEPQNSKFPGFEL  424



>gb|KDO60699.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=433

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQV--FPNDREFRDAA  458
            TLRYMM+NRFP SGNYPVSEGNPRDKLVQW HGATG+ ITLCKASQV  FP+DREFRDAA
Sbjct  273  TLRYMMSNRFPQSGNYPVSEGNPRDKLVQWSHGATGVAITLCKASQVSVFPSDREFRDAA  332

Query  457  IEAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIM  278
            IEAGEV+WK+GLVKKVGLADG AGNAYA LSLYRLTGE+IY ERA AF SFLYHNA +++
Sbjct  333  IEAGEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLV  392

Query  277  AGSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                  G ADH YSLFQGLAG AC+WFDL+ P N+RFPGYE+
Sbjct  393  TSGHTRG-ADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  433



>gb|KJB48858.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR+MM NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+PNDREFRDAAIE
Sbjct  231  TLRHMMCNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPNDREFRDAAIE  290

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGN YA LSLYRLTGE+IY+ERA+AF SFLYHN   +   
Sbjct  291  AGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKERAKAFASFLYHNKRKLAGI  350

Query  271  SQGDG-AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G G  AD  YSLFQGLAG ACLWFD++APH S+FPGYE+
Sbjct  351  EHGGGFGADDGYSLFQGLAGTACLWFDMLAPHKSKFPGYEL  391



>emb|CAN83415.1| hypothetical protein VITISV_029722 [Vitis vinifera]
Length=421

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIE
Sbjct  263  TLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SFLYHNAG ++  
Sbjct  323  AGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTV  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  383  GHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>gb|KDP29724.1| hypothetical protein JCGZ_18659 [Jatropha curcas]
Length=422

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 134/160 (84%), Gaps = 6/160 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+ RFP SGNYP SEGNPRDKLVQW HGAT + I+LCKASQVF NDREFR AAIE
Sbjct  269  TLRYMMSKRFPRSGNYPSSEGNPRDKLVQWSHGATAMAISLCKASQVFSNDREFRSAAIE  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGL DG AGNAYA LSLYRLTGESIY+ERA+AF SFLYHNA     G
Sbjct  329  AGEVVWKSGLVKKVGLFDGIAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASKFSTG  388

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                  ADH YSLFQGLAGVACLWFD++AP  SRFPGYE+
Sbjct  389  ------ADHVYSLFQGLAGVACLWFDILAPERSRFPGYEL  422



>ref|XP_010652678.1| PREDICTED: lanC-like protein GCL1 isoform X1 [Vitis vinifera]
Length=421

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIE
Sbjct  263  TLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SFLYHNAG ++  
Sbjct  323  AGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTV  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  383  GHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_002268951.3| PREDICTED: lanC-like protein GCL1 [Vitis vinifera]
Length=421

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIE
Sbjct  263  TLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SFLYHNAG ++  
Sbjct  323  AGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTV  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  383  GHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_002262692.1| PREDICTED: lanC-like protein GCL1 isoform X2 [Vitis vinifera]
Length=421

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIE
Sbjct  263  TLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SFLYHNAG ++  
Sbjct  323  AGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTV  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  383  GHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_009339587.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK VQW HGA G+ ITLCKASQVFP DREFRDAAIE
Sbjct  265  TLRYMMANRFPHSGNYPSSEGNPRDKFVQWSHGAAGMAITLCKASQVFPGDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYH AG+    
Sbjct  325  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYKERAKAFASFLYHKAGEFSTA  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  ++ YSLFQGLAG ACLWFDL  P NSRFPGYE+
Sbjct  385  GRTHG-VEYGYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_008453808.1| PREDICTED: lanC-like protein GCL1 [Cucumis melo]
Length=419

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATGIGITLCKASQVF  DREFRDAAIE
Sbjct  261  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWSHGATGIGITLCKASQVFHEDREFRDAAIE  320

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVK+VGLADG +GNAYA LSLYRLTGES+Y+ERARAFG++LYHNA  ++A 
Sbjct  321  AGEVVWKNGLVKEVGLADGVSGNAYAFLSLYRLTGESVYEERARAFGTYLYHNASKLVA-  379

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            +Q     D  +SLF GLAG ACLWFDL+ P  SRFPGYE+
Sbjct  380  NQNQVGGDRLFSLFHGLAGTACLWFDLLEPEKSRFPGYEL  419



>ref|XP_002531667.1| catalytic, putative [Ricinus communis]
 gb|EEF30711.1| catalytic, putative [Ricinus communis]
Length=432

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRF HSGNYP SEGNPRDKLVQW HGATG+ ITL KAS+VFPNDREFRDAAIE
Sbjct  276  TLRYMMSNRFLHSGNYPSSEGNPRDKLVQWSHGATGMAITLSKASEVFPNDREFRDAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSL+RLTG+ IY+ERA+AF SFLYHNA +I+  
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLFRLTGDIIYEERAKAFASFLYHNASEII--  393

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G    D AYSLF+GLAG ACLWFDL+AP  SRFPGYE+
Sbjct  394  -NGHVPGDDAYSLFKGLAGAACLWFDLLAPEKSRFPGYEL  432



>gb|KJB48857.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=429

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR+MM NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+PNDREFRDAAIE
Sbjct  269  TLRHMMCNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPNDREFRDAAIE  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGN YA LSLYRLTGE+IY+ERA+AF SFLYHN   +   
Sbjct  329  AGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKERAKAFASFLYHNKRKLAGI  388

Query  271  SQGDG-AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G G  AD  YSLFQGLAG ACLWFD++APH S+FPGYE+
Sbjct  389  EHGGGFGADDGYSLFQGLAGTACLWFDMLAPHKSKFPGYEL  429



>ref|XP_009800854.1| PREDICTED: lanC-like protein GCL1 [Nicotiana sylvestris]
Length=432

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HGATGI IT+CKAS+V  NDREFRDAAIE
Sbjct  274  TLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHGATGITITMCKASEVLSNDREFRDAAIE  333

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             GEVVWK+GLVKKVGLADG +GNAYA LSL+RLTGESIY+ERAR+F S LYHNA  IM  
Sbjct  334  GGEVVWKNGLVKKVGLADGASGNAYAFLSLFRLTGESIYEERARSFASCLYHNARTIM-N  392

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +    ADH+YSLFQGL GVAC  FDL+ P NSRFPGYE+
Sbjct  393  ERHHNEADHSYSLFQGLGGVACFLFDLLTPENSRFPGYEL  432



>ref|XP_004146876.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 ref|XP_004168242.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN53211.1| hypothetical protein Csa_4G026880 [Cucumis sativus]
Length=419

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEG+PRDKLVQW HGATGIGITLCKASQVF  DREFRDAAIE
Sbjct  261  TLRYLMSKRFPHSGNYPSSEGSPRDKLVQWSHGATGIGITLCKASQVFHEDREFRDAAIE  320

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVK+VGLADG AGNAYA LSLYRLTGES+Y+ERARAFG++LYHNA  ++A 
Sbjct  321  AGEVVWKNGLVKEVGLADGVAGNAYAFLSLYRLTGESVYEERARAFGTYLYHNASKLVA-  379

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            +Q     D  +SLF GLAG ACLWFDL+ P  SRFPGYE+
Sbjct  380  TQNQVGGDRLFSLFHGLAGTACLWFDLLEPEKSRFPGYEL  419



>ref|XP_007207244.1| hypothetical protein PRUPE_ppa006265m2g, partial [Prunus persica]
 gb|EMJ08443.1| hypothetical protein PRUPE_ppa006265m2g, partial [Prunus persica]
Length=184

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK V W HGA G+ ITLCKASQVFP DREFR AAIE
Sbjct  26   TLRYMMANRFPHSGNYPSSEGNPRDKFVHWSHGAAGMAITLCKASQVFPGDREFRHAAIE  85

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGE+IY+ RA+AF SFLYHN  +++  
Sbjct  86   AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGEAIYEGRAKAFASFLYHNGRELVTV  145

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G A+HAYSLFQGLAG ACL FDL  P N+RFPGYE+
Sbjct  146  GDTHG-AEHAYSLFQGLAGTACLLFDLHVPENARFPGYEL  184



>emb|CBI33140.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIE
Sbjct  309  TLRYMRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIE  368

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SFLYHNAG ++  
Sbjct  369  AGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTV  428

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  +HAYSLFQGLAG ACL FDL++P NSRFPGYE+
Sbjct  429  GHA-GTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  467



>gb|KHG19988.1| LanC-like protein 2 [Gossypium arboreum]
Length=432

 Score =   259 bits (662),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR+MM NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+PNDREFRDAAIE
Sbjct  272  TLRHMMCNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPNDREFRDAAIE  331

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGN YA LSLYRLTGE+IY++RA+AF SFLYHN   +   
Sbjct  332  AGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKDRAKAFASFLYHNKRKLAGI  391

Query  271  SQGDG-AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G G  AD  YSLFQGLAG ACLWFD++APH S+FPGYE+
Sbjct  392  EHGGGFRADDEYSLFQGLAGTACLWFDMLAPHKSKFPGYEL  432



>ref|XP_009605819.1| PREDICTED: lanC-like protein GCL1 [Nicotiana tomentosiformis]
Length=430

 Score =   259 bits (662),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HGATGI IT+CKAS+V  NDREFRDAAIE
Sbjct  272  TLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHGATGITITMCKASEVLSNDREFRDAAIE  331

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             GEVVWK+GLVKKVGLADG +G AYA LSL+RLTGESIY+ERARAF S LYHNA  IM  
Sbjct  332  GGEVVWKNGLVKKVGLADGASGIAYAFLSLFRLTGESIYEERARAFASCLYHNARTIM-N  390

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +    ADH+YSLFQGL GVAC  FDL+ P NSRFPGYE+
Sbjct  391  ERHHNEADHSYSLFQGLGGVACFLFDLLTPENSRFPGYEL  430



>ref|XP_009365826.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   259 bits (661),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFP SGNYP SEGNPRDK VQW HGA G+ ITLCKASQVFP DREFRDAAIE
Sbjct  265  TLRYMMANRFPRSGNYPSSEGNPRDKFVQWSHGAAGMAITLCKASQVFPGDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYH AG+    
Sbjct  325  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHKAGEFSTA  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  ++ YSLFQGLAG ACLWFDL  P NSRFPGYE+
Sbjct  385  GRTHG-VEYGYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_008358138.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL1 [Malus 
domestica]
Length=423

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK VQW HGA G+ ITLCKASQV P DREFRDAAIE
Sbjct  265  TLRYMMANRFPHSGNYPSSEGNPRDKFVQWSHGAAGMAITLCKASQVXPGDREFRDAAIE  324

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGESIY+ERA+AF SFLYH AG+    
Sbjct  325  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHXAGEFSIA  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  ++ YSLFQGLAG ACLWFDL  P NSRFPGYE+
Sbjct  385  GRTHG-VEYVYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_004250112.1| PREDICTED: lanC-like protein GCL1 [Solanum lycopersicum]
Length=424

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HGATGI IT+CK S+V  +DREFRDAAIE
Sbjct  266  TLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHGATGITITMCKVSKVLSDDREFRDAAIE  325

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             GEVVWKSGLV+KVGLADG +GNAYA LSLYRLTGESIY+ERA+AF S LY NA  IM  
Sbjct  326  GGEVVWKSGLVEKVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIM-N  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +    ADH+YSLFQGL GVAC  FDL+AP NSRFPG+E+
Sbjct  385  EREHNEADHSYSLFQGLGGVACFLFDLLAPKNSRFPGFEL  424



>ref|XP_010025417.1| PREDICTED: lanC-like protein GCL1 [Eucalyptus grandis]
Length=430

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKASQVFP+DR+FRDAAIE
Sbjct  272  TLRYIMSKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASQVFPHDRDFRDAAIE  331

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG +GNAYA LSLYRLTGE IY++RARAF SFLYH+A   +  
Sbjct  332  AGEVVWKNGLVKKVGLADGISGNAYAFLSLYRLTGERIYEDRARAFASFLYHDANKPVGT  391

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G   AD+A+SL+QGLAG ACLWFDL+   NSRFPGYE+
Sbjct  392  GHGH-VADYAFSLYQGLAGAACLWFDLVDAENSRFPGYEL  430



>ref|XP_010267103.1| PREDICTED: lanC-like protein GCL1 [Nelumbo nucifera]
Length=421

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            T RYMM NRFP SGNYP SEGNPRD LVQW HGATG+ ITLC A+QVF  DREFRDAAIE
Sbjct  263  TFRYMMKNRFPRSGNYPSSEGNPRDNLVQWSHGATGMAITLCNAAQVFSCDREFRDAAIE  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLV+KVGL+DG +GNAYA LSLYRLTG++IYQ+RA AF SFLYHNAG ++  
Sbjct  323  AGEVVWKNGLVRKVGLSDGVSGNAYAFLSLYRLTGKTIYQKRAEAFASFLYHNAGRLVTA  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                   DHAYSLFQGLAGVACLWFDL++P NSRFPGYE+
Sbjct  383  GHVR-RNDHAYSLFQGLAGVACLWFDLVSPENSRFPGYEL  421



>ref|XP_010680997.1| PREDICTED: lanC-like protein GCL1 [Beta vulgaris subsp. vulgaris]
Length=433

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFP SGNYP S+GNPRD L+QW HGATG+ ITLCKASQVFPN+REFRD AIE
Sbjct  274  TLRYLMSKRFPESGNYPSSDGNPRDNLIQWSHGATGVAITLCKASQVFPNEREFRDGAIE  333

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKK GLADG AGNAYA LSLY+LTGE +Y ERA+AF SFLYH   +++  
Sbjct  334  AGEVVWKSGLVKKAGLADGVAGNAYAFLSLYKLTGEVVYVERAKAFASFLYHKGSEVVNA  393

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  DHAYSLF GLAGVACL+FDL+ P NS+FPGYE+
Sbjct  394  EEYPGGTDHAYSLFLGLAGVACLFFDLLHPENSKFPGYEL  433



>gb|ADU04157.1| hypothetical protein [Gossypium hirsutum]
Length=429

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR+MM NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+PNDREFRDAAIE
Sbjct  269  TLRHMMCNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPNDREFRDAAIE  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGN YA LSLYRLTGE+IY+ERA+AF SFLYHN   +   
Sbjct  329  AGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKERAKAFASFLYHNKRKLAGI  388

Query  271  SQGDG-AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G G  AD  YSLFQGLAG ACLWFD++ P  S+FPGYE+
Sbjct  389  EHGGGFGADDGYSLFQGLAGTACLWFDMLVPLKSKFPGYEL  429



>gb|ADU04150.1| hypothetical protein [Gossypium hirsutum]
Length=432

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR+MM NRFPHSGNYP SEGNPRDKLVQW HGAT + ITL KASQV+PNDREFRDAAIE
Sbjct  272  TLRHMMCNRFPHSGNYPSSEGNPRDKLVQWSHGATSMAITLAKASQVYPNDREFRDAAIE  331

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGN YA LSLYRLTGE+IY+ RA+AF SFLYHN   +   
Sbjct  332  AGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKYRAKAFASFLYHNKRKLAGI  391

Query  271  SQGDG-AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G G  A+  YSLFQGLAG ACLWFD++APH S+FPGYE+
Sbjct  392  EHGGGFRANDEYSLFQGLAGTACLWFDMLAPHKSKFPGYEL  432



>gb|KCW62074.1| hypothetical protein EUGRSUZ_H04744 [Eucalyptus grandis]
Length=472

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITLCKASQVFP+DR+FRDAAIE
Sbjct  314  TLRYIMSKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLCKASQVFPHDRDFRDAAIE  373

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG +GNAYA LSLYRLTGE IY++RARAF SFLYH+A   +  
Sbjct  374  AGEVVWKNGLVKKVGLADGISGNAYAFLSLYRLTGERIYEDRARAFASFLYHDANKPVGT  433

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G   AD+A+SL+QGLAG ACLWFDL+   NSRFPGYE+
Sbjct  434  GHGH-VADYAFSLYQGLAGAACLWFDLVDAENSRFPGYEL  472



>ref|XP_011100038.1| PREDICTED: lanC-like protein GCL1 [Sesamum indicum]
Length=427

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRD+LVQW HGA+GI +TLCKAS+V P+DREFRDAAIE
Sbjct  269  TLRYMMSNRFPHSGNYPVSEGNPRDRLVQWSHGASGIAVTLCKASEVLPSDREFRDAAIE  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADGTAGNAYA LSL RLTGESIY+ERA AF S+LYH+A   +  
Sbjct  329  AGEVVWKSGLVKKVGLADGTAGNAYAFLSLLRLTGESIYKERATAFASYLYHSATKTIT-  387

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              G   A+HA SLF GLAG ACLWFDL    ++RFPGYEI
Sbjct  388  ENGSVGAEHACSLFHGLAGAACLWFDLHRQEDTRFPGYEI  427



>gb|AAF75794.1|AF272710_1 putative 7-transmembrane G-protein-coupled receptor [Solanum 
chacoense]
Length=424

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HGATGI IT+CK S+V  +DREFR AAIE
Sbjct  266  TLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHGATGITITMCKVSEVLSDDREFRGAAIE  325

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             GEVVWKSGLV++VGLADG +GNAYA LSLYRLTGESIY+ERA+AF S LY NA  IM  
Sbjct  326  GGEVVWKSGLVERVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIM-N  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +    ADH+YSLFQGL GVAC  FDL+AP NSRFPGYE+
Sbjct  385  ERHHNEADHSYSLFQGLGGVACFLFDLLAPKNSRFPGYEL  424



>ref|XP_006353211.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=424

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFPHSGNYPVSEGNPRDKLVQW HGATGI IT+CK S+V  +DREFR AAIE
Sbjct  266  TLRYMMSNRFPHSGNYPVSEGNPRDKLVQWSHGATGITITMCKVSEVLSDDREFRGAAIE  325

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             GEVVWKSGLV++VGLADG +GNAYA LSLYRLTGESIY+ERA+AF S LY NA  IM  
Sbjct  326  GGEVVWKSGLVERVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIM-N  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +    ADH+YSLFQGL GVAC  FDL+AP NSRFPGYE+
Sbjct  385  ERHHNEADHSYSLFQGLGGVACFLFDLLAPKNSRFPGYEL  424



>ref|XP_008235076.1| PREDICTED: lanC-like protein GCL1 [Prunus mume]
Length=425

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFPHSGNYP SEGNPRDK V W HGA G+ ITLCKASQVFP DREFRDAAIE
Sbjct  267  TLRYMMANRFPHSGNYPSSEGNPRDKFVHWSHGAAGMAITLCKASQVFPGDREFRDAAIE  326

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GL+KKVGLADG AGNAYA LSLYRLTGE+IY+ RA+AF SFLYHN  +++  
Sbjct  327  AGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGETIYEGRAKAFASFLYHNGRELVTV  386

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G A+HAYSLFQGLAG ACL FDL  P N+RFPGYE+
Sbjct  387  GDTHG-AEHAYSLFQGLAGTACLLFDLHMPENARFPGYEL  425



>emb|CDY08803.1| BnaA06g24210D [Brassica napus]
Length=430

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  273  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  332

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ 
Sbjct  333  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARELVSA  392

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            + G+  A+H YSLF+GLAG ACLWFDL++P +S+FPGYEI
Sbjct  393  TMGE--AEHDYSLFRGLAGPACLWFDLVSPVDSKFPGYEI  430



>gb|EYU30985.1| hypothetical protein MIMGU_mgv1a006900mg [Erythranthe guttata]
Length=427

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+ R P SGNYPVSEG+ RD+LVQW HGA G+ ITLCKASQVFPNDREFRDAAIE
Sbjct  267  TLRYMMSKRDPQSGNYPVSEGHTRDELVQWSHGAGGLAITLCKASQVFPNDREFRDAAIE  326

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADGTAGNAYA LSL RLTGE +Y+ERA +F S+LYH+A  IMAG
Sbjct  327  AGEVVWKSGLVKKVGLADGTAGNAYALLSLLRLTGERVYEERAESFASYLYHSARKIMAG  386

Query  271  SQGDGAA-DHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  GA+ D  YSLFQG AG ACL+FDL+ P NSRFPGYEI
Sbjct  387  GEYSGASEDLDYSLFQGFAGSACLFFDLLKPENSRFPGYEI  427



>ref|XP_002866662.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42921.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  277  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  336

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A D+M  
Sbjct  337  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVLYEERAKAFASYLCHDARDLMNM  396

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            ++ +  A+H YSLF+GLAG  CLWFDL++P +SRFPGYEI
Sbjct  397  TRQE--AEHDYSLFRGLAGPVCLWFDLVSPVDSRFPGYEI  434



>ref|XP_010519354.1| PREDICTED: lanC-like protein GCL1 [Tarenaya hassleriana]
Length=428

 Score =   251 bits (642),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYP SEGNPRDKLVQW HGAT + ITL KASQVFPN+REFRDAAIE
Sbjct  275  TLRYMMSNRFPQSGNYPCSEGNPRDKLVQWAHGATCMAITLSKASQVFPNEREFRDAAIE  334

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW +GLVKKVGLADG AGNAYA LSL+RLTG+ IY+ERA AF S+L HNA D++  
Sbjct  335  AGEVVWNNGLVKKVGLADGVAGNAYAFLSLFRLTGDRIYEERAIAFASYLCHNARDLVEN  394

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            S+      HAYSLF+GLAG ACLWFDL+ P +SRFPGYEI
Sbjct  395  SE------HAYSLFRGLAGAACLWFDLVRPESSRFPGYEI  428



>gb|KHN31391.1| LanC-like protein 2 [Glycine soja]
Length=419

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL Y+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA++VFPNDRE RDAAIE
Sbjct  268  TLWYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAEVFPNDRELRDAAIE  327

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SFLY NA  +   
Sbjct  328  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFLYDNAKSL---  384

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 AA + YSLFQGLAG ACLWFDL+AP NSRFPGYE+
Sbjct  385  -----AAANGYSLFQGLAGTACLWFDLLAPDNSRFPGYEL  419



>emb|CDY55165.1| BnaCnng28300D [Brassica napus]
Length=303

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGN RDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  146  TLRYMMSNRFPNSGNYPCSEGNRRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  205

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+  ++++ 
Sbjct  206  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDGRELVSA  265

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            + G+  A+H YSLF+GLAG ACLWFDL++P +S+FPGYEI
Sbjct  266  TMGE--AEHDYSLFRGLAGPACLWFDLVSPVDSKFPGYEI  303



>ref|XP_009150615.1| PREDICTED: lanC-like protein GCL1 [Brassica rapa]
Length=433

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  276  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ 
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARELVSA  395

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            + G+  A++ YSLF+GLAG ACLWFDL++P +S+FPGYEI
Sbjct  396  TMGE--AEYDYSLFRGLAGPACLWFDLVSPVDSKFPGYEI  433



>ref|XP_010463250.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=435

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  277  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPRERDFREAAIE  336

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  
Sbjct  337  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDM  396

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            S+ +  A+H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  397  SRQE-EAEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  435



>ref|XP_007163665.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
 gb|ESW35659.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
Length=409

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 132/160 (83%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  258  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  317

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLY+LT ESIY ERA++F SFLY NA  +   
Sbjct  318  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYQLTKESIYLERAKSFASFLYDNAKSL---  374

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 A  + YSLFQGLAG ACLWFDL AP NSRFPGYE+
Sbjct  375  -----APSNGYSLFQGLAGTACLWFDLHAPQNSRFPGYEL  409



>ref|XP_003552029.2| PREDICTED: lanC-like protein GCL1-like [Glycine max]
Length=452

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL Y+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA++VFPNDRE RDAAIE
Sbjct  301  TLWYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAEVFPNDRELRDAAIE  360

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SFLY NA  +   
Sbjct  361  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFLYDNAKSL---  417

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 AA + YSLFQGLAG ACLWFDL+AP NSRFPGYE+
Sbjct  418  -----AAANGYSLFQGLAGTACLWFDLLAPDNSRFPGYEL  452



>ref|XP_010484384.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=434

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPR+KLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  277  TLRYMMSNRFPNSGNYPCSEGNPRNKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  336

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  
Sbjct  337  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDM  396

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            S+ +  A+H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  397  SRQE--AEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  434



>ref|XP_010444546.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=433

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  276  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A D++  
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARDLLDM  395

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            S+ +  A+H YSLF+GLAG  CLWFDL++P +S+FPGY I
Sbjct  396  SRQE--AEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYMI  433



>ref|XP_006591493.1| PREDICTED: lanC-like protein 2-like isoform X4 [Glycine max]
Length=350

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  199  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  258

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +   
Sbjct  259  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL---  315

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 A+ + YSL QGLAG  CLWFDL+AP +SRFPGYE+
Sbjct  316  -----ASANGYSLSQGLAGTVCLWFDLLAPDSSRFPGYEL  350



>ref|XP_006280490.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
 gb|EOA13388.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
Length=435

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ +TL KASQVFPN+R+FR+AAIE
Sbjct  278  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAVTLAKASQVFPNERDFREAAIE  337

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L H+A ++++ 
Sbjct  338  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDAVELVSM  397

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            ++ +   +H YSLF+GLAG  CLW DL++P +S+FPGYEI
Sbjct  398  TRQE--TEHDYSLFRGLAGPVCLWLDLVSPVDSKFPGYEI  435



>ref|XP_003538606.1| PREDICTED: lanC-like protein 2-like isoform X1 [Glycine max]
Length=412

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  261  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  320

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +   
Sbjct  321  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL---  377

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 A+ + YSL QGLAG  CLWFDL+AP +SRFPGYE+
Sbjct  378  -----ASANGYSLSQGLAGTVCLWFDLLAPDSSRFPGYEL  412



>ref|XP_006591491.1| PREDICTED: lanC-like protein 2-like isoform X2 [Glycine max]
 ref|XP_006591492.1| PREDICTED: lanC-like protein 2-like isoform X3 [Glycine max]
Length=413

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  262  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  321

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +   
Sbjct  322  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL---  378

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 A+ + YSL QGLAG  CLWFDL+AP +SRFPGYE+
Sbjct  379  -----ASANGYSLSQGLAGTVCLWFDLLAPDSSRFPGYEL  413



>gb|KHN44353.1| LanC-like protein 2 [Glycine soja]
Length=411

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 8/160 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  260  TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  319

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +   
Sbjct  320  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL---  376

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 A+ + YSL QGLAG  CLWFDL+AP +SRFPGYE+
Sbjct  377  -----ASANGYSLSQGLAGTVCLWFDLLAPDSSRFPGYEL  411



>ref|XP_003601926.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72177.1| G protein coupled receptor [Medicago truncatula]
Length=415

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+++ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  257  TLRYLISKRFPHSGNYPSSEGNPRDKLVQWSHGATGMAITLSKAAQVFPNDRELRDAAIE  316

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG +GNAYA LSLY+LT +SIY+ERA++F  FLY NA  +   
Sbjct  317  AGEVVWKNGLVKKVGLADGVSGNAYAFLSLYKLTKDSIYEERAKSFSCFLYDNARALAV-  375

Query  271  SQGDGAAD-HAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +G   AD + YSLF GLAG ACLWFDLIAP NSRFPGYE+
Sbjct  376  -EGQVVADGNGYSLFHGLAGTACLWFDLIAPDNSRFPGYEL  415



>gb|KFK28210.1| hypothetical protein AALP_AA8G486800 [Arabis alpina]
Length=425

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  268  TLRYMMSNRFPKSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  327

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF  +L  +A D++  
Sbjct  328  AGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFAGYLCRDARDLVNA  387

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            ++ +  A H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  388  TRVE--AGHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  425



>ref|NP_201331.1| protein GCR2-like 1 [Arabidopsis thaliana]
 sp|Q9FJN7.1|GCL1_ARATH RecName: Full=LanC-like protein GCL1; AltName: Full=G protein-coupled 
receptor 2-like protein 1; Short=Protein GCR2-like 
1 [Arabidopsis thaliana]
 dbj|BAB11664.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAL24184.1| AT5g65280/MQN23_23 [Arabidopsis thaliana]
 gb|AED98033.1| protein GCR2-like 1 [Arabidopsis thaliana]
Length=433

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  276  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L  +A +++  
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCRDAIELVNM  395

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            +  +   +H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  396  TSQE--TEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  433



>gb|AAK96841.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAM91135.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
Length=433

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP +R+FR+AAIE
Sbjct  276  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKERDFREAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L  +A +++  
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCRDAIELVNM  395

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            +  +   +H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  396  TSQE--TEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  433



>ref|XP_006394052.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
 gb|ESQ31338.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
Length=433

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM+NRFP+SGNYP SEGNPRDKLVQW HGATG+ ITL KASQVFP + +FR+AAIE
Sbjct  276  TLRYMMSNRFPNSGNYPCSEGNPRDKLVQWAHGATGMAITLAKASQVFPKEGDFREAAIE  335

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG AGNAYA LSLYRLTG+ +Y+ERA+AF S+L  +A D++  
Sbjct  336  AGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCCDARDLVNA  395

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            +  +  A+H YSLF+GLAG  CLWFDL++P +S+FPGYEI
Sbjct  396  TMEE--AEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  433



>ref|XP_004502406.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=412

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+++ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFP+DRE RDAAIE
Sbjct  254  TLRYLISKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPSDRELRDAAIE  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK+GLVKKVGLADG +GNAYA LSLY+LT ++IY ERA++F  FLY NA  ++A 
Sbjct  314  AGEVVWKNGLVKKVGLADGVSGNAYAFLSLYKLTKDAIYVERAKSFSCFLYDNA-RVLAA  372

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
               D    + YSLF GLAG ACLWFDL+AP NSRFPGYE+
Sbjct  373  EGQDVMGANGYSLFHGLAGTACLWFDLLAPANSRFPGYEL  412



>ref|XP_010937380.1| PREDICTED: lanC-like protein GCL1 [Elaeis guineensis]
Length=414

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            T+RYM+ NRF HSGNYP SEGNPRDKLVQW HGA G+ I LCKA+QVFP++REFRDAAIE
Sbjct  256  TVRYMVQNRFGHSGNYPSSEGNPRDKLVQWSHGAGGVAIMLCKAAQVFPDEREFRDAAIE  315

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK G  +KVGLADG AGNAYA LSLY+LT E +Y ERA AF   LYHNA  ++A 
Sbjct  316  AGEVVWKRGSNQKVGLADGIAGNAYAFLSLYQLTKEKVYLERAEAFAGSLYHNAFKLVAR  375

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q +G  ++ YSLFQGLAGVACLWFDL+ P ++ FPG+E+
Sbjct  376  DQVNG-GENTYSLFQGLAGVACLWFDLMTPESASFPGFEL  414



>gb|ACU17850.1| unknown [Glycine max]
Length=231

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 8/139 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY+M+ RFPHSGNYP SEGNPRDKLVQW HGATG+ ITL KA+QVFPNDRE RDAAIE
Sbjct  95   TLRYLMSKRFPHSGNYPSSEGNPRDKLVQWGHGATGMAITLSKAAQVFPNDRELRDAAIE  154

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWKSGLVKKVGLADG +GNAYA LSLYRLT ESIY+ERA++F SF+Y NA  +   
Sbjct  155  AGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFMYDNAKSL---  211

Query  271  SQGDGAADHAYSLFQGLAG  215
                 A+ + YSL QGLAG
Sbjct  212  -----ASANGYSLSQGLAG  225



>gb|ABK24484.1| unknown [Picea sitchensis]
 gb|ACN40165.1| unknown [Picea sitchensis]
Length=427

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEGN RDKLVQWCHGA G+ ++LCKA+QV P +  FR AA+E
Sbjct  269  TLHYMIRNRFPESGNYPSSEGNKRDKLVQWCHGAPGVAMSLCKAAQVLPGEPVFRQAAVE  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGE+VWK GL++KVGL  G +GNAY  L+LYRLT E +Y  RA+AF  FLY+N   ++A 
Sbjct  329  AGELVWKKGLLRKVGLCHGISGNAYTFLALYRLTKEELYLNRAKAFTGFLYNNGRRLIAS  388

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q  G  DH YSLF+GLAG ACL+FD++ P ++RFPG+E+
Sbjct  389  GQMHG-GDHPYSLFEGLAGTACLYFDMVKPEHARFPGFEL  427



>emb|CBI38513.3| unnamed protein product [Vitis vinifera]
Length=117

 Score =   189 bits (480),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -1

Query  619  MMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEV  440
            M +NRFPHSGNYP  EGNPRDKLVQW HGATG+ ITLCKASQVF  DREFRDAAIEAGEV
Sbjct  1    MRSNRFPHSGNYPSFEGNPRDKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIEAGEV  60

Query  439  VWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNA  290
            VWK+GLVKKVGL+DG AGNAYA LSLYRLTGE +Y+ERA+AF SF   N+
Sbjct  61   VWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFFPENS  110



>ref|XP_001776967.1| predicted protein [Physcomitrella patens]
 gb|EDQ58216.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+  RFP SGNYP SEGN  D+LV WCHGA GI +TLCKAS+VFP++ EF+ AA+E
Sbjct  238  TLRYMIARRFP-SGNYPSSEGNATDRLVHWCHGAPGIAMTLCKASKVFPDEMEFQHAAVE  296

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AG+VVW  GL++K+GL  G +GN Y  LSLY+ TG   +  RA+ F +FL+ NA  ++  
Sbjct  297  AGDVVWSRGLLRKLGLCHGISGNTYVFLSLYQSTGGKQHLFRAQQFATFLHKNARTLIES  356

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  DH YSLF+GLAG ACL+FDL  P  +RFP YE+
Sbjct  357  GEMHG-GDHPYSLFEGLAGTACLFFDLTKPEMARFPAYEL  395



>ref|XP_001758715.1| predicted protein [Physcomitrella patens]
 gb|EDQ76693.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+  RF  SGNYP SEG+ RD+LV WC+GA G+ +TLCKA+QV+P  ++F+ AAIE
Sbjct  250  TLRYMIKGRFS-SGNYPSSEGSTRDRLVHWCYGAPGMALTLCKAAQVYPECKDFKLAAIE  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL++++GL  G +GNAY  L+LYRL GE  +  RA  FG FL+ NA  ++  
Sbjct  309  AGEVVWKRGLLRRLGLCHGISGNAYVFLALYRLCGEKKHLFRAHQFGKFLHKNAKQLIRN  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  DH YSL++G AG ACLW DL     SRFPGYE 
Sbjct  369  GEMHG-GDHGYSLYEGWAGTACLWLDLAGADASRFPGYEF  407



>ref|XP_002982067.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
 gb|EFJ16735.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
Length=215

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP S+GN RDKL+ WCHGA GI +TLCKA++VFP +  FR+AA+ 
Sbjct  59   TLLYMIANRF-QSGNYPSSDGNQRDKLIHWCHGAPGICLTLCKAAKVFP-EPVFREAAVA  116

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGE++WK GL+++VGL  G +GN Y  L+LYRLTG+  +  RAR+F +FL +   +++  
Sbjct  117  AGELIWKKGLLRRVGLCHGVSGNTYPFLALYRLTGDRKHLFRARSFATFLCNQGRELIDS  176

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH YSLF+GLAG A LW DL  P  +RFPGYE+
Sbjct  177  GDMHG-GDHPYSLFEGLAGTAFLWLDLQRPEEARFPGYEL  215



>gb|KDO74128.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
 gb|KDO74129.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=228

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++
Sbjct  72   TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVD  129

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A 
Sbjct  130  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAE  189

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  190  GKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  228



>ref|XP_004172119.1| PREDICTED: lanC-like protein 2-like, partial [Cucumis sativus]
Length=293

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 118/160 (74%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+
Sbjct  137  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAID  194

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+ +Y  RA+AF  FL+ NA  +++ 
Sbjct  195  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLMYLHRAKAFACFLHQNAEKLISE  254

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +   + D  YSLF+G+ G+A L+FD++ P+ ++FP YE+
Sbjct  255  GKMH-SGDRPYSLFEGIGGMAYLFFDMVEPNAAKFPSYEL  293



>ref|XP_002966453.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
 gb|EFJ32480.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
Length=421

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP S+GN RDKL+ WCHGA GI +TLCKA++VFP +  FR+AA+ 
Sbjct  265  TLLYMIANRF-QSGNYPSSDGNQRDKLIHWCHGAPGICLTLCKAAKVFP-EPVFREAAVA  322

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGE++WK GL+++VGL  G +GN Y  L+LYRLTG+  +  RAR+F +FL +   +++  
Sbjct  323  AGELIWKKGLLRRVGLCHGVSGNTYPFLALYRLTGDRKHLFRARSFATFLCNQGRELIDS  382

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH YSLF+GLAG A LW DL  P  +RFPGYE+
Sbjct  383  GDMHG-GDHPYSLFEGLAGTAFLWLDLQRPEEARFPGYEL  421



>gb|KDO74127.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=298

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++
Sbjct  142  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVD  199

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A 
Sbjct  200  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAE  259

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  260  GKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  298



>ref|XP_004141231.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN55144.1| hypothetical protein Csa_4G638330 [Cucumis sativus]
Length=412

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 118/160 (74%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+
Sbjct  256  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAID  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+ +Y  RA+AF  FL+ NA  +++ 
Sbjct  314  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLMYLHRAKAFACFLHQNAEKLISE  373

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +   + D  YSLF+G+ G+A L+FD++ P+ ++FP YE+
Sbjct  374  GKMH-SGDRPYSLFEGIGGMAYLFFDMVEPNAAKFPSYEL  412



>ref|XP_006451926.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
 gb|ESR65166.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
Length=407

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++
Sbjct  251  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A 
Sbjct  309  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAE  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  369  GKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>gb|KDO74125.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=407

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++
Sbjct  251  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A 
Sbjct  309  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAE  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  369  GKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_006464716.1| PREDICTED: lanC-like protein GCR2-like [Citrus sinensis]
Length=407

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  ++EF  AA++
Sbjct  251  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVTLTLAKAAEVF-GEKEFLQAAVD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FLY  A  ++A 
Sbjct  309  AGEVVWKRGLLKQVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLYDRAQKLIAE  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFP YE+
Sbjct  369  GKMHG-GDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>gb|KDP27026.1| hypothetical protein JCGZ_20961 [Jatropha curcas]
Length=408

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+  RFP SGNYP SEGN  D+LV WCHGA G+ +TL KA++VF  D+EF  AAI+
Sbjct  252  TLRYMIETRFP-SGNYPSSEGNESDRLVHWCHGAPGVALTLVKAAEVF-GDKEFLQAAID  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+++VG+  G +GN Y   SLYRLTG + Y  RA+AF  FL+  A  ++  
Sbjct  310  AGEVVWNRGLLRRVGICHGISGNTYVFFSLYRLTGRAEYLYRAKAFACFLHDKAQKLILE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+FD+I P  +RFP YE+
Sbjct  370  GKMHG-GDRPYSLFEGIGGMAYLFFDMIEPSEARFPAYEL  408



>gb|KJB84322.1| hypothetical protein B456_N018400 [Gossypium raimondii]
 gb|KJB84325.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=300

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY++ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++
Sbjct  144  TLRYIIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGITLTLVKAAEVF-GDKEFLQAALD  201

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++ 
Sbjct  202  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQ  261

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D++    +RFP YEI
Sbjct  262  GKMHG-GDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  300



>gb|KJB84323.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=340

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY++ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++
Sbjct  184  TLRYIIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGITLTLVKAAEVF-GDKEFLQAALD  241

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++ 
Sbjct  242  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQ  301

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D++    +RFP YEI
Sbjct  302  GKMHG-GDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  340



>ref|XP_006827807.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
 gb|ERM95223.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
Length=374

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYMM NRFP SGNYP SEG+  D+LV WCHGA G+ +T+C+A Q F  D+EF DAA++
Sbjct  217  TLRYMMQNRFP-SGNYPSSEGSTTDRLVHWCHGAPGVALTMCRAVQAF-GDKEFMDAAVD  274

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A +VVWK GL+++VG+  G +GNAY  L+LYRL G+  Y  +A+AF  FL    G +++ 
Sbjct  275  ATDVVWKRGLLRRVGICHGVSGNAYVFLALYRLLGKEEYLYKAKAFACFLLDCGGRLISS  334

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D + SLF+G+AG A L+ D+  P +SRFP YE+
Sbjct  335  GEMHG-GDRSLSLFEGMAGTAHLFLDMTKPSDSRFPAYEL  373



>gb|KFK35758.1| hypothetical protein AALP_AA4G032600 [Arabis alpina]
Length=403

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEGN  D+LV WCHGA G+ +TL KA+QVF   +EF +AA+E
Sbjct  247  TLRYMIQNRFP-SGNYPSSEGNESDRLVHWCHGAPGVALTLIKAAQVF-GTQEFVEAAME  304

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  ++A 
Sbjct  305  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAFASFLLDKSEKLIAE  364

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G++ ++ D+I P  + FPGYE+
Sbjct  365  GKMHG-GDRPFSLFEGIGGMSYMFLDMIDPTQALFPGYEL  403



>gb|KJB84324.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=407

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY++ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++
Sbjct  251  TLRYIIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGITLTLVKAAEVF-GDKEFLQAALD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++ 
Sbjct  309  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQ  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D++    +RFP YEI
Sbjct  369  GKMHG-GDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  407



>ref|XP_002534246.1| catalytic, putative [Ricinus communis]
 gb|EEF28136.1| catalytic, putative [Ricinus communis]
Length=419

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+NNRF  SGNYP SEGN  D+LV WCHGA G+ +TL KA++VF  D+EF  AA+E
Sbjct  263  TLRYMINNRF-RSGNYPSSEGNESDRLVHWCHGAPGVALTLVKAAEVF-GDQEFLQAAME  320

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VGL  G +GN Y  LSLY+LTG   Y  RA+AF  F++  A  +++ 
Sbjct  321  AAEVVWNWGLLKRVGLCHGISGNTYVFLSLYQLTGNMEYLYRAKAFACFIHDRAQKLISE  380

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+FD+I P  +RFP YE+
Sbjct  381  GKMHG-GDRPYSLFEGVGGMAYLFFDMIEPSEARFPAYEL  419



>ref|XP_003540453.1| PREDICTED: lanC-like protein GCR2-like [Glycine max]
Length=405

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+NNR P SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++
Sbjct  249  TLRYMINNRLP-SGNYPSSEGSENDRLVHWCHGAPGLTLTLVKAAEVF-GDKEFSQAAVD  306

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYR+TG   Y  RA+AF  FL   A ++++ 
Sbjct  307  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAFACFLLDRAQNLISE  366

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+GL G+A    D++ P  ++FPGYE+
Sbjct  367  GKMHG-GDRPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>ref|XP_002284781.1| PREDICTED: lanC-like protein GCR2 [Vitis vinifera]
 emb|CBI20338.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++
Sbjct  251  TLRYMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLLKAAEVF-GDKEFLQAAVD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG   +  RA+AF  FL   A  +++ 
Sbjct  309  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEFLYRAKAFACFLLDRAQRLISE  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+  L+ D+I P  +RFPGYE+
Sbjct  369  GKMHG-GDRPYSLFEGIGGMTYLFLDMIEPSEARFPGYEL  407



>gb|KHN28043.1| LanC-like protein 2 [Glycine soja]
Length=405

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+NNR P SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++
Sbjct  249  TLRYMINNRLP-SGNYPSSEGSENDRLVHWCHGAPGLTLTLVKAAEVF-GDKEFSQAAVD  306

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYR+TG   Y  RA+AF  FL   A ++++ 
Sbjct  307  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAFACFLLDRAQNLISE  366

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+GL G+A    D++ P  ++FPGYE+
Sbjct  367  GKMHG-GDRPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>ref|XP_004244211.1| PREDICTED: lanC-like protein GCL2 [Solanum lycopersicum]
Length=408

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF ND EF  AAIE
Sbjct  252  TLHYMIRNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLIKAAKVFSND-EFLQAAIE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EV+W  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  310  AAEVIWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHTRAQTLISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+FD+I P  +RFP YE+
Sbjct  370  GVMHG-GDRPYSLFEGMGGMAYLFFDMIDPIETRFPAYEL  408



>ref|XP_003574129.2| PREDICTED: lanC-like protein GCR2 isoform X2 [Brachypodium distachyon]
Length=475

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM++ R+P SGNYP SEG+  D+LV WCHGA G+ +TLCKA QVF +D  F+ +A E
Sbjct  319  TLRYMISKRYP-SGNYPSSEGSGSDRLVHWCHGAPGVALTLCKAYQVFHDDH-FKQSAAE  376

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A 
Sbjct  377  AGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEDADRLIAE  436

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A    D++ P+ SRFP YE+
Sbjct  437  EAMHG-GDHPFSLFEGKAGMAYFLLDMVNPYESRFPAYEL  475



>ref|XP_010234867.1| PREDICTED: lanC-like protein GCR2 isoform X1 [Brachypodium distachyon]
Length=477

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM++ R+P SGNYP SEG+  D+LV WCHGA G+ +TLCKA QVF +D  F+ +A E
Sbjct  321  TLRYMISKRYP-SGNYPSSEGSGSDRLVHWCHGAPGVALTLCKAYQVFHDD-HFKQSAAE  378

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A 
Sbjct  379  AGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEDADRLIAE  438

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A    D++ P+ SRFP YE+
Sbjct  439  EAMHG-GDHPFSLFEGKAGMAYFLLDMVNPYESRFPAYEL  477



>gb|KJB84326.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=409

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRY++ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++
Sbjct  253  TLRYIIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGITLTLVKAAEVF-GDKEFLQAALD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++ 
Sbjct  311  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFTSFLSDRAEKLISQ  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D++    +RFP YEI
Sbjct  371  GKMHG-GDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  409



>ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao]
 gb|EOY12868.1| G protein coupled receptor [Theobroma cacao]
Length=406

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ +R+P +GNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D+EF  AA++
Sbjct  250  TLRYMIKSRYP-TGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAAEVF-GDKEFLQAAVD  307

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG+  Y  RA+AF SFL   A  +++ 
Sbjct  308  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAFASFLSDRAQKLISE  367

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+  P  +RFP YEI
Sbjct  368  RKMHG-GDRPYSLFEGIGGMAYLFLDMGEPSEARFPAYEI  406



>ref|XP_010918435.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Elaeis guineensis]
Length=365

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL+YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KASQVF  + +F   A+E
Sbjct  209  TLQYMIRNRFP-SGNYPSSEGSNNDRLVHWCHGAPGVSLTLTKASQVF-QEEQFLQVAVE  266

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  Y  RA+AF  FL   A  ++A 
Sbjct  267  AAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAFACFLLDKANKLIAD  326

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G AG+A L+ D++ P  SRFP YE+
Sbjct  327  GLMHG-GDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  365



>gb|KHG14999.1| LanC-like protein 2 [Gossypium arboreum]
Length=407

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLR M+ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  D+EF  AA++
Sbjct  251  TLRCMIKNRFP-SGNYPSSEGSESDRLVHWCHGAPGITLTLAKAAEVF-GDKEFLQAALD  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF SFL   A  +++ 
Sbjct  309  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFASFLSDRAEKLISQ  368

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D++    +RFP YEI
Sbjct  369  GKMHG-GDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  407



>ref|XP_010918434.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Elaeis guineensis]
Length=404

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL+YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KASQVF  + +F   A+E
Sbjct  248  TLQYMIRNRFP-SGNYPSSEGSNNDRLVHWCHGAPGVSLTLTKASQVF-QEEQFLQVAVE  305

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  Y  RA+AF  FL   A  ++A 
Sbjct  306  AAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAFACFLLDKANKLIAD  365

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G AG+A L+ D++ P  SRFP YE+
Sbjct  366  GLMHG-GDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_007149603.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
 gb|ESW21597.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
Length=427

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+N RFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF  ++EF  AA++
Sbjct  271  TLRYMINYRFP-SGNYPSSEGSENDRLVHWCHGAPGIILTLVKAAEVF-GEKEFLQAAVD  328

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y   A+AFG FL   A  +++G
Sbjct  329  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNEEYLYMAKAFGCFLLDRAQKLISG  388

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             +  G  D  YSLF+GL G+A    D++ P  ++FPGYE
Sbjct  389  GKMHG-GDRPYSLFEGLGGMAYTCLDMVDPKMAKFPGYE  426



>ref|XP_008366750.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=409

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGN+P SEG+  D+LV WCHGA G+ +TL +A++VF  D+EF  AAI+
Sbjct  253  TLRYMIKNRFP-SGNFPSSEGSESDRLVHWCHGAPGVALTLLRAAEVF-GDQEFLQAAID  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  Y  RA+AF  FL+  A  +++ 
Sbjct  311  AGEVVWNQGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAFACFLHDRALRLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D +YSLF+G+ G+A L  D+  P  +RFP YE+
Sbjct  371  GMMHG-GDRSYSLFEGVGGMAHLLLDMTEPSEARFPAYEL  409



>ref|XP_011042485.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
 ref|XP_011013677.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
Length=412

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEGN  D LV WCHGA GI +TL KA++VF  D+EF  AA+E
Sbjct  256  TLHYMIKNHFP-SGNYPSSEGNKSDCLVHWCHGAPGIALTLAKAAEVF-GDKEFLQAAME  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  +SLYRLTG   Y  RA+AF  FLY  A  +++ 
Sbjct  314  AGEVVWNRGLLKRVGICHGISGNTYVFVSLYRLTGNVEYLYRAKAFACFLYDRAQKLVSE  373

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G  G+A L+ D++ P  +RFP YE+
Sbjct  374  GKMHG-GDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  412



>emb|CDP05888.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA GI +TL KA++VF + +EF   A++
Sbjct  253  TLRYMIKNRFP-SGNYPSSEGSETDRLVHWCHGAPGIALTLSKAAEVF-SSKEFLQGAVD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VGL  G +GN Y  LSLYR+TG   Y  RA+AF SFL+  A  +++ 
Sbjct  311  AGEVVWNRGLLKRVGLCHGISGNTYVFLSLYRMTGRVEYLYRAKAFASFLHDRAKTLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+  P  +RFP YE+
Sbjct  371  GIMHG-GDRPYSLFEGIGGMAYLFLDIAEPSAARFPAYEL  409



>ref|XP_010099009.1| hypothetical protein L484_025669 [Morus notabilis]
 gb|EXB76311.1| hypothetical protein L484_025669 [Morus notabilis]
Length=409

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D++F  AA++
Sbjct  253  TLRYMIKNCFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLVKAAEVF-EDKQFLQAAMD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AG+VVW+ GL+K+VG+  G +GNAY  L+LYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  311  AGDVVWERGLLKRVGICHGISGNAYVFLALYRLTGKVEYLYKAKAFACFLHDRARKLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  DH YSLF+G+ G+A L+ D+  P  +RFP YE+
Sbjct  371  GRMHG-GDHPYSLFEGIGGMAHLFLDMTEPSEARFPAYEL  409



>ref|XP_006661914.1| PREDICTED: lanC-like protein GCR2-like [Oryza brachyantha]
Length=399

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P SGNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+ +A E
Sbjct  243  TLLYMIRNRYP-SGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQSAAE  300

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  +A  ++A 
Sbjct  301  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLESADRLIAD  360

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+I+P  S+FP YE+
Sbjct  361  GTMHG-GDHPFSLFEGKAGMAYLLLDMISPSESKFPAYEL  399



>ref|XP_006348233.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=407

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNY  SEG+  D LV WCHGA G+ +TL KA++VF +D EF  AA E
Sbjct  251  TLRYMIKNRFS-SGNYRTSEGDESDVLVHWCHGAPGVALTLAKAAKVFGDD-EFLKAARE  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGD-IMA  275
            AGEVVW+ GL+K+VG+  G +GNAY  LSLYRLTG+  Y  +A+AF  FL+  A   I  
Sbjct  309  AGEVVWRRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYKAKAFACFLHDRAHTFICE  368

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G    G  +H +SLF+G+ G+ACL+ DL+ P  SRFP YE+
Sbjct  369  GIMHKG--NHPFSLFEGIGGMACLFLDLVEPFESRFPAYEL  407



>ref|XP_006370294.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
 gb|ERP66863.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
Length=412

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEGN  D LV WCHGA GI +TL KA++VF  D+EF  AA+E
Sbjct  256  TLHYMIKNHFP-SGNYPSSEGNKSDCLVHWCHGAPGIALTLAKAAEVF-GDKEFLQAAME  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FL+  A  +++ 
Sbjct  314  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLHDRAQKLVSE  373

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G  G+A L+ D++ P  +RFP YE+
Sbjct  374  GKMHG-GDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  412



>gb|EMS68258.1| LanC-like protein 2 [Triticum urartu]
Length=436

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM++NRFP SGNYP SE +  D+LV WCHGA G+ +TL KA QVF +D  F+ +A E
Sbjct  280  TLRYMISNRFP-SGNYPSSEDSESDRLVHWCHGAPGVALTLAKAYQVFQDD-HFKQSAAE  337

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  NA  ++A 
Sbjct  338  AAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFACFLLENADRLIAE  397

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG+A L  D++ P  SRFP YE+
Sbjct  398  EAMHG-GDRPFSLFEGKAGMAYLLLDMVNPSESRFPAYEL  436



>ref|XP_004244212.1| PREDICTED: lanC-like protein GCR2 [Solanum lycopersicum]
Length=407

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNY  SEG+  D  V WCHGA G+ +TL KA++VF +D EF +AA E
Sbjct  251  TLRYMIKNRFS-SGNYRTSEGDESDVRVHWCHGAAGVALTLAKAAKVFGDD-EFLEAARE  308

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA-  275
            AGEVVW+ GL+K+VG+  G +GNAY  LSLY+LT E  Y  +A+AF  FL+  A  ++  
Sbjct  309  AGEVVWRRGLLKRVGICHGISGNAYVFLSLYKLTREEEYLYKAKAFACFLHDRAHTLICE  368

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G    G  DH +SLF+G+ G+ACL+ DL+ P  SRFP YE+
Sbjct  369  GVMHKG--DHPFSLFEGIGGMACLFLDLVEPFESRFPAYEV  407



>ref|XP_006348234.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=408

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL Y++ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF ND E+  AA+E
Sbjct  252  TLHYIIRNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLTKAAKVFSND-EYLQAAVE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EV+W  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  310  AAEVIWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVGYLYKAKAFACFLHARAQALISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+FD+I P  +RFP YE+
Sbjct  370  GVMHG-GDRPYSLFEGIGGMAYLFFDMIDPMETRFPAYEL  408



>ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum indicum]
Length=403

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF ++ EF  AAI+
Sbjct  247  TLRYMIKNRFP-SGNYPSSEGSETDRLVHWCHGAPGVALTLAKAAKVFASE-EFLQAAID  304

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLY+LTG+  +  RA+AF  FL H+   I+  
Sbjct  305  AGEVVWNRGLLKRVGVCHGISGNAYIFLSLYQLTGKQEFLYRAKAFACFL-HDRAQILIS  363

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                   D  YSLF+G+ G+A L+ D+  P  +RFP YE+
Sbjct  364  EGIIHGGDRPYSLFEGIGGMAYLFLDMTEPSQARFPAYEL  403



>gb|KEH38770.1| G protein coupled receptor [Medicago truncatula]
Length=417

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  DREF  AA +
Sbjct  261  TLRYMIKNRFS-SGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAAEVF-GDREFLQAAED  318

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+ F  FL   A +++  
Sbjct  319  AGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNKEYLYRAKGFSCFLLDRAQELIGQ  378

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+GL G+   + D+I P  +RFPGYE+
Sbjct  379  GKMHG-GDRPYSLFEGLGGMTYTFVDMIDPQVARFPGYEL  417



>ref|XP_004291663.1| PREDICTED: lanC-like protein GCR2 [Fragaria vesca subsp. vesca]
Length=403

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N FP SGNY  SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AAI+
Sbjct  247  TLRYMIKNCFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAEVF-GDEEFVQAAID  304

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW+ GL+K+VGL  G +GN Y  LSLYR TG+  Y  RA+AF  FLY  A  +++ 
Sbjct  305  AGEVVWRRGLLKRVGLCHGISGNTYVFLSLYRFTGKVEYLYRAKAFACFLYDRAPRLISE  364

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+  P  +RFPGYE+
Sbjct  365  GRMHG-GDRPYSLFEGVGGMAHLFLDMTDPSEARFPGYEL  403



>emb|CAJ86377.1| OSIGBa0155K17.4 [Oryza sativa Indica Group]
Length=422

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYPV+E +  D+ V WCHGA GI +TL KASQVFP +R F +A  E
Sbjct  266  TLRYMIQNRFP-SGNYPVTEEDKHDRFVHWCHGAPGISLTLAKASQVFPEER-FLEAIAE  323

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  L+L+RLT +  +  RA+AF  FL   A  ++A 
Sbjct  324  AAEVVWNRGLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAKAFACFLLDRAKQLIA-  382

Query  271  SQGDG---AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
               DG   + D  YSLF+G  G+A L+ D+I P +SRFPGYE+
Sbjct  383  ---DGIMHSGDEPYSLFEGQVGMAYLFLDMINPLDSRFPGYEL  422



>gb|ABB47829.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
Length=399

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P +GNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A E
Sbjct  243  TLLYMIRNRYP-TGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAE  300

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  301  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAD  360

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+++P  S+FP YE+
Sbjct  361  GAMHG-GDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  399



>ref|XP_007212308.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
 gb|EMJ13507.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
Length=398

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGN+P SEG+  D+LV WCHGA G+ +TL +A++VF  D EF  AAI+
Sbjct  242  TLRYMIKNRFP-SGNFPSSEGSESDRLVHWCHGAPGVALTLVRAAEVF-GDLEFLQAAID  299

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A ++++ 
Sbjct  300  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALNLISE  359

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L  D+  P  +RFP YE+
Sbjct  360  GAMHG-GDRPYSLFEGVGGMAHLLLDMTEPSEARFPAYEL  398



>ref|NP_001174024.1| Os04g0529600 [Oryza sativa Japonica Group]
 emb|CAD41202.1| OSJNBa0074L08.13 [Oryza sativa Japonica Group]
 emb|CAE03855.1| OSJNBa0081C01.1 [Oryza sativa Japonica Group]
 gb|EAY94933.1| hypothetical protein OsI_16739 [Oryza sativa Indica Group]
 gb|EAZ31418.1| hypothetical protein OsJ_15552 [Oryza sativa Japonica Group]
 dbj|BAH92752.1| Os04g0529600 [Oryza sativa Japonica Group]
Length=422

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYPV+E +  D+ V WCHGA GI +TL KASQVFP +R F +A  E
Sbjct  266  TLRYMIQNRFP-SGNYPVTEEDKHDRFVHWCHGAPGISLTLAKASQVFPEER-FLEAIAE  323

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  L+L+RLT +  +  RA+AF  FL   A  ++A 
Sbjct  324  AAEVVWNRGLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAKAFACFLLDRAKQLIA-  382

Query  271  SQGDG---AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
               DG   + D  YSLF+G  G+A L+ D+I P +SRFPGYE+
Sbjct  383  ---DGIMHSGDEPYSLFEGQVGMAYLFLDMINPLDSRFPGYEL  422



>gb|KFK40450.1| hypothetical protein AALP_AA3G374700 [Arabis alpina]
Length=407

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP +E + R D LV WCHGA GI +TL KAS+VF  +REF +A +
Sbjct  250  TLKYMIKNRFP-SGNYPANEEDRRRDTLVHWCHGAPGIALTLVKASEVF-GEREFLEAGV  307

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVWK GL+K+VG+  G +GNAY  L+LYR TG S Y  RA+AF SFL      +++
Sbjct  308  AAAEVVWKRGLIKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAFASFLLDRGHKLLS  367

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  368  KGEMHG-GDSPYSLFEGIGGMAYLFLDMVDPTQARFPGYEL  407



>gb|AES74528.2| G protein coupled receptor [Medicago truncatula]
Length=441

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRFP SGNYP S+ + + D LV WCHGA G+ +TL KA++VF  D+EF DAA+
Sbjct  284  TLKYMIHNRFP-SGNYPASDKDKKSDVLVHWCHGAPGMALTLVKAAKVF-GDKEFLDAAM  341

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EAGEVVW  GL+K+VG+  G +GNAY  LSLY+LTG + Y  RA+AF  FL   A ++++
Sbjct  342  EAGEVVWSRGLLKRVGICHGISGNAYVFLSLYQLTGNTKYLYRAKAFACFLLDGAHNLIS  401

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G +  G  D  +SLF+G+ G+A L+ D++ P  S+FP YE+
Sbjct  402  GGEMHG-GDSPHSLFEGVGGMAYLFLDMVNPSQSKFPAYEL  441



>ref|XP_011085355.1| PREDICTED: lanC-like protein GCL2 [Sesamum indicum]
Length=422

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 6/162 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYMM NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA+
Sbjct  265  TLRYMMKNRFP-SGNYPASEEDKKRDVLVHWCHGAPGIALTLIKAAEVF-GDKEFLEAAM  322

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  +M 
Sbjct  323  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGIVEYLYRAKAFACFLLDRAHMLM-  381

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             S GD    D+  SLF+G+ G+A L+ D++ P N+RFP YE+
Sbjct  382  -STGDLHGGDNPSSLFEGIGGMAHLFLDMVQPKNARFPAYEL  422



>gb|ABB47830.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG93541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P +GNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A E
Sbjct  245  TLLYMIRNRYP-TGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAE  302

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  303  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAD  362

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+++P  S+FP YE+
Sbjct  363  GAMHG-GDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  401



>gb|EYU26400.1| hypothetical protein MIMGU_mgv1a007259mg [Erythranthe guttata]
Length=413

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF ++ EF  AAIE
Sbjct  257  TLHYMIKNRF-ESGNYPSSEGSENDRLVHWCHGAPGVALTLAKAAKVFGSE-EFMQAAIE  314

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GNAY  LSLY+LTG+S +  +A+AF  FLY  A  +++ 
Sbjct  315  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGKSEFLYKAKAFACFLYDRAQKLVSE  374

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+I P  +RFP +E+
Sbjct  375  GVMHG-GDRPYSLFEGIGGMAYLFLDIIEPSQARFPVFEL  413



>ref|XP_008452476.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Cucumis melo]
Length=412

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SE +  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+
Sbjct  256  TLRYMIKNRFL-SGNYPSSEESESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAID  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+ NA  +++ 
Sbjct  314  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLTYLHRAKAFACFLHQNAEKLISE  373

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +   + D  YSLF+G+ G+A L+ D++ P+ ++FP YE+
Sbjct  374  GKMH-SGDCPYSLFEGIGGMAYLFLDMVEPYAAKFPSYEL  412



>ref|XP_008452475.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Cucumis melo]
Length=415

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SE +  D+LV WCHGA G+ +TL KA++VF +D EF  AAI+
Sbjct  259  TLRYMIKNRFL-SGNYPSSEESESDRLVHWCHGAPGVALTLGKAAEVFGDD-EFLQAAID  316

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+ NA  +++ 
Sbjct  317  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLTYLHRAKAFACFLHQNAEKLISE  376

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +   + D  YSLF+G+ G+A L+ D++ P+ ++FP YE+
Sbjct  377  GKMH-SGDCPYSLFEGIGGMAYLFLDMVEPYAAKFPSYEL  415



>ref|XP_004514463.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=446

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SEG+  RD+LV WCHGA G+ +TL KAS+VF  D EF DAA+
Sbjct  289  TLKYMILNRFP-SGNYPASEGDKKRDELVHWCHGAPGVALTLVKASKVF-GDEEFLDAAM  346

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EA +VVW  GL+K+VG+  G +GNAY  LSLY+LTG + Y  +A+AF  FL   A  +++
Sbjct  347  EAADVVWSRGLLKRVGMCHGISGNAYVFLSLYQLTGNAKYLYKAKAFACFLLDRAHKLIS  406

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P  S+FP YE+
Sbjct  407  RGEMHG-GDRPYSLFEGVGGMAYLFLDMVDPSQSKFPAYEL  446



>ref|XP_003618310.1| LanC-like protein [Medicago truncatula]
Length=469

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRFP SGNYP S+ + + D LV WCHGA G+ +TL KA++VF  D+EF DAA+
Sbjct  312  TLKYMIHNRFP-SGNYPASDKDKKSDVLVHWCHGAPGMALTLVKAAKVF-GDKEFLDAAM  369

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EAGEVVW  GL+K+VG+  G +GNAY  LSLY+LTG + Y  RA+AF  FL   A ++++
Sbjct  370  EAGEVVWSRGLLKRVGICHGISGNAYVFLSLYQLTGNTKYLYRAKAFACFLLDGAHNLIS  429

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G +  G  D  +SLF+G+ G+A L+ D++ P  S+FP YE+
Sbjct  430  GGEMHG-GDSPHSLFEGVGGMAYLFLDMVNPSQSKFPAYEL  469



>gb|ABQ14360.1| abscisic acid ABA receptor [Populus trichocarpa]
Length=443

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEGN  D LV WCHGA GI +TL KA++VF  D+EF  AA+E
Sbjct  287  TLHYMIKNHFP-SGNYPSSEGNKSDCLVHWCHGAPGIALTLAKAAEVF-GDKEFLQAAME  344

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FL+  A  +++ 
Sbjct  345  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFACFLHDRAQKLVSE  404

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G  G+A L+ D++ P  +RFP YE+
Sbjct  405  GKMHG-GDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  443



>ref|XP_007132705.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
 gb|ESW04699.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
Length=414

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRF  SGNYP SE + + D LV WCHGA GI +TL KA++VF  D+EF DAA+
Sbjct  257  TLKYMISNRF-SSGNYPASEDDRKSDVLVHWCHGAPGIALTLVKAAKVF-GDKEFLDAAM  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EAGEVVW  GL+KKVG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  +++
Sbjct  315  EAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNVKHLYRAKAFACFLLDRAHKLIS  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G +  G  D  YSLF+GL G+A L+ D+I P  S+FP YE+
Sbjct  375  GGEMHG-GDRPYSLFEGLGGMAYLFLDMIDPSLSKFPAYEL  414



>ref|XP_004487685.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=416

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA + F  D+EF  AA++
Sbjct  260  TLRYMIKNRFS-SGNYPSSEGSESDRLVHWCHGAPGVTLTLVKAVEAF-EDKEFLQAAVD  317

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VGL  G +GN Y  LSLYRLTG   Y  RA+ F  FL   A  ++  
Sbjct  318  AGEVVWNRGLLKRVGLCHGVSGNTYVFLSLYRLTGNKEYLYRAKGFSCFLLDRAQKLIVK  377

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+GL G+A  + D++ P  +RFPGYE+
Sbjct  378  GKMHG-GDRPYSLFEGLGGMANTFLDMVDPQVARFPGYEL  416



>gb|AAL58268.1|AC068923_10 putative lanthionine synthetase [Oryza sativa Japonica Group]
Length=446

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P +GNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A E
Sbjct  290  TLLYMIRNRYP-TGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAE  347

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  348  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAD  407

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+++P  S+FP YE+
Sbjct  408  GAMHG-GDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  446



>gb|EMT26581.1| LanC-like protein 2 [Aegilops tauschii]
Length=579

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM++NRFP SGNYP SE +  D+LV WCHGA G+ +TL KA QVF +D  F+ +A E
Sbjct  423  TLRYMISNRFP-SGNYPSSEDSESDRLVHWCHGAPGVALTLAKAYQVFQDD-HFKQSAAE  480

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL  NA  ++A 
Sbjct  481  AAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFACFLLENADRLIAE  540

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG+A L  D++ P  SRFP YE+
Sbjct  541  EAMHG-GDRPFSLFEGKAGMAYLLLDMVNPSESRFPAYEL  579



>ref|NP_001149305.1| LOC100282928 [Zea mays]
 gb|ACG34942.1| lanC-like protein 2 [Zea mays]
Length=401

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A E
Sbjct  245  TLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAE  302

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  303  AAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAE  362

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  363  GAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  401



>ref|NP_001064963.1| Os10g0497900 [Oryza sativa Japonica Group]
 dbj|BAF26877.1| Os10g0497900, partial [Oryza sativa Japonica Group]
Length=447

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P +GNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A E
Sbjct  291  TLLYMIRNRYP-TGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAE  348

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  349  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAD  408

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+++P  S+FP YE+
Sbjct  409  GAMHG-GDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  447



>tpg|DAA49457.1| TPA: LOW QUALITY PROTEIN: lanC-like protein 2 [Zea mays]
Length=400

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A E
Sbjct  244  TLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAE  301

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  302  AAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAE  361

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  362  GAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  400



>gb|EAZ16566.1| hypothetical protein OsJ_32039 [Oryza sativa Japonica Group]
Length=461

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NR+P +GNYP SEG+  D+LV WCHGA G+ +TL KA QVF +D  F+  A E
Sbjct  305  TLLYMIRNRYP-TGNYPSSEGSESDRLVHWCHGAPGVALTLAKAYQVF-HDEHFKQTAAE  362

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  363  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAD  422

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  DH +SLF+G AG+A L  D+++P  S+FP YE+
Sbjct  423  GAMHG-GDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  461



>ref|XP_009766748.1| PREDICTED: lanC-like protein GCL2 [Nicotiana sylvestris]
Length=420

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  DREF +AA+
Sbjct  257  TLRYMVKNRFP-SGNYPASEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GDREFLNAAV  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLY+LTG   Y  RA+AF  FL   A  ++A
Sbjct  315  DAAEVVWNRGLLKRVGMCHGISGNAYVFLSLYQLTGNEEYLYRAKAFACFLLDRAHKLIA  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGY  158
              +  G  D  YSLF+G+ G+A L+ DL  P  +RFP Y
Sbjct  375  KGEMHG-GDSPYSLFEGIGGMAYLFLDLTEPKEARFPAY  412



>ref|XP_002517941.1| catalytic, putative [Ricinus communis]
 gb|EEF44459.1| catalytic, putative [Ricinus communis]
Length=410

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 111/161 (69%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+NNRFP SGNYP SE +  RD LV WCHGA GI +TL KA QVF  D+EF  AA+
Sbjct  253  TLKYMINNRFP-SGNYPASEEDWKRDVLVHWCHGAPGIALTLVKAVQVF-GDKEFLQAAV  310

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A E+VW  GL+K+VG+  G +GN Y  L+LYR+TG   +  RA+AF SFL   A  +++
Sbjct  311  DAAEIVWNRGLLKRVGICHGISGNTYVFLALYRMTGSIEFLYRAKAFASFLLDRAHKLIS  370

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  371  AGEMHG-GDSPYSLFEGIGGMAYLFLDMIDPSKARFPAYEL  410



>gb|AGV54199.1| lanC-like protein [Phaseolus vulgaris]
Length=414

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 113/161 (70%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRF  SGNYP SE + + D LV WCHGA GI +TL KA +VF  D+EF DAA+
Sbjct  257  TLKYMISNRF-RSGNYPASEDDRKSDVLVHWCHGAPGIALTLVKAGKVF-GDKEFLDAAM  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EAGEVVW  GL+KKVG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  +++
Sbjct  315  EAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNVKHLYRAKAFACFLLDRAHKLIS  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G +  G  D  YSLF+GL G+A L+ D+I P  S+FP YE+
Sbjct  375  GGEMHG-GDRPYSLFEGLGGMAYLFLDMIDPSLSKFPAYEL  414



>ref|XP_004982728.1| PREDICTED: lanC-like protein 2-like [Setaria italica]
Length=446

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEGN  D+LV WCHGA G+ +TL KA +VF +D  F+ +A  
Sbjct  290  TLRYMIKNRFP-SGNYPSSEGNESDRLVHWCHGAPGVALTLAKAYEVFHDD-HFKQSAAG  347

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  RA+AF  FL   A + +A 
Sbjct  348  AAEVVWNRGLLKRVGICHGVSGNAYTFLSLYRLTGNVEYLYRAKAFACFLLEKADEFIAE  407

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG+A L  D++ P  SRFP YE+
Sbjct  408  GAMHG-GDRPFSLFEGKAGMAYLLLDMVDPSESRFPAYEL  446



>ref|XP_010462143.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=412

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA+QVF   +EF +AA+E
Sbjct  256  TLSYMIQNRFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLVKAAQVFKT-KEFVEAAME  313

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  +++ 
Sbjct  314  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLFRAKAFASFLLDRSEKLISE  373

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  374  GKMHG-GDGPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  412



>ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo nucifera]
Length=420

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AA  
Sbjct  264  TLRYMIKNRF-SSGNYPSSEGSDNDRLVHWCHGAPGVTLTLVKAAEVFGGD-EFLKAAEA  321

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEV+WK GL+K+VG+  G +GNAY  LSLYR TG   Y  RARAF  FL   A  +++ 
Sbjct  322  AGEVIWKRGLLKRVGICHGISGNAYTFLSLYRQTGNVEYLYRARAFACFLLDRANRLISE  381

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  382  GKMHG-GDRPYSLFEGIGGMAYLFLDMIEPAEARFPAYEL  420



>gb|ACN31611.1| unknown [Zea mays]
Length=408

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F+ +A E
Sbjct  252  TLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FKQSAAE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   +  RA+AF  FL   A  ++A 
Sbjct  310  AAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEHLYRAKAFACFLLEKADQLIAE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  370  GAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  408



>ref|XP_008676974.1| PREDICTED: LOC100282928 isoform X1 [Zea mays]
 tpg|DAA49460.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=451

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A E
Sbjct  295  TLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAE  352

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  353  AAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAE  412

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  413  GAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  451



>tpg|DAA49459.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=449

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ N+FP SGNYP SEGN  D LV WCHGA G+ +TL KA +VF +D  F  +A E
Sbjct  293  TLRYMIKNKFP-SGNYPSSEGNESDHLVHWCHGAPGVALTLAKAYEVFHDDY-FEQSAAE  350

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  351  AAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAE  410

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +SLF+G AG++ L  D++ P  SRFP YE+
Sbjct  411  GAMHG-GDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  449



>gb|KCW89517.1| hypothetical protein EUGRSUZ_A01805 [Eucalyptus grandis]
Length=196

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D EF  AA+
Sbjct  39   TLKYMIRNRFP-SGNYPSSEEDRNRDVLVHWCHGAPGIALTLVKAAEVF-RDEEFLRAAV  96

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GN Y  LSLYR+TG + +  RA+AF  FL   A  +++
Sbjct  97   DAAEVVWNRGLLKRVGICHGISGNVYVFLSLYRVTGNAEFLYRAKAFACFLLDRALKLIS  156

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D+ YSLF+G+ G A L+ D++ P  +RFP YE+
Sbjct  157  TGEMHG-GDNPYSLFEGIGGTAYLFLDMVEPSAARFPAYEL  196



>ref|XP_008781994.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Phoenix 
dactylifera]
Length=276

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 108/163 (66%), Gaps = 6/163 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEG+  D+L+ WCHGA G+ +TL KA+QVF  + +F   A E
Sbjct  117  TLHYMIQNRFP-SGNYPSSEGSYDDRLMHWCHGAPGVALTLTKAAQVF-QEEQFLQVAAE  174

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN Y  L+LYRLTG  +Y  RA+AF  FL  +  D    
Sbjct  175  AAEVVWSRGLLKRVGICHGISGNXYVFLALYRLTGNVVYLYRAKAFACFLL-DKLDKANK  233

Query  271  SQGDG---AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
               DG   + DH YSLF+G AG+A L+ D++ P  SRFP YE+
Sbjct  234  LIADGLMHSGDHPYSLFEGQAGMAYLFLDMVRPSESRFPAYEL  276



>ref|XP_008226665.1| PREDICTED: lanC-like protein GCR2 [Prunus mume]
Length=409

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGN+P SEG   D+LV WCHGA G+ +TL +A++VF  D+EF  AAI+
Sbjct  253  TLHYMIKNRFP-SGNFPSSEGTESDRLVHWCHGAPGVALTLVRAAEVF-GDKEFLQAAID  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A ++++ 
Sbjct  311  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALNLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGY  158
                G  D  YSLF+G+ G+A L  D+  P  +RFP Y
Sbjct  371  GTMHG-GDRPYSLFEGVGGMAHLLLDMTEPSEARFPAY  407



>ref|XP_003539910.1| PREDICTED: lanC-like protein GCL2-like [Glycine max]
 gb|KHN31966.1| LanC-like protein 2 [Glycine soja]
Length=414

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRF  SGNYPVSE + + D LV WCHGA G+ +TL KA++VF  D+EF DAAI
Sbjct  257  TLKYMISNRF-RSGNYPVSEDDRKSDALVHWCHGAPGMALTLVKAAKVF-GDKEFLDAAI  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EA EVVW  GL+KKVG+  G +GNAY  LSLY+LTG+  Y  RA+AF  FL   A  +++
Sbjct  315  EAAEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGDVKYLYRAKAFACFLLDRAHKLIS  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YS+F+GL G+A L+ D+  P  S+FP YE+
Sbjct  375  RGEMHG-GDRPYSMFEGLGGMAYLFLDMSDPSLSKFPAYEL  414



>ref|XP_002894411.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70670.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF   +EF +AA+E
Sbjct  254  TLSYMIQNRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFKT-KEFVEAAME  311

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG++ Y  RA+AF SFL   +  +++ 
Sbjct  312  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKAEYLYRAKAFASFLLDKSEKLISE  371

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  372  GKMHG-GDRPFSLFEGIGGMAYMFLDMNDPTQALFPGYEL  410



>ref|XP_008809400.1| PREDICTED: lanC-like protein GCL2 [Phoenix dactylifera]
Length=404

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA+QVF  + +F  A  E
Sbjct  248  TLRYMIQNRFS-SGNYPSSEGSNNDRLVHWCHGAPGVSLTLTKAAQVF-QEEQFLQATAE  305

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  306  AAEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNMEYLYRAKAFACFLLDKANKLIA-  364

Query  271  SQGDG---AADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
               DG   + D  YSLF+G AG+A L+ D++ P  SRFP YE+
Sbjct  365  ---DGLMHSGDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_009400288.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=403

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+N+RFP SGNYP S+G+  D+LV WCHGA G+ +TL KASQVF  D +   AA E
Sbjct  247  TLSYMINHRFP-SGNYPSSQGSNSDRLVHWCHGAPGVALTLIKASQVF-QDEQILGAAEE  304

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A +VVW  GL+K+VG+  G +GN Y  LSLYRLTG   Y  RA+AF  FL   A  ++A 
Sbjct  305  AAKVVWSRGLLKRVGICHGISGNTYVFLSLYRLTGRVEYLYRAKAFACFLLDRANQLIAD  364

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +   + D  YS+F+G AG+A L+ D+I P  SRFP YE+
Sbjct  365  GRMH-SGDRPYSMFEGQAGMAHLFLDMIRPSESRFPAYEL  403



>ref|XP_009588409.1| PREDICTED: lanC-like protein GCL2 [Nicotiana tomentosiformis]
Length=423

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 108/159 (68%), Gaps = 4/159 (3%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  DREF +AA+
Sbjct  257  TLRYMVKNRFP-SGNYPTSEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GDREFLNAAV  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLY+LTG   Y  RA+A   FL   A  ++A
Sbjct  315  DAAEVVWNRGLLKRVGMCHGISGNAYVFLSLYQLTGNVEYLYRAKALACFLLDRAHKLIA  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGY  158
              +  G  D  YSLF+G+ G+A L+ D+  P  +RFP Y
Sbjct  375  KGEMHG-GDSPYSLFEGIGGMAYLFLDMTEPKEARFPAY  412



>ref|XP_010062888.1| PREDICTED: lanC-like protein GCR2 [Eucalyptus grandis]
 gb|KCW70029.1| hypothetical protein EUGRSUZ_F03336 [Eucalyptus grandis]
Length=409

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF   +EF  AA++
Sbjct  253  TLHYMIKNRFP-SGNYPSSEGSETDRLVHWCHGAPGVALTLVKAAEVF-GSKEFLQAAVD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSL RLTG + Y  RA+AF  FL   A  +++ 
Sbjct  311  AGEVVWSRGLLKRVGICHGISGNAYVFLSLSRLTGNAEYLYRAKAFACFLQDRALRLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D   P  +RFP YE+
Sbjct  371  GKMHG-GDRPYSLFEGIGGMAGLFMDTTEPSEARFPAYEL  409



>gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum]
Length=409

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP  GNYP SE + + D LV WCHGA GI +TL KA++VF +D EF +AA+
Sbjct  252  TLRYMIRNRFP-GGNYPASEQDRKSDVLVHWCHGAPGIALTLVKAAEVFGDD-EFLEAAV  309

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYR TG   +  RA+AF  FL   A  +++
Sbjct  310  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRKTGNVKFLHRAKAFACFLLDQAHKLIS  369

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D+I P  SRFP YE+
Sbjct  370  NGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL  409



>ref|XP_010542278.1| PREDICTED: lanC-like protein GCR2 [Tarenaya hassleriana]
Length=408

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL Y+M NRFP SGNY  SEGN  D+LV WCHGA G+ +TL KA++VF  + EF +AA+E
Sbjct  252  TLHYIMKNRFP-SGNYRSSEGNESDRLVHWCHGAPGVALTLVKAAEVFGTE-EFLEAAVE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNA+  LSLYR+TG++ Y  RA+AF +FL   +  +++ 
Sbjct  310  AGEVVWNRGLLKRVGICHGISGNAFVFLSLYRVTGKAEYLYRAKAFAAFLLDRSEKLISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  +S+F+G+ G+A L+FD+  P  +RFPG+++
Sbjct  370  GNMHG-GDRPFSIFEGIGGMAYLFFDMNDPSGARFPGFQL  408



>ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
             LRYM+  RFP  GNYP SEG+  D+LV WCHGA G+ +TL KA +VF  D+E   AA++
Sbjct  252  VLRYMIRGRFP-GGNYPSSEGSESDRLVHWCHGAPGLALTLAKAYEVF-GDKELLQAAVD  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  GT+GN Y  L+LYRLTG + Y  RA+AF SFL+  A  ++A 
Sbjct  310  AAEVVWNRGLLKRVGICHGTSGNTYVFLALYRLTGNAEYLYRAKAFASFLHDRARRLIAE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+GL G+A L+ D+  P  +RFP YE+
Sbjct  370  GFMHG-GDRPYSLFEGLGGMAYLFLDMNEPAEARFPAYEL  408



>ref|XP_010500915.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=411

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNYP SEG+  D+L  WCHGA G+ +TL KA+QVF   +EF +AA+E
Sbjct  255  TLSYMIQNRFP-SGNYPSSEGSESDRLFHWCHGAPGVALTLVKAAQVFKT-KEFIEAAME  312

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K++G+  G +GN Y  LSLYRLT +  Y  RA+AF SFL   +  +++ 
Sbjct  313  AGEVVWNRGLLKRLGICHGISGNTYVFLSLYRLTEKPEYLYRAKAFASFLLEKSEKLISE  372

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  373  GKMHG-GDRPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  411



>ref|XP_009400289.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 106/159 (67%), Gaps = 3/159 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEG   D+LV WCHGA G+ +TL KA+QVF  D+ F  AA E
Sbjct  248  TLHYMIQNHFP-SGNYPSSEGFDTDRLVHWCHGAPGVALTLTKAAQVF-QDKLFLKAAAE  305

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A +VVW  GL+K+VG+  G +GNAY  LSLYRLTG   Y  +A+AF  FL   A  ++A 
Sbjct  306  AADVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVSYLYQAKAFTCFLLDRANKLIAE  365

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             +   + DH YSLF+G AG+A L+ D+  P  SRFP Y+
Sbjct  366  GKMH-SGDHPYSLFEGQAGMAYLFLDMTTPSQSRFPAYK  403



>ref|XP_009343572.1| PREDICTED: lanC-like protein GCR2 [Pyrus x bretschneideri]
Length=409

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGN+P SEG+  D LV WCHGA G+ +TL +A++VF  D+EF  AA++
Sbjct  253  TLHYMIKNRFP-SGNFPSSEGSESDCLVHWCHGAPGVALTLLRAAEVF-GDQEFLQAAVD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF  FL+  A  +++ 
Sbjct  311  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKAFACFLHDRALRLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+  L  D+  P  +RFP YE+
Sbjct  371  GTMHG-GDRPYSLFEGVGGMVHLLLDMTEPSEARFPAYEL  409



>ref|XP_002884221.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60480.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 111/161 (69%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  +REF +A  
Sbjct  248  TLKYMIKNRFP-SGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAAEVF-GEREFLEAGA  305

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY  LSLYR TG S Y  RA+AF SFL      +++
Sbjct  306  AAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGMSEYLYRAKAFASFLLDRGPKLLS  365

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+AG+A L+ D++ P  +RFPGYE+
Sbjct  366  KGEMHG-GDSPYSLFEGVAGMAYLYLDMVDPSQARFPGYEL  405



>emb|CDP14758.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL YM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  D+ F  AAI
Sbjct  264  TLNYMIKNRFP-SGNYPASEEDKRRDVLVHWCHGAPGIALTLVKAAEVF-GDKRFLQAAI  321

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GN Y  L+LYRLTG   +  RA+AF  FL   A  +++
Sbjct  322  DAAEVVWNRGLLKRVGICHGVSGNTYVFLALYRLTGNVEFLYRAKAFSCFLLDRAYKLIS  381

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P N+RFP YE+
Sbjct  382  KGEMHG-GDSPYSLFEGIGGMAYLFLDMVEPTNARFPAYEL  421



>ref|XP_006409014.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
 gb|ESQ50467.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
Length=405

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 113/162 (70%), Gaps = 6/162 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ +RFP SGNY  SE + R D LV WCHGA GI +TL KA++VF  +REF +AA 
Sbjct  248  TLKYMIKSRFP-SGNYAASEEDRRRDLLVHWCHGAPGIALTLVKAAEVF-KEREFLEAAA  305

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY  LSLYR TG S Y  RA+AF SFL   A  ++ 
Sbjct  306  AAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGRSEYLYRAKAFASFLLDRAHKLL-  364

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             S+GD    D  YSLF+G+ G+ACL+ D++ P  +RFPGYE+
Sbjct  365  -SKGDMHGGDSPYSLFEGVGGMACLFLDMVDPFQARFPGYEL  405



>gb|AAG52264.1|AC019018_1 putative G protein-coupled receptor; 80093-78432 [Arabidopsis 
thaliana]
Length=401

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N +EF +AA+E
Sbjct  245  TLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-NTKEFVEAAME  302

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL   +  +++ 
Sbjct  303  AGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISE  362

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  363  GQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  401



>ref|XP_007215460.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
 gb|EMJ16659.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
Length=413

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 6/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA+
Sbjct  256  TLKYMIDNRFP-SGNYPASEEDKNRDVLVHWCHGAPGISLTLAKAAKVF-GDKEFMEAAV  313

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVWK GL+K+VG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  ++ 
Sbjct  314  DAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNLGFLYRAKAFACFLVDRAHKLI-  372

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             S+G+    D  YSLF+G+ G+A L  D+I P  ++FP YE
Sbjct  373  -SEGELHRGDSPYSLFEGVGGMAYLLLDMIEPSQAKFPAYE  412



>ref|XP_006303704.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
 gb|EOA36602.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
Length=410

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP SEG+  D+LV WCHGA G+ +TL KA+QVF   +EF +AA+E
Sbjct  254  TLTYMIQNRFS-SGNYPSSEGSESDRLVHWCHGAPGVALTLVKAAQVFKT-KEFVEAAME  311

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+ G+  G  GN Y  LSLYRLTG+  Y  RA+AF SFL   +   ++ 
Sbjct  312  AGEVVWNRGLLKRAGICHGITGNTYVFLSLYRLTGKPEYLYRAKAFASFLMDKSEKFISE  371

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  372  GKMHG-GDRPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  410



>ref|XP_007043561.1| GCR2-like 2 isoform 3 [Theobroma cacao]
 gb|EOX99392.1| GCR2-like 2 isoform 3 [Theobroma cacao]
Length=288

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF +D EF +AA+
Sbjct  131  TLKYMIRNRFP-SGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEVFGDD-EFLEAAV  188

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVV+  GL+K+VG+  G +GNAY  LSLYR TG   +  RA+AF  FL   A  +++
Sbjct  189  DAAEVVFNRGLLKRVGICHGISGNAYVFLSLYRKTGNVEFLYRAKAFACFLLDRAHKLIS  248

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE 
Sbjct  249  KGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGARFPAYEF  288



>ref|NP_175700.2| G-protein coupled receptor 2 [Arabidopsis thaliana]
 sp|F4IEM5.1|GCR2_ARATH RecName: Full=LanC-like protein GCR2; AltName: Full=G-protein 
coupled receptor 2 [Arabidopsis thaliana]
 gb|AEE32868.1| G-protein coupled receptor 2 [Arabidopsis thaliana]
Length=410

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N +EF +AA+E
Sbjct  254  TLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-NTKEFVEAAME  311

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL   +  +++ 
Sbjct  312  AGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISE  371

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  372  GQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  410



>pdb|3T33|A Chain A, Crystal Structure Of Arabidopsis Gcr2
Length=415

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QV+ N +EF +AA+E
Sbjct  259  TLSYMIQNRFP-SGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY-NTKEFVEAAME  316

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLT    Y  RA+AF SFL   +  +++ 
Sbjct  317  AGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISE  376

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             Q  G  D  +SLF+G+ G+A +  D+  P  + FPGYE+
Sbjct  377  GQMHG-GDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  415



>ref|XP_002263345.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657174.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657175.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 emb|CBI28768.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP  GNYP SE +   D LV WCHGA G+ +TL KA++VF +D EF +AAI
Sbjct  255  TLRYMIKNRFPR-GNYPASEEDRNGDVLVHWCHGAPGVALTLAKAAEVFGDD-EFLEAAI  312

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  +  RA+AF  FL   A  +++
Sbjct  313  DAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRAKAFACFLLDRAHKLIS  372

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G  G+A L+ D+I P  +RFP YE+
Sbjct  373  DGEMHG-GDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>ref|XP_010051804.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Eucalyptus 
grandis]
Length=419

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D EF  AA+
Sbjct  262  TLKYMIRNRFP-SGNYPSSEEDRNRDVLVHWCHGAPGIALTLVKAAEVF-RDEEFLRAAV  319

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GN Y  LSLYR+TG + +  RA+AF  FL   A  +++
Sbjct  320  DAAEVVWNRGLLKRVGICHGISGNVYVFLSLYRVTGNAEFLYRAKAFACFLLDRALKLIS  379

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D+ YSLF+G+ G A L+ D++ P  +RFP YE+
Sbjct  380  TGEMHG-GDNPYSLFEGIGGTAYLFLDMVEPSAARFPAYEL  419



>gb|AGV54697.1| lanC-like protein 2 [Phaseolus vulgaris]
Length=405

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 105/160 (66%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+N RFP SGNYP SEG+  D+ V WCHGA GI  TL KA +VF   +EF  AA++
Sbjct  249  TLRYMINYRFP-SGNYPSSEGSENDRFVHWCHGAPGIIFTLVKAGEVF-GGKEFLQAAVD  306

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVWK GL+K+VG+  G +GN Y    LYRLTG   Y   A+AFG FL   A  +++G
Sbjct  307  AGEVVWKRGLLKRVGICHGISGNPYVFFFLYRLTGNEEYLYMAKAFGCFLLDRAQKLISG  366

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G  G+A    D++ P  ++FPGYE 
Sbjct  367  GKMHG-GDCPYSLFEGFGGMAYTCLDMVDPKMAKFPGYEF  405



>gb|EYU26156.1| hypothetical protein MIMGU_mgv1a007017mg [Erythranthe guttata]
Length=422

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ N+FP SGNYPVSE +  RD LV WCHGA GI +TL KA+ VF  D+EF + A+
Sbjct  265  TLKYMIKNQFP-SGNYPVSEEDKTRDALVHWCHGAPGIALTLTKAAMVF-GDKEFLEGAM  322

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K++G+  G +GNAY  LSLYRLTG   Y  RA+AF SFL    G  M 
Sbjct  323  GAAEVVWNRGLLKRIGMCHGISGNAYVFLSLYRLTGVVEYLYRAKAFASFLLD--GTHML  380

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             S G+  + D+ +SLF+G+ G+  L+ D++ P N+RFP YE
Sbjct  381  ISTGELHSGDNPFSLFEGMGGMTHLFLDMVQPKNARFPAYE  421



>emb|CAN64758.1| hypothetical protein VITISV_008093 [Vitis vinifera]
Length=412

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP  GNYP SE +   D LV WCHGA G+ +TL KA++VF +D EF +AAI
Sbjct  255  TLRYMIKNRFPR-GNYPASEEDRNGDVLVHWCHGAPGVALTLAKAAEVFGDD-EFLEAAI  312

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYRLTG+  +  RA+AF  FL   A  +++
Sbjct  313  DAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRAKAFACFLLDRAHKLIS  372

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G  G+A L+ D+I P  +RFP YE+
Sbjct  373  DGEMHG-GDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>gb|KDP24150.1| hypothetical protein JCGZ_25807 [Jatropha curcas]
Length=414

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL YM+ NRFP SGNYP SE +  RD LV WCHGA G+ +TL KA++VF  D EF  AA+
Sbjct  257  TLNYMIKNRFP-SGNYPPSEEDRKRDVLVHWCHGAPGVALTLVKAAKVFGVD-EFLQAAV  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYR+TG   +  RA+AF SFL   A  +++
Sbjct  315  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRMTGNLEFLYRAKAFTSFLLDRAHKLIS  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              + +G  D  YSLF+G+ G+A L+ D   P  SRFP YE+
Sbjct  375  AGEMNG-GDSPYSLFEGIGGMAYLFLDTTEPSESRFPAYEL  414



>ref|XP_006299729.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
 gb|EOA32627.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
Length=403

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  +REF +A  
Sbjct  246  TLRYMIKNRFP-SGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAAEVF-GEREFLEAGA  303

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GN Y  L+LYR TG S Y  RA+AF SFL      +++
Sbjct  304  AAAEVVWNRGLLKRVGICHGISGNTYVFLALYRATGRSEYLYRAKAFASFLLDRGPKLLS  363

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+AG+A L+FD++ P  +RFP YE+
Sbjct  364  QGEMHG-GDSPYSLFEGVAGMAYLFFDMVDPSQARFPCYEL  403



>gb|AAD20918.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE + + D LV WCHGA GI +TL KA++VF  +REF +A+ 
Sbjct  214  TLKYMIKNRFP-SGNYPASEEDKKKDILVHWCHGAPGIALTLGKAAEVF-GEREFLEASA  271

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY  L+LYR TG S Y  RA+AF SFL      +++
Sbjct  272  AAAEVVWNRGLLKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAFASFLLDRGPKLLS  331

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+AG+A L+ D++ P  +RFPGYE+
Sbjct  332  KGEMHG-GDSPYSLFEGVAGMAYLFLDMVDPSEARFPGYEL  371



>ref|XP_007043559.1| GCR2-like 2 isoform 1 [Theobroma cacao]
 gb|EOX99390.1| GCR2-like 2 isoform 1 [Theobroma cacao]
Length=408

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF +D EF +AA+
Sbjct  251  TLKYMIRNRFP-SGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEVFGDD-EFLEAAV  308

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVV+  GL+K+VG+  G +GNAY  LSLYR TG   +  RA+AF  FL   A  +++
Sbjct  309  DAAEVVFNRGLLKRVGICHGISGNAYVFLSLYRKTGNVEFLYRAKAFACFLLDRAHKLIS  368

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE 
Sbjct  369  KGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGARFPAYEF  408



>ref|NP_850003.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
 sp|Q8VZQ6.1|GCL2_ARATH RecName: Full=LanC-like protein GCL2; AltName: Full=G protein-coupled 
receptor 2-like protein 2; Short=Protein GCR2-like 
2 [Arabidopsis thaliana]
 gb|AAL36290.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20120.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07068.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
Length=405

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE + + D LV WCHGA GI +TL KA++VF  +REF +A+ 
Sbjct  248  TLKYMIKNRFP-SGNYPASEEDKKKDILVHWCHGAPGIALTLGKAAEVF-GEREFLEASA  305

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY  L+LYR TG S Y  RA+AF SFL      +++
Sbjct  306  AAAEVVWNRGLLKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAFASFLLDRGPKLLS  365

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+AG+A L+ D++ P  +RFPGYE+
Sbjct  366  KGEMHG-GDSPYSLFEGVAGMAYLFLDMVDPSEARFPGYEL  405



>ref|XP_009147647.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCR2 [Brassica 
rapa]
Length=409

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ + L KA+QVF  D EF +AA+E
Sbjct  253  TLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALALVKAAQVFRKD-EFVEAAME  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEV+W  GL+K VG+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  +++ 
Sbjct  311  AGEVLWNRGLLKXVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAFASFLLDKSEKLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  371  GKMHG-GDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  409



>gb|KJB79968.1| hypothetical protein B456_013G075200 [Gossypium raimondii]
Length=409

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TLRYM+ NRFP  GNYP SE + + D LV WCHGA GI +TL KA++VF +D EF +AA+
Sbjct  252  TLRYMIRNRFP-GGNYPASEQDRKSDVLVHWCHGAPGIALTLVKAAEVFGDD-EFLEAAV  309

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLY  TG   +  RA+AF  FL   A  +++
Sbjct  310  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYGKTGNVKFLYRAKAFACFLLDQAHKLIS  369

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D+I P  SRFP YE+
Sbjct  370  KGEMHG-GDRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL  409



>ref|XP_009357824.1| PREDICTED: lanC-like protein GCL2 [Pyrus x bretschneideri]
Length=414

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 6/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+NNRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA 
Sbjct  257  TLKYMINNRFP-SGNYPASEEDRHRDVLVHWCHGAPGIALTLAKAAKVF-GDKEFLEAAA  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVWK GL+K+VG+  G +GNAY  LSLY+LTG  ++  RA+AF  FL   A  ++ 
Sbjct  315  DAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYRAKAFACFLLDRAHKLI-  373

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             SQG+    D  YSLF+G+ G+A L  D++ P  ++FP YE
Sbjct  374  -SQGEMHRGDSPYSLFEGVGGMAYLLLDMVEPSQAKFPAYE  413



>ref|XP_008229171.1| PREDICTED: lanC-like protein GCL2 [Prunus mume]
Length=413

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 112/161 (70%), Gaps = 6/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM++NRFP SGNYP SE +  RD LV WCHGA GI +TL KA++ F  D+EF +AA+
Sbjct  256  TLKYMIDNRFP-SGNYPASEEDKNRDVLVHWCHGAPGIALTLAKAAKFF-GDKEFMEAAV  313

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A E+VWK GL+K+VG+  G +GNAY  LSLY+LTG   +  RA+AF  FL   A  ++ 
Sbjct  314  DAAEMVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNLGFLYRAKAFACFLVDRANKLI-  372

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
             S+G+    D  YSLF+G+ G+A L  D+I P  ++FP Y+
Sbjct  373  -SEGELHRGDSPYSLFEGVGGMAYLLLDMIEPSQAKFPAYK  412



>ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3 [Nelumbo nucifera]
Length=408

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP SE +  D LV WCHGA G+ +TL KA++VF   R+F  AA +
Sbjct  252  TLSYMIKNRF-SSGNYPSSEDDGTDCLVHWCHGAPGVALTLVKAAEVF-GGRQFLKAAGD  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   +  RA+AF  FL   A  +++ 
Sbjct  310  AGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAFACFLLDMAPKLISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  370  GKMHG-GDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  408



>ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nelumbo nucifera]
Length=409

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP SE +  D LV WCHGA G+ +TL KA++VF   R+F  AA +
Sbjct  253  TLSYMIKNRF-SSGNYPSSEDDGTDCLVHWCHGAPGVALTLVKAAEVF-GGRQFLKAAGD  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   +  RA+AF  FL   A  +++ 
Sbjct  311  AGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAFACFLLDMAPKLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  371  GKMHG-GDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  409



>ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nelumbo nucifera]
Length=436

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ NRF  SGNYP SE +  D LV WCHGA G+ +TL KA++VF   R+F  AA +
Sbjct  280  TLSYMIKNRF-SSGNYPSSEDDGTDCLVHWCHGAPGVALTLVKAAEVF-GGRQFLKAAGD  337

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GNAY  LSLYRLTG   +  RA+AF  FL   A  +++ 
Sbjct  338  AGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAFACFLLDMAPKLISE  397

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  398  GKMHG-GDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  436



>ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP S+G+  D+LV WCHGA G+ +TL KA++VF +D EF  AA E
Sbjct  254  TLRYMIRNRFP-SGNYPSSDGSESDRLVHWCHGAPGVALTLIKAAEVFSSD-EFLQAAAE  311

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +ARAF  FL+  A  +++ 
Sbjct  312  AAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKARAFACFLHARAQTLISE  371

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  372  GVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana sylvestris]
Length=408

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP S+G+  D+LV WCHGA G+ +TL KA++VF +D EF  AA E
Sbjct  252  TLRYMIRNRFP-SGNYPSSDGSESDRLVHWCHGAPGVALTLIKAAEVFSSD-EFLQAAAE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +ARAF  FL+  A  +++ 
Sbjct  310  AAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKARAFACFLHARAQTLISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  370  GVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|XP_006392852.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
 gb|ESQ30138.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
Length=409

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM  +RFP SGNY  SEGN  D LV WCHGATG+ +TL KA+QV     E  +AA+E
Sbjct  253  TLAYMFLHRFP-SGNYLSSEGNESDCLVHWCHGATGVALTLVKAAQVL-RTVELVEAAME  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+VG+  G +GN Y  LSLYRLTG+  Y  RA+AF SFL   +  +++ 
Sbjct  311  AGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAFASFLLDKSEKLISE  370

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++FD+  P  + FP YE+
Sbjct  371  GEMHG-GDRPFSLFEGIGGMAYMFFDMNDPTRALFPAYEL  409



>emb|CDY05791.1| BnaC07g00120D [Brassica napus]
Length=269

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 7/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+Y++NNRFP +GNYP SE + R D LV WCHGA G   TL KA++VF  +REF +A  
Sbjct  115  TLKYIINNRFP-NGNYPASEEDRRRDFLVHWCHGAPG---TLVKAAEVF-GEREFLEAGE  169

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY SLSLYR TG + Y  +A+AF SFL      +++
Sbjct  170  AAAEVVWNRGLLKQVGICHGISGNAYVSLSLYRATGRNEYLHQAKAFASFLLDKGHKLLS  229

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  230  KGEMHG-GDSPYSLFEGVGGMAYLFLDMVDPSQARFPGYEL  269



>ref|XP_010248544.1| PREDICTED: lanC-like protein GCL1 [Nelumbo nucifera]
Length=121

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            T RYMM NRFPHSGNYP SE N RDKLVQW H ATG+ ITLC A+ VF  DREFRDAA E
Sbjct  24   TFRYMMKNRFPHSGNYPSSEDNSRDKLVQWSHRATGMAITLCNAAWVFSCDREFRDAATE  83

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESI  338
            AGEVVWK+GL +KVGL+DG +GNAYA LS   LT  SI
Sbjct  84   AGEVVWKNGLARKVGLSDGVSGNAYAFLSDILLTCMSI  121



>ref|XP_008381258.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=414

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 6/161 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNP-RDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+NNRFP SGNYP SE +  RD LV WCHGA GI +TL KA++VF  D+EF +AA 
Sbjct  257  TLKYMINNRFP-SGNYPASEEDRHRDVLVHWCHGAPGIALTLAKAAKVF-GDKEFLEAAA  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVWK GL+K+VG+  G +GNAY  LSLY+LTG  ++  RA+AF  FL   +  ++ 
Sbjct  315  DAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYRAKAFACFLLDRSHKLI-  373

Query  274  GSQGD-GAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
              QG+    D  YSLF+G+ G+A L  D++ P  ++FP YE
Sbjct  374  -XQGEMHRGDSPYSLFEGVGGMAYLLLDMLEPSQAKFPAYE  413



>ref|XP_004248157.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Solanum lycopersicum]
Length=413

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 4/160 (3%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+ NRFP SGNYP SE + R D LV WCHGA GI +TL KA++VF  D EF +AA+
Sbjct  257  TLKYMVKNRFP-SGNYPASENDRRRDLLVHWCHGAPGIVLTLVKAAEVF-GDEEFINAAV  314

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAYA LSLYRLTG + Y  RA+AF  FL   A  ++A
Sbjct  315  AAAEVVWNRGLLKRVGICHGISGNAYALLSLYRLTGNAEYLYRAKAFACFLLDRAHKLIA  374

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYE  155
              +  G  D  YSLF+G+AG+A L+ D+  P N+RFP YE
Sbjct  375  KGEMHG-GDTPYSLFEGIAGMAYLFLDMPDPKNARFPAYE  413



>ref|XP_010555129.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+Y++ NRFP  GNY  SE + R D LV WCHGA GI +TL KA++VF  D +F  AA 
Sbjct  248  TLKYLIKNRFP-CGNYAASEEDRRRDVLVHWCHGAPGIALTLTKAAKVF-GDGDFLKAAA  305

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYR T  + Y  RA+AF  FL   A ++++
Sbjct  306  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATSNTEYLYRAKAFACFLLDRAHELLS  365

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  366  EGEMHG-GDSPYSLFEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_010555131.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+Y++ NRFP  GNY  SE + R D LV WCHGA GI +TL KA++VF  D +F  AA 
Sbjct  248  TLKYLIKNRFP-CGNYAASEEDRRRDVLVHWCHGAPGIALTLTKAAKVF-GDGDFLKAAA  305

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            +A EVVW  GL+K+VG+  G +GNAY  LSLYR T  + Y  RA+AF  FL   A ++++
Sbjct  306  DAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATSNTEYLYRAKAFACFLLDRAHELLS  365

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G+A L+ D++ P  +RFPGYE+
Sbjct  366  EGEMHG-GDSPYSLFEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_011045509.1| PREDICTED: lanC-like protein GCL2 [Populus euphratica]
Length=409

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 107/161 (66%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGN-PRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+YM+NN FP SGNY  SE +  RD LV WCHGA GI +TL KA +VF  D+EF +AAI
Sbjct  252  TLKYMINNCFP-SGNYSTSEEDRKRDVLVHWCHGAPGIALTLVKAVKVF-GDKEFLEAAI  309

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+    +GNAY  LSLY+LTG   +  +A+AF  FL   A  +++
Sbjct  310  NAAEVVWNRGLLKRVGICHDISGNAYVFLSLYQLTGNIEFLYKAKAFTCFLLDRAHKLIS  369

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YS+F+G  G+A L+ D+I P  +RFP YE+
Sbjct  370  AGEMHG-GDSPYSMFEGTGGMAYLFLDMIDPSKARFPAYEL  409



>ref|XP_002467007.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
 gb|EER94005.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
Length=451

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TLRYM+ NRFP SGNYP SEGN  D+LV WCHGA G+ +TL KA +VF +D  F+ AA E
Sbjct  295  TLRYMIENRFP-SGNYPSSEGNESDRLVHWCHGAPGVALTLAKAYEVFHDDY-FKQAAAE  352

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GNAY  LSLYRL+G   Y  RA+AF  FL   A  ++A 
Sbjct  353  AAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLSGNVEYLYRAKAFACFLLEKADQLIAE  412

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D ++SLF+  AG+A L  D++ P  SRFP YE+
Sbjct  413  GAMHG-GDRSFSLFEEKAGMAYLLLDMVDPSESRFPAYEL  451



>ref|XP_010267752.1| PREDICTED: uncharacterized protein LOC104604881 [Nelumbo nucifera]
Length=195

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -1

Query  619  MMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIEAGEV  440
            MM +RFPHSGNYP SE NPRDKLVQW HGATG+ ITLC A++VF  DREFRDAAIEAGEV
Sbjct  74   MMKDRFPHSGNYPSSEDNPRDKLVQWSHGATGMSITLCNAARVFSCDREFRDAAIEAGEV  133

Query  439  VWKSGLVKKVGLADGTAGNAYASLSLYRLTGESI  338
            VW++GLV+KVGL+DG +GNAYA LS +  T E +
Sbjct  134  VWRNGLVRKVGLSDGVSGNAYAFLSDFIDTHEHL  167



>ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AA E
Sbjct  254  TLHYMIRNHFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLIKAAKVFSID-EFLQAAAE  311

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  312  AAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHARAQTLISE  371

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  372  GVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana tomentosiformis]
Length=408

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ N FP SGNYP SEG+  D+LV WCHGA G+ +TL KA++VF  D EF  AA E
Sbjct  252  TLHYMIRNHFP-SGNYPSSEGSESDRLVHWCHGAPGVALTLIKAAKVFSID-EFLQAAAE  309

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            A EVVW  GL+K+VG+  G +GN+Y  LSLYRLTG+  Y  +A+AF  FL+  A  +++ 
Sbjct  310  AAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAFACFLHARAQTLISE  369

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                G  D  YSLF+G+ G+A L+ D+I P  +RFP YE+
Sbjct  370  GVMHG-GDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|XP_009102106.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Brassica 
rapa]
Length=408

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL+Y++NNRFP S NYP SE + R D LV WCHGA GI +TL KA++     REF +A  
Sbjct  251  TLKYLINNRFP-SXNYPASEEDRRRDLLVHWCHGAPGIALTLVKAAEFL--GREFLEAGE  307

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             A EVVW  GL+K+VG+  G +GNAY  LS YR TG + Y  RA+AF SFL      +++
Sbjct  308  AAAEVVWNRGLLKRVGICHGISGNAYVFLSFYRATGRNEYLHRAKAFASFLLDRGHKLLS  367

Query  274  GSQGDGAADHAYSLFQGLAG-VACLWFDLIAPHNSRFPGYEI  152
              +  G  D  YSLF+G+ G +A L+ D++ P  +RFPGYE+
Sbjct  368  KGEMHG-GDSPYSLFEGVVGKMAYLFLDMVDPSQARFPGYEL  408



>ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 4/161 (2%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVS-EGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAI  455
            TL  M+ NRFP SGNYP S E + RD LV WCHGA G+ +TL KA +V   D+ F +AA 
Sbjct  253  TLLSMIQNRFP-SGNYPASGEDSRRDLLVHWCHGAPGVALTLIKAYEVL-GDKVFLEAAA  310

Query  454  EAGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            EA EVVW+ GL+K+VG+  G +GN Y  LSLYR+T    Y  RA+AF SFL  NA  ++A
Sbjct  311  EAAEVVWRRGLLKRVGICHGISGNTYVFLSLYRVTRNPSYLYRAKAFASFLLDNAHKLIA  370

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
              +  G  D+ YSLF+G+ G+A L+ D+  P ++RFP YE+
Sbjct  371  AGEMHG-GDNPYSLFEGIGGMAYLFLDMKEPTSARFPAYEL  410



>emb|CBG76444.1| OO_Ba0013J05-OO_Ba0033A15.31 [Oryza officinalis]
Length=1333

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 104/160 (65%), Gaps = 14/160 (9%)
 Frame = -1

Query  631   TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
             TLRYM+ NRFP SGNYP  E +  D+LV WCHGA GI +TL KASQVFP +R F +A  E
Sbjct  1188  TLRYMIENRFP-SGNYPTIEEDNYDRLVHWCHGAPGISLTLTKASQVFPEER-FLEAVAE  1245

Query  451   AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
             A EVVW  GL+K+VG+  G +GNAY  L+L+RLT +  +  RA+            I  G
Sbjct  1246  AAEVVWNRGLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAKQL----------IADG  1295

Query  271   SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
                 G  D  YSLF+G AG+A L+ D+I P +SRFPGYE+
Sbjct  1296  IMHSG--DKPYSLFEGQAGMAYLFLDMINPLDSRFPGYEL  1333



>gb|EFN72970.1| LanC-like protein 1 [Camponotus floridanus]
Length=351

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+P S GNP DKL+QWCHGA GI I  C A +VF  D  F + AI 
Sbjct  195  SLYYLQRLQFS-SGNFPSSTGNPSDKLIQWCHGAPGISILFCLAYKVF-EDNTFLETAIR  252

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV W+ GL+KK   +  G AGN Y  + L++ T +  Y  RA  F  + +H       
Sbjct  253  CGEVTWERGLLKKGYSICHGVAGNGYTFIYLFQQTKDVKYLYRACKFAEWCFH------Y  306

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            GS  +   D  +SLF+GLAGV     D+  PH ++FP Y+I
Sbjct  307  GSHQNRCPDRPFSLFEGLAGVIYFLLDVQQPHLAKFPTYDI  347



>ref|XP_011268961.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein 1 [Camponotus 
floridanus]
Length=404

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+P S GNP DKL+QWCHGA GI I  C A +VF  D  F + AI 
Sbjct  248  SLYYLQRLQFS-SGNFPSSTGNPSDKLIQWCHGAPGISILFCLAYKVF-EDNTFLETAIR  305

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV W+ GL+KK   +  G AGN Y  + L++ T +  Y  RA  F  + +H       
Sbjct  306  CGEVTWERGLLKKGYSICHGVAGNGYTFIYLFQQTKDVKYLYRACKFAEWCFH------Y  359

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            GS  +   D  +SLF+GLAGV     D+  PH ++FP Y+I
Sbjct  360  GSHQNRCPDRPFSLFEGLAGVIYFLLDVQQPHLAKFPTYDI  400



>ref|XP_005658651.1| PREDICTED: lanC-like protein 2-like [Sus scrofa]
Length=431

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+  TL +A +VF  ++  RD A+E
Sbjct  231  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRD-AVE  288

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  289  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LEY  342

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  +RFP +E+
Sbjct  343  GAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFEL  383



>ref|XP_006757252.1| PREDICTED: lanC-like protein 2 [Myotis davidii]
 gb|ELK35145.1| LanC-like protein 2 [Myotis davidii]
Length=391

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA+G+   L +A +VF  D+  +D A+E
Sbjct  230  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGASGVIHMLMQAYKVFREDKYLKD-AME  287

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  GL  GTAGN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  288  CSDVIWQRGLLRKGYGLCHGTAGNGYAFLSLYHLTQDRKYLYRACKFAEWC------LDY  341

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  342  GAHGCRIPDRPYSLFEGMAGAIHFLSDVLAPETSRFPAFEL  382



>ref|XP_004018608.1| PREDICTED: lanC-like protein 2 [Ovis aries]
Length=392

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  227  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLVQAYKVFKEEKYLKD-AVE  284

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY +T +  Y  RA  F  +       +  
Sbjct  285  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHITQDKKYLYRACKFAEWC------LDY  338

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  339  GAHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  379



>ref|XP_006912141.1| PREDICTED: lanC-like protein 2 [Pteropus alecto]
Length=396

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A QVF  ++  +D A+E
Sbjct  231  SIDYLRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYQVFKEEKYLKD-AME  288

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  289  CSDVIWQRGLLRKGYGVCHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LEY  342

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  343  GAHGCRIPDRPYSLFEGMAGTIHFLSDVLVPETSRFPAFEL  383



>ref|XP_004602091.1| PREDICTED: lanC-like protein 2 [Sorex araneus]
Length=396

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  231  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVSHMLMQAYKVFKEEKYLKD-AME  288

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  289  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LDY  342

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  343  GTHGCRIPDRPYSLFEGMAGTIHFLSDILVPETSRFPAFEL  383



>gb|ELK12680.1| LanC-like protein 2 [Pteropus alecto]
Length=459

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A QVF  ++  +D A+E
Sbjct  294  SIDYLRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYQVFKEEKYLKD-AME  351

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  352  CSDVIWQRGLLRKGYGVCHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LEY  405

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  406  GAHGCRIPDRPYSLFEGMAGTIHFLSDVLVPETSRFPAFEL  446



>ref|XP_007463743.1| PREDICTED: lanC-like protein 2 [Lipotes vexillifer]
Length=370

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  205  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  262

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  263  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTRDKKYLYRACKFAEWC------LEY  316

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  317  GTHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  357



>ref|XP_003744937.1| PREDICTED: lanC-like protein 2-like [Metaseiulus occidentalis]
Length=376

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 91/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            T+ ++++ ++  SGNYP S G+  D+LV WCHGA G      KA +VF  D  +   A +
Sbjct  224  TIEFLISQKY-RSGNYPSSLGSTSDRLVHWCHGAPGFLFLFAKAYEVF-GDAPYLQEARQ  281

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +VVWK GL+KK  GL  G AGNAY  L LY+LT E  Y  RA  F  F          
Sbjct  282  CADVVWKRGLLKKGYGLCHGVAGNAYCFLRLYKLTMEDCYLYRAARFAEFC------CAY  335

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G   AD  YSLF+G+AG      D++ P  S+FPG+E+
Sbjct  336  GTHGCRVADRPYSLFEGMAGTIHFLVDMLRPLESKFPGFEV  376



>ref|XP_007118424.1| PREDICTED: lanC-like protein 2 [Physeter catodon]
Length=481

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  316  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIYMLMQAYKVFKEEKYLKD-AME  373

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  374  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTRDKKYLYRACKFAEWC------LEY  427

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  428  GTHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  468



>emb|CDY26028.1| BnaC06g05960D [Brassica napus]
Length=386

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 96/160 (60%), Gaps = 26/160 (16%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF  D EF +AA+E
Sbjct  253  TLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFRKD-EFVEAAME  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+                      E +Y  RA+AF SFL   +  +++ 
Sbjct  311  AGEVVWNRGLLKR---------------------PEYLY--RAKAFASFLLDKSEKLISE  347

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  348  GKMQG-GDRRFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>ref|XP_006634360.1| PREDICTED: lanC-like protein 2-like [Lepisosteus oculatus]
Length=432

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+   L +A  VF  ++  +D A+E
Sbjct  280  SIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLIQAYMVFKEEKYLKD-AVE  337

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL++K  G+  GTAGN Y+ LSLY+LT E  Y  RA  F  +       +  
Sbjct  338  CGEVIWQRGLLRKGYGICHGTAGNGYSFLSLYKLTQEKKYLYRACKFAEWC------LDY  391

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  392  GTHGCRIPDRPYSLFEGMAGAIHYLSDVLMPETSRFPAFEL  432



>ref|XP_011215196.1| PREDICTED: lanC-like protein 2 isoform X2 [Ailuropoda melanoleuca]
Length=404

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  243  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLVQAYKVFKEEKYLKD-AME  300

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  301  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHLTQDKKYLYRACKFAEWC------LEY  354

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  355  GTHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSRFPAFEL  395



>ref|XP_005695556.1| PREDICTED: lanC-like protein 2 [Capra hircus]
Length=462

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  297  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAYKVFKEEKYLKD-AVE  354

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY +T +  Y  RA  F  +       +  
Sbjct  355  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHITQDKKYLYRACKFAEWC------LDY  408

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  409  GAHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  449



>ref|XP_011369800.1| PREDICTED: lanC-like protein 2 [Pteropus vampyrus]
 ref|XP_011369801.1| PREDICTED: lanC-like protein 2 [Pteropus vampyrus]
Length=379

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHG+ G+   L +A QVF  ++  +D A+E
Sbjct  205  SIDYLRHKRF-RSGNYPSSLSNETDRLVHWCHGSPGVIHMLMQAYQVFKEEKYLKD-AME  262

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  263  CSDVIWQRGLLRKGYGVCHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LEY  316

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  317  GAHGCRIPDRPYSLFEGMAGTIHFLSDVLVPETSRFPAFEL  357



>ref|XP_008701796.1| PREDICTED: lanC-like protein 2 [Ursus maritimus]
Length=388

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  227  SVDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLVQAYKVFKEEKYLKD-AME  284

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  285  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHLTQDKKYLYRACKFAEWC------LEY  338

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  339  GAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSRFPAFEL  379



>ref|XP_006074845.1| PREDICTED: lanC-like protein 2, partial [Bubalus bubalis]
Length=389

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  224  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAYKVFKEEKYLKD-AVE  281

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY +T +  Y  RA  F  +       +  
Sbjct  282  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWC------LEY  335

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  336  GAHGCRIPDRPYSLFEGMAGTIHFLSDILAPEASRFPAFEL  376



>ref|XP_002930203.1| PREDICTED: lanC-like protein 2 isoform X1 [Ailuropoda melanoleuca]
Length=453

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  292  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLVQAYKVFKEEKYLKD-AME  349

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  350  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHLTQDKKYLYRACKFAEWC------LEY  403

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  404  GTHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSRFPAFEL  444



>gb|EFB24809.1| hypothetical protein PANDA_020566 [Ailuropoda melanoleuca]
Length=450

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  292  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLVQAYKVFKEEKYLKD-AME  349

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  350  CSDVIWQRGLLRKGYGICHGTAGNGYAFLSLYHLTQDKKYLYRACKFAEWC------LEY  403

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  404  GTHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSRFPAFEL  444



>ref|NP_001095726.1| lanC-like protein 2 [Bos taurus]
 gb|AAI49312.1| LANCL2 protein [Bos taurus]
Length=433

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  269  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAHKVFKEEKYLKD-AVE  326

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY +T +  Y  RA  F  +       +  
Sbjct  327  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWC------LEY  380

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  381  GAHGCRIPDRPYSLFEGMAGTIHFLSDILAPEASRFPAFEL  421



>emb|CDY53809.1| BnaA06g01740D [Brassica napus]
Length=386

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 96/160 (60%), Gaps = 26/160 (16%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            TL YM+ +RFP SGNY  SEG+  D+LV WCHGA G+ +TL KA+QVF  D EF +AA+E
Sbjct  253  TLSYMIQHRFP-SGNYLSSEGSESDRLVHWCHGAPGVALTLVKAAQVFRTD-EFVEAAME  310

Query  451  AGEVVWKSGLVKKVGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMAG  272
            AGEVVW  GL+K+                      E +Y  RA+AF SFL   +  +++ 
Sbjct  311  AGEVVWNRGLLKR---------------------PEYLY--RAKAFASFLLDKSEKLISE  347

Query  271  SQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
             +  G  D  +SLF+G+ G+A ++ D+  P  + FPGYE+
Sbjct  348  GKMHG-GDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>ref|XP_005904454.1| PREDICTED: lanC-like protein 2 [Bos mutus]
 ref|XP_010832232.1| PREDICTED: lanC-like protein 2 isoform X1 [Bison bison bison]
 gb|ELR50053.1| LanC-like protein 2 [Bos mutus]
Length=452

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  287  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAHKVFKEEKYLKD-AVE  344

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY +T +  Y  RA  F  +       +  
Sbjct  345  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWC------LEY  398

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  399  GAHGCRIPDRPYSLFEGMAGTIHFLSDILAPEASRFPAFEL  439



>ref|XP_005975688.1| PREDICTED: lanC-like protein 2 [Pantholops hodgsonii]
Length=418

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  253  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAYKVFKEEKYLKD-AVE  310

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY +T +  Y  RA  F  +       +  
Sbjct  311  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWC------LDY  364

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  365  GAHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  405



>ref|XP_008148865.1| PREDICTED: lanC-like protein 2, partial [Eptesicus fuscus]
Length=402

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA+G+   L +A +VF  ++  +D A+E
Sbjct  241  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGASGVIHMLMQAYKVFKEEKYLKD-AME  298

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  GL  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  299  CSDVIWQRGLLRKGYGLCHGTAGNGYSFLSLYHLTRDRKYLYRACKFAEWC------LDY  352

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  353  GAHGCRIPDRPYSLFEGMAGAIHFLSDVLAPETSRFPAFEL  393



>ref|XP_797679.2| PREDICTED: lanC-like protein 2-like [Strongylocentrotus purpuratus]
Length=411

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            T+ Y++  RFP SGN+P S GN  DKL+ WCHGA G+   L +A +VF  D ++  AA++
Sbjct  258  TVDYILELRFP-SGNFPSSLGNQSDKLIHWCHGAPGVVHMLLQAHKVF-GDAKYLSAAVD  315

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             G VVW+ G+++K  GL  GTAGNAYA L+LY+ T +  Y  +A  F  +       +  
Sbjct  316  CGTVVWERGILRKGYGLCHGTAGNAYAFLALYQATKDEQYLYKACKFAEWC------MDY  369

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPG  161
            G  G   AD  YSL +G+AG      DL+ P+++RFPG
Sbjct  370  GKHGCKLADRPYSLMEGMAGTIYFLSDLLHPNDARFPG  407



>ref|XP_004283055.1| PREDICTED: lanC-like protein 2 [Orcinus orca]
 ref|XP_004310874.1| PREDICTED: lanC-like protein 2 [Tursiops truncatus]
Length=452

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  ++ A+E
Sbjct  287  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE-AME  344

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  345  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTRDKKYLYRACKFAEWC------LEY  398

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  399  GTHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  439



>ref|NP_001133442.1| LanC-like protein 2 [Salmo salar]
 gb|ACI33244.1| LanC-like protein 2 [Salmo salar]
Length=432

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 96/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+   L  A +VF +++  +D A+E
Sbjct  280  SVDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLIMAHKVFKDEKYLKD-AVE  337

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL++K  G+  GTAGNAY+ L+LY+LT E  Y  RA  F  +       +  
Sbjct  338  CGEVIWQRGLLRKGYGICHGTAGNAYSFLTLYQLTQEKKYLYRACKFAEWC------LDY  391

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      DL  P +S FP +E+
Sbjct  392  GTHGCRIPDRPYSLFEGMAGAIHYLSDLTQPESSCFPAFEL  432



>ref|XP_007187727.1| PREDICTED: lanC-like protein 2 [Balaenoptera acutorostrata scammoni]
Length=370

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y  + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  205  SIDYTRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  262

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  263  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTRDKKYLYRACKFAEWC------LDY  316

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  317  GTHGCRIPDRPYSLFEGMAGTVHFLSDILAPEASRFPAFEL  357



>ref|XP_004668898.1| PREDICTED: lanC-like protein 2 [Jaculus jaculus]
Length=346

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A QVF  ++  ++ A++
Sbjct  188  SIDYLRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYQVFKEEKYLKE-AMD  245

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GT+GN YA LSLY LT +  Y  RA  F  +       +  
Sbjct  246  CSDVIWQRGLLRKGYGICHGTSGNGYAFLSLYHLTQDKKYLYRACKFAEWC------LDY  299

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI*TLK  140
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+ +L+
Sbjct  300  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFELGSLQ  344



>gb|AAH04887.2| LANCL2 protein, partial [Homo sapiens]
Length=252

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  ++ A+E
Sbjct  94   SIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE-AME  151

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLYRLT +  Y  RA  F  +       +  
Sbjct  152  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC------LDY  205

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  206  GAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  246



>ref|XP_008506329.1| PREDICTED: lanC-like protein 2 [Equus przewalskii]
Length=362

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  197  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  254

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GT+GN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  255  CSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYHLTQDRKYLYRACKFAEWC------LEY  308

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  309  GAHGCRIPDRPYSLFEGMAGAIHFLSDVLVPETSRFPAFEL  349



>ref|XP_006219526.1| PREDICTED: lanC-like protein 2-like [Vicugna pacos]
Length=426

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  261  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AVE  318

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  G AGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  319  CSDVIWQRGLLRKGYGICHGAAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  372

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  373  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFEL  413



>ref|XP_005609226.1| PREDICTED: lanC-like protein 2, partial [Equus caballus]
Length=411

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  246  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  303

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GT+GN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  304  CSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYHLTQDRKYLYRACKFAEWC------LEY  357

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  358  GAHGCRIPDRPYSLFEGMAGAIHFLSDVLVPETSRFPAFEL  398



>ref|XP_007535283.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein 2 [Erinaceus 
europaeus]
Length=406

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  242  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVVHMLMQAYKVFKEEKYLKD-AME  299

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT E  Y  RA  F  +       +  
Sbjct  300  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQEKKYLYRACKFAEWC------LDY  353

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  S+FP +E+
Sbjct  354  GAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSQFPAFEL  394



>ref|XP_010967451.1| PREDICTED: lanC-like protein 2 [Camelus bactrianus]
Length=408

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  243  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  300

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  G AGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  301  CSDVIWQRGLLRKGYGICHGAAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  354

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  355  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFEL  395



>ref|XP_008825772.1| PREDICTED: lanC-like protein 2 [Nannospalax galili]
Length=449

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A QVF  ++  ++ A+E
Sbjct  291  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAHQVFKEEKYLKE-AME  348

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GT+GN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  349  CSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LDY  402

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI*TLK  140
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+ +L+
Sbjct  403  GAHGCRIPDRPYSLFEGMAGAVHFLSDILVPETSRFPAFELGSLQ  447



>ref|XP_010995335.1| PREDICTED: lanC-like protein 2, partial [Camelus dromedarius]
Length=406

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  241  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  298

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  G AGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  299  CSDVIWQRGLLRKGYGICHGAAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  352

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  353  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFEL  393



>ref|XP_011173044.1| PREDICTED: lanC-like protein 1 isoform X2 [Solenopsis invicta]
Length=407

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+  S G+P D+LVQWCHGA G+    C A +VF  D  F + AI+
Sbjct  255  SLYYLKKLQFS-SGNFLSSVGSPSDRLVQWCHGAPGMSALFCLAYKVF-EDSTFLEIAIQ  312

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL+KK   +  G AGN YA + L++ T +  Y  RA  F  + +H       
Sbjct  313  CGEVIWERGLLKKGYSICHGVAGNGYAFIHLFQQTKDIKYLYRACKFAEWCFH------Y  366

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G   + + D  +SLF+GLAGV     D+  PH+++FP Y+I
Sbjct  367  GLHQNRSPDRPFSLFEGLAGVIYFLLDVQQPHSAKFPTYDI  407



>ref|XP_003406133.1| PREDICTED: lanC-like protein 1 isoform X1 [Loxodonta africana]
 ref|XP_010600491.1| PREDICTED: lanC-like protein 1 isoform X1 [Loxodonta africana]
Length=399

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+   +FP SGNYP   G+ RD LV WCHGA G+   L +A +VF  +R  RD A +
Sbjct  247  SVDYVCQLKFP-SGNYPPCVGDNRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLRD-AYQ  304

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL+KK  GL  GTAGNAYA L+LY LT +  Y  RA  F  +       +  
Sbjct  305  CADVIWQYGLLKKGYGLCHGTAGNAYAFLTLYNLTQDMKYLYRACKFAEWC------LDY  358

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G  G    D  +SLF+G+AG      DL+ P  ++FP +E+
Sbjct  359  GEHGCRTPDTPFSLFEGMAGTIYFLSDLLVPMKAKFPAFEL  399



>gb|EFZ09548.1| hypothetical protein SINV_11015 [Solenopsis invicta]
Length=416

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+  S G+P D+LVQWCHGA G+    C A +VF  D  F + AI+
Sbjct  264  SLYYLKKLQFS-SGNFLSSVGSPSDRLVQWCHGAPGMSALFCLAYKVF-EDSTFLEIAIQ  321

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL+KK   +  G AGN YA + L++ T +  Y  RA  F  + +H       
Sbjct  322  CGEVIWERGLLKKGYSICHGVAGNGYAFIHLFQQTKDIKYLYRACKFAEWCFH------Y  375

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G   + + D  +SLF+GLAGV     D+  PH+++FP Y+I
Sbjct  376  GLHQNRSPDRPFSLFEGLAGVIYFLLDVQQPHSAKFPTYDI  416



>ref|XP_011173043.1| PREDICTED: lanC-like protein 1 isoform X1 [Solenopsis invicta]
Length=424

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+  S G+P D+LVQWCHGA G+    C A +VF  D  F + AI+
Sbjct  272  SLYYLKKLQFS-SGNFLSSVGSPSDRLVQWCHGAPGMSALFCLAYKVF-EDSTFLEIAIQ  329

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL+KK   +  G AGN YA + L++ T +  Y  RA  F  + +H       
Sbjct  330  CGEVIWERGLLKKGYSICHGVAGNGYAFIHLFQQTKDIKYLYRACKFAEWCFH------Y  383

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G   + + D  +SLF+GLAGV     D+  PH+++FP Y+I
Sbjct  384  GLHQNRSPDRPFSLFEGLAGVIYFLLDVQQPHSAKFPTYDI  424



>ref|XP_011173045.1| PREDICTED: lanC-like protein 1 isoform X3 [Solenopsis invicta]
 ref|XP_011173046.1| PREDICTED: lanC-like protein 1 isoform X3 [Solenopsis invicta]
 ref|XP_011173047.1| PREDICTED: lanC-like protein 1 isoform X3 [Solenopsis invicta]
Length=405

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            +L Y+   +F  SGN+  S G+P D+LVQWCHGA G+    C A +VF  D  F + AI+
Sbjct  253  SLYYLKKLQFS-SGNFLSSVGSPSDRLVQWCHGAPGMSALFCLAYKVF-EDSTFLEIAIQ  310

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
             GEV+W+ GL+KK   +  G AGN YA + L++ T +  Y  RA  F  + +H       
Sbjct  311  CGEVIWERGLLKKGYSICHGVAGNGYAFIHLFQQTKDIKYLYRACKFAEWCFH------Y  364

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G   + + D  +SLF+GLAGV     D+  PH+++FP Y+I
Sbjct  365  GLHQNRSPDRPFSLFEGLAGVIYFLLDVQQPHSAKFPTYDI  405



>ref|XP_007423495.1| PREDICTED: lanC-like protein 2 [Python bivittatus]
Length=462

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + +F  SGNYP S  N  D+LV WCHGA G+   L +A +VF  D+  +D A+E
Sbjct  297  SIDYVRHKKF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEDKYLKD-AME  354

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
            + +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  355  SSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LDY  408

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  409  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPEQSRFPAFEL  449



>ref|XP_005676543.1| PREDICTED: lanC-like protein 1 isoform X1 [Capra hircus]
 ref|XP_005676544.1| PREDICTED: lanC-like protein 1 isoform X2 [Capra hircus]
 ref|XP_005676545.1| PREDICTED: lanC-like protein 1 isoform X3 [Capra hircus]
 ref|XP_005676546.1| PREDICTED: lanC-like protein 1 isoform X4 [Capra hircus]
Length=424

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+   +FP SGNYP    + RD LV WCHGA G+   L +A +VF  +R   D A +
Sbjct  272  SVDYVCQLKFP-SGNYPPCVDDSRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLND-AYQ  329

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL+KK  GL  GTAGNAYA LSLY+LT ++ Y  RA  F  +       +  
Sbjct  330  CADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYKLTQDAKYLYRACKFAEWC------LDY  383

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G  G    D  +SLF+G+AG      DL+ P  +RFP +E+
Sbjct  384  GEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL  424



>ref|XP_004004942.1| PREDICTED: lanC-like protein 1 [Ovis aries]
 ref|XP_005676547.1| PREDICTED: lanC-like protein 1 isoform X5 [Capra hircus]
Length=399

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+   +FP SGNYP    + RD LV WCHGA G+   L +A +VF  +R   D A +
Sbjct  247  SVDYVCQLKFP-SGNYPPCVDDSRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLND-AYQ  304

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL+KK  GL  GTAGNAYA LSLY+LT ++ Y  RA  F  +       +  
Sbjct  305  CADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYKLTQDAKYLYRACKFAEWC------LDY  358

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G  G    D  +SLF+G+AG      DL+ P  +RFP +E+
Sbjct  359  GEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL  399



>ref|XP_004417378.1| PREDICTED: lanC-like protein 2 [Odobenus rosmarus divergens]
Length=453

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  292  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  349

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  350  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  403

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  S+FP +E+
Sbjct  404  GAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSQFPAFEL  444



>ref|XP_005631064.1| PREDICTED: lanC-like protein 2 [Canis lupus familiaris]
Length=566

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+ + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  405  SIDYVRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  462

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  GTAGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  463  CSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  516

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++AP  SRFP +E+
Sbjct  517  GAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETSRFPAFEL  557



>ref|XP_006192458.1| PREDICTED: lanC-like protein 2-like [Camelus ferus]
Length=459

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ YM + RF  SGNYP S  N  D+LV WCHGA G+   L +A +VF  ++  +D A+E
Sbjct  294  SIDYMRHKRF-RSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKD-AME  351

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              +V+W+ GL++K  G+  G AGN Y+ LSLY LT +  Y  RA  F  +       +  
Sbjct  352  CSDVIWQRGLLRKGYGICHGAAGNGYSFLSLYHLTQDKKYLYRACKFAEWC------LEY  405

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G+ G    D  YSLF+G+AG      D++ P  SRFP +E+
Sbjct  406  GAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFEL  446



>ref|XP_009965174.1| PREDICTED: lanC-like protein 1 [Tyto alba]
Length=194

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  631  TLRYMMNNRFPHSGNYPVSEGNPRDKLVQWCHGATGIGITLCKASQVFPNDREFRDAAIE  452
            ++ Y+   +FP SGNYP    + RD LV WCHGA G+   L +A +VF  ++++ + A++
Sbjct  42   SVDYLCQLKFP-SGNYPPCIDDTRDLLVHWCHGAPGVIYMLVQAYKVF-GEQQYLNDALQ  99

Query  451  AGEVVWKSGLVKK-VGLADGTAGNAYASLSLYRLTGESIYQERARAFGSFLYHNAGDIMA  275
              EV+W+ GL+KK  GL  GTAGNAY  L+LY LT    Y  RA  F  +       +  
Sbjct  100  CAEVIWQHGLLKKGYGLCHGTAGNAYGFLALYNLTQNMKYLYRACKFAEWC------LSY  153

Query  274  GSQGDGAADHAYSLFQGLAGVACLWFDLIAPHNSRFPGYEI  152
            G  G    D  +SLF+G+AG      DL+ P  +RFP +E+
Sbjct  154  GQHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875