BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041P01

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093709.1|  hypothetical protein L484_019050                   202   1e-62   Morus notabilis
ref|XP_010264244.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    201   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010662384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    199   1e-61   Vitis vinifera
gb|EPS58672.1|  hypothetical protein M569_16139                         199   2e-61   Genlisea aurea
ref|XP_010258983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    199   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011018294.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    199   2e-61   Populus euphratica
ref|XP_011070110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    198   4e-61   Sesamum indicum [beniseed]
ref|XP_007039883.1|  NADH dehydrogenase 1 beta subcomplex subunit 8     198   5e-61   
ref|XP_009378949.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    197   8e-61   Pyrus x bretschneideri [bai li]
ref|XP_010055510.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    197   1e-60   Eucalyptus grandis [rose gum]
ref|XP_007215154.1|  hypothetical protein PRUPE_ppa013399mg             196   2e-60   Prunus persica
ref|XP_010530067.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_004147198.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   4e-60   Cucumis sativus [cucumbers]
ref|XP_007155645.1|  hypothetical protein PHAVU_003G219300g             196   4e-60   Phaseolus vulgaris [French bean]
ref|XP_008228960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   4e-60   Prunus mume [ume]
ref|NP_001235493.1|  uncharacterized protein LOC100499749               195   6e-60   Glycine max [soybeans]
ref|XP_006355476.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    194   1e-59   Solanum tuberosum [potatoes]
ref|XP_006398455.1|  hypothetical protein EUTSA_v10001074mg             194   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_008343083.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    194   1e-59   
ref|XP_007161348.1|  hypothetical protein PHAVU_001G061600g             195   1e-59   Phaseolus vulgaris [French bean]
ref|XP_002518112.1|  conserved hypothetical protein                     194   2e-59   Ricinus communis
ref|XP_004516831.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    194   2e-59   Cicer arietinum [garbanzo]
emb|CDY17725.1|  BnaA06g35440D                                          194   2e-59   Brassica napus [oilseed rape]
ref|XP_009101408.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    194   2e-59   Brassica rapa
emb|CDY41058.1|  BnaA09g18370D                                          193   2e-59   Brassica napus [oilseed rape]
ref|XP_009770592.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    193   3e-59   Nicotiana sylvestris
ref|XP_004245753.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    193   3e-59   Solanum lycopersicum
gb|KHG13058.1|  hypothetical protein F383_17357                         193   4e-59   Gossypium arboreum [tree cotton]
emb|CDP09936.1|  unnamed protein product                                193   4e-59   Coffea canephora [robusta coffee]
ref|XP_009114266.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    192   8e-59   Brassica rapa
emb|CDX77778.1|  BnaC07g20320D                                          192   1e-58   
gb|KHG01041.1|  hypothetical protein F383_21717                         192   1e-58   Gossypium arboreum [tree cotton]
ref|XP_009602608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    192   1e-58   Nicotiana tomentosiformis
gb|KHN09808.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomplex...    192   1e-58   Glycine soja [wild soybean]
gb|EYU32869.1|  hypothetical protein MIMGU_mgv1a016342mg                191   2e-58   Erythranthe guttata [common monkey flower]
gb|KJB21488.1|  hypothetical protein B456_004G200300                    191   2e-58   Gossypium raimondii
ref|XP_006281322.1|  hypothetical protein CARUB_v10027375mg             191   2e-58   Capsella rubella
gb|ABK94153.1|  unknown                                                 191   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010919522.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    191   2e-58   Elaeis guineensis
gb|KJB51916.1|  hypothetical protein B456_008G237800                    191   2e-58   Gossypium raimondii
emb|CDY28920.1|  BnaA02g25560D                                          191   3e-58   Brassica napus [oilseed rape]
emb|CDY40556.1|  BnaC02g33360D                                          190   5e-58   Brassica napus [oilseed rape]
ref|XP_006830041.1|  hypothetical protein AMTR_s00124p00115680          190   5e-58   Amborella trichopoda
ref|XP_011466981.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    190   7e-58   Fragaria vesca subsp. vesca
ref|XP_009128982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    190   8e-58   Brassica rapa
ref|XP_010441437.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    189   1e-57   Camelina sativa [gold-of-pleasure]
gb|KFK31361.1|  hypothetical protein AALP_AA6G102500                    188   3e-57   Arabis alpina [alpine rockcress]
gb|AGL09490.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          187   4e-57   Hydnora visseri
gb|KJB21491.1|  hypothetical protein B456_004G200300                    187   9e-57   Gossypium raimondii
ref|XP_008786987.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    186   1e-56   Phoenix dactylifera
ref|XP_003608732.1|  hypothetical protein MTR_4g101140                  186   1e-56   Medicago truncatula
ref|XP_010494996.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    185   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008796817.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    184   2e-55   Phoenix dactylifera
ref|XP_008381184.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    182   6e-55   
ref|XP_009101407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    183   6e-55   Brassica rapa
ref|XP_010919523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    181   2e-54   
ref|XP_006662581.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    178   2e-53   Oryza brachyantha
ref|XP_006440353.1|  hypothetical protein CICLE_v10022867mg             176   2e-52   Citrus clementina [clementine]
ref|NP_001131355.1|  uncharacterized protein LOC100192676               174   7e-52   Zea mays [maize]
ref|XP_009400677.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    174   9e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065325.1|  Os10g0551600                                       172   4e-51   
gb|EEC67413.1|  hypothetical protein OsI_34583                          171   2e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_010518861.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    169   8e-50   Tarenaya hassleriana [spider flower]
ref|XP_008659958.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    169   1e-49   
ref|XP_004983722.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    167   3e-49   Setaria italica
ref|XP_003574306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    167   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_010264245.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    166   8e-49   Nelumbo nucifera [Indian lotus]
ref|NP_568684.1|  uncharacterized protein                               166   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002467527.1|  hypothetical protein SORBIDRAFT_01g029640          166   1e-48   Sorghum bicolor [broomcorn]
ref|NP_001142497.1|  uncharacterized protein LOC100274725               166   1e-48   Zea mays [maize]
dbj|BAJ85316.1|  predicted protein                                      166   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001144293.1|  uncharacterized protein LOC100277176               166   1e-48   
gb|ACJ84169.1|  unknown                                                 166   2e-48   Medicago truncatula
ref|XP_002863335.1|  hypothetical protein ARALYDRAFT_494216             164   5e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010258984.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    164   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011018295.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    162   3e-47   Populus euphratica
gb|ABD64969.1|  hypothetical protein 25.t00006                          162   4e-47   Brassica oleracea
ref|XP_006355519.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    162   1e-46   
gb|ABD64927.1|  hypothetical protein 24.t00002                          159   8e-46   Brassica oleracea
ref|XP_008659963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    157   9e-46   
ref|XP_006368197.1|  hypothetical protein POPTR_0001s00430g             158   1e-45   
gb|ABD64995.1|  hypothetical protein 26.t00015                          158   1e-45   Brassica oleracea
ref|XP_010695116.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    157   3e-45   
gb|KDP39850.1|  hypothetical protein JCGZ_03381                         154   6e-44   Jatropha curcas
ref|XP_003608733.1|  hypothetical protein MTR_4g101140                  153   1e-43   
ref|XP_008796813.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   3e-43   Phoenix dactylifera
ref|XP_008796814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   6e-43   
ref|XP_008796812.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   9e-43   
emb|CDY25957.1|  BnaC09g20300D                                          160   1e-42   Brassica napus [oilseed rape]
gb|AGL09493.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          149   1e-42   Piper nigrum
gb|AGL09494.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          149   1e-42   Thottea sp. JN-2013
gb|AGL09491.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          149   2e-42   Manekia incurva
gb|AGL09486.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          147   5e-42   Asimina triloba [pawpaw]
emb|CBI31907.3|  unnamed protein product                                154   1e-41   Vitis vinifera
gb|AGL09497.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          146   2e-41   Zippelia begoniifolia
gb|AGL09485.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          145   4e-41   Asarum caudatum
gb|AGL09488.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          145   6e-41   Chloranthus fortunei
gb|AGL09496.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          145   7e-41   Xymalos monospora
gb|ABK23873.1|  unknown                                                 145   1e-40   Picea sitchensis
gb|AGL09492.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          143   3e-40   Peperomia prostrata
ref|XP_006440354.1|  hypothetical protein CICLE_v10022867mg             142   2e-39   
gb|AGL09487.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          141   2e-39   Calycanthus occidentalis [California-allspice]
ref|XP_001753451.1|  predicted protein                                  141   2e-39   
gb|AFW87915.1|  hypothetical protein ZEAMMB73_145461                    140   1e-38   
gb|AGL09489.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          137   7e-38   Hernandia nymphaeifolia [kayu jambu hutan]
gb|EMT16400.1|  hypothetical protein F775_28617                         137   2e-37   
gb|AGL09495.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          133   2e-36   Verhuellia lunaria
gb|AFP49345.1|  hypothetical protein                                    125   3e-33   Olea europaea
gb|ADY38662.1|  hypothetical protein                                    120   2e-31   Wolffia arrhiza
gb|KJB21489.1|  hypothetical protein B456_004G200300                    118   2e-30   Gossypium raimondii
ref|XP_010934141.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    120   3e-30   
gb|KJB51917.1|  hypothetical protein B456_008G237800                    118   3e-30   Gossypium raimondii
ref|XP_002440834.1|  hypothetical protein SORBIDRAFT_09g008006          107   2e-26   
gb|KCW71992.1|  hypothetical protein EUGRSUZ_E00445                     101   8e-24   Eucalyptus grandis [rose gum]
gb|KJB21490.1|  hypothetical protein B456_004G200300                    100   2e-23   Gossypium raimondii
ref|NP_001236148.1|  uncharacterized protein LOC100306514             94.0    2e-20   
ref|XP_002504368.1|  predicted protein                                85.9    1e-17   Micromonas commoda
gb|AGU36714.1|  kinesin-related protein                               77.4    2e-15   Helianthus petiolaris
gb|AGU36715.1|  kinesin-related protein                               77.4    2e-15   Helianthus annuus
gb|AGU36716.1|  kinesin-related protein                               77.4    2e-15   Helianthus annuus
gb|AGU36718.1|  kinesin-related protein                               77.4    3e-15   Helianthus annuus
gb|AGU36724.1|  kinesin-related protein                               77.0    3e-15   Helianthus annuus
gb|AFK49234.1|  unknown                                               76.6    3e-14   Lotus japonicus
ref|XP_005649552.1|  hypothetical protein COCSUDRAFT_52742            73.6    5e-13   Coccomyxa subellipsoidea C-169
ref|XP_001420082.1|  predicted protein                                72.4    9e-13   Ostreococcus lucimarinus CCE9901
ref|XP_010229345.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  70.5    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_007510211.1|  predicted protein                                70.5    6e-12   Bathycoccus prasinos
ref|XP_003064828.1|  predicted protein                                71.6    1e-11   Micromonas pusilla CCMP1545
ref|XP_003081497.1|  unnamed protein product                          62.4    2e-09   
emb|CEF99290.1|  unnamed product                                      58.9    2e-08   Ostreococcus tauri
ref|XP_002968302.1|  hypothetical protein SELMODRAFT_409541           48.9    2e-04   



>ref|XP_010093709.1| hypothetical protein L484_019050 [Morus notabilis]
 gb|EXB54489.1| hypothetical protein L484_019050 [Morus notabilis]
Length=125

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_010264244.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Nelumbo nucifera]
Length=125

 Score =   201 bits (511),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTPFPEPCLDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+ VWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFASLGLLVVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_010662384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Vitis vinifera]
Length=125

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWM
Sbjct  23   VASSLPLRSGMGLPVGKHIVPNKPLPVNDELIWDNGTPFPEPCIDRIAETVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIPFTP+VYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKIPFTPRVYPYDNLRVELGGEP  125



>gb|EPS58672.1| hypothetical protein M569_16139, partial [Genlisea aurea]
Length=124

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
             A+SL  RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  22   TAASLRRRAGMGLPVGKHIVPDKPLPVNDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  81

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+AVWNDKAS+IP+TPKV+PYDNL+VELGGEP
Sbjct  82   CGGLGFFASLGLLAVWNDKASRIPYTPKVFPYDNLRVELGGEP  124



>ref|XP_010258983.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=125

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTPFPEPCLDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+AVWNDKAS IPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFASLGLLAVWNDKASXIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_011018294.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Populus euphratica]
Length=125

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASS+  R+GMGLPVGKHIVPDKP+PVNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+ VWNDKAS IPFTPKVYPYDNLKVELGGEP
Sbjct  83   CGGLGFFASLGLLVVWNDKASTIPFTPKVYPYDNLKVELGGEP  125



>ref|XP_011070110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Sesamum indicum]
Length=125

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            A+SL  R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGKYEALAW+C
Sbjct  24   AASLRQRSGMGLPVGKHIVPDKPLPVNDELVWDNGTAFPEPCIDRIADTVGKYEALAWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  84   GGLGFFASLGFLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_007039883.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
 gb|EOY24384.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
Length=125

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   VASSLRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTSFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+A WNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAWWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_009378949.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Pyrus x bretschneideri]
Length=125

 Score =   197 bits (501),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRVRAGMGLPVGKHIVPDKPLPVNDELIWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  FA LGL+AVWNDKASKIPF+PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFAGLGLLAVWNDKASKIPFSPKVYPYDNLRVELGGEP  125



>ref|XP_010055510.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Eucalyptus grandis]
 gb|KCW71991.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=125

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDEL+WDNGT FPEPCIDRIADTVGKYEALAW+C
Sbjct  24   ASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTAFPEPCIDRIADTVGKYEALAWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFASLGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  84   GGLGFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_007215154.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
 gb|EMJ16353.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
Length=125

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  RAGMGLPVGKHIVP++PL VNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRAGMGLPVGKHIVPNRPLHVNDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_010530067.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Tarenaya hassleriana]
Length=125

 Score =   196 bits (497),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SS+  RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT FPEPC+DRIADTVGKYEAL W+
Sbjct  23   VGSSIRLRAGMGLPVGKHIVPDKPLPVNDELVWDNGTAFPEPCVDRIADTVGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFA+LGL AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFATLGLAAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_004147198.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_004166721.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_008448866.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Cucumis melo]
 gb|KGN55877.1| hypothetical protein Csa_3G021140 [Cucumis sativus]
Length=127

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASSL  R+GMGLPVGKHIVPDKPLP NDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   IASSLRLRSGMGLPVGKHIVPDKPLPENDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLG +AVWNDKASKIPF PKVYPYDNL+VELGG+P
Sbjct  83   CGGLGFFASLGFLAVWNDKASKIPFAPKVYPYDNLRVELGGDP  125



>ref|XP_007155645.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
 gb|ESW27639.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
Length=125

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VPDKPLP+N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_008228960.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Prunus mume]
Length=125

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  RAGMGLPVGKHIVP+ PL VNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRAGMGLPVGKHIVPNSPLHVNDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|NP_001235493.1| uncharacterized protein LOC100499749 [Glycine max]
 gb|ACU13472.1| unknown [Glycine max]
 gb|KHN04354.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VPDKPLP+N+EL+WDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_006355476.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=125

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL TRAGMGLPVGKHIVPDKPL VNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_006398455.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
 gb|ESQ39908.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
Length=125

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_008343083.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
 ref|XP_008353844.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
Length=125

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTPFPEPC DRIADTVGKYEALAW+
Sbjct  23   VASSLRVRAGMGLPVGKHIVPDKPLPVNDELVWDNGTPFPEPCXDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  FA LGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFAGLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_007161348.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
 gb|ESW33342.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
Length=156

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VPDKPLP+N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  54   VASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTPFPEPCIDRIADTVGKYEALAWL  113

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  FASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  114  CGGLSCFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  156



>ref|XP_002518112.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44245.1| conserved hypothetical protein [Ricinus communis]
Length=126

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL  R+GMGLPVGKHIVPDKPLPVN+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  24   IGSSLRLRSGMGLPVGKHIVPDKPLPVNEELVWDNGTPFPEPCIDRIADTVGKYEALAWL  83

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASKIP+ PKVYPYDNL+ ELGGEP
Sbjct  84   CGGLSFFASLGLLAVWNDKASKIPYVPKVYPYDNLRAELGGEP  126



>ref|XP_004516831.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cicer arietinum]
Length=125

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VP+KPLP+N+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPNKPLPMNEELLWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASK PFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKYPFTPKVYPYDNLRVELGGEP  125



>emb|CDY17725.1| BnaA06g35440D [Brassica napus]
Length=125

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_009101408.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Brassica rapa]
Length=125

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVELGGEP  125



>emb|CDY41058.1| BnaA09g18370D [Brassica napus]
Length=125

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_009770592.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana sylvestris]
Length=125

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL TRAGMGLPVGKHIVPDKPL VNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VELGGEP
Sbjct  83   SGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVELGGEP  125



>ref|XP_004245753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Solanum lycopersicum]
Length=125

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASSL TRAGMGLPVGKHIVPDKPL VNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   LASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>gb|KHG13058.1| hypothetical protein F383_17357 [Gossypium arboreum]
Length=125

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
             ASSL  R+GMGLPVGKHIVPDKPLPVNDELMWDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   AASSLRLRSGMGLPVGKHIVPDKPLPVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
            CGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VELGGE
Sbjct  83   CGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVELGGE  124



>emb|CDP09936.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  R+GMGLPVGKHIVPDKPLPVNDEL+WDNGTPFPEPCIDRIA+TVGKYEAL+WM
Sbjct  23   VGSSLRLRSGMGLPVGKHIVPDKPLPVNDELVWDNGTPFPEPCIDRIAETVGKYEALSWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+AVWNDKASKIP+TPKVYPY NL+ ELG EP
Sbjct  83   CGGLGFFASLGLLAVWNDKASKIPYTPKVYPYGNLRAELGEEP  125



>ref|XP_009114266.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHI PDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIAPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVELGGEP  125



>emb|CDX77778.1| BnaC07g20320D [Brassica napus]
Length=125

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PF P+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFAPRVYPYDNLRVELGGEP  125



>gb|KHG01041.1| hypothetical protein F383_21717 [Gossypium arboreum]
Length=125

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASS   R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   VASSFRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTAFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLG +A WNDKASKIPF PKVYPYD+L+VELGGEP
Sbjct  83   CGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDSLRVELGGEP  125



>ref|XP_009602608.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana tomentosiformis]
Length=125

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL TRAGMGLPVGKHIVPDKPL VNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VVSSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VELGGEP
Sbjct  83   SGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVELGGEP  125



>gb|KHN09808.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VPDKPLP+N+EL+WDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLGL+AVWNDKASK PF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGLLAVWNDKASKTPFAPKVYPYDNLRVELGGEP  125



>gb|EYU32869.1| hypothetical protein MIMGU_mgv1a016342mg [Erythranthe guttata]
Length=125

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VA+SL  R+GMGLPVGKH+VPDKPLPVNDEL+WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VATSLRQRSGMGLPVGKHLVPDKPLPVNDELVWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  FA LGL+AVWNDKAS IPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFAGLGLLAVWNDKASTIPFAPKVYPYDNLRVELGGEP  125



>gb|KJB21488.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=125

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASS   R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   IASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTAFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_006281322.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
 gb|EOA14220.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
Length=125

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  RAGMGLPVGKHIVP+KPL VNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  83   SGGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>gb|ABK94153.1| unknown [Populus trichocarpa]
Length=125

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL   +GMGLPVGKHIVPDKP+ VNDEL WDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLSSGMGLPVGKHIVPDKPISVNDELTWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+ VWNDKAS IPF PKVYPYDNLKVELGGEP
Sbjct  83   CGGLGFFASLGLLVVWNDKASTIPFAPKVYPYDNLKVELGGEP  125



>ref|XP_010919522.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Elaeis guineensis]
Length=125

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL TR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPC+DR+A T+GKYEAL W+
Sbjct  23   LVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCVDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFA+LGL+AVWNDKASKIP+TPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFATLGLLAVWNDKASKIPYTPKVYPYDNLRVELGGEP  125



>gb|KJB51916.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=125

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
             ASSL  R+GMGLPVGKHIVPDKPL VNDEL+WDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   AASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTAFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>emb|CDY28920.1| BnaA02g25560D [Brassica napus]
Length=125

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGL FFA LG++AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLSFFAGLGMLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>emb|CDY40556.1| BnaC02g33360D [Brassica napus]
Length=125

 Score =   190 bits (483),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGL FFA+LG++AV NDKASK+PF+P+VYPYDNL+VELGGEP
Sbjct  84   GGLSFFAALGMLAVLNDKASKVPFSPRVYPYDNLRVELGGEP  125



>ref|XP_006830041.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
 gb|ERM97457.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
Length=124

 Score =   190 bits (483),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -1

Query  595  SSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCG  416
            SSL  R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT +PEPC+D++A TVG+YEALAW+CG
Sbjct  24   SSLRHRSGMGLPVGKHIVPDKPLPVNDELIWDNGTAYPEPCLDKLATTVGEYEALAWLCG  83

Query  415  GLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  84   GLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGEP  124



>ref|XP_011466981.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Fragaria vesca subsp. vesca]
Length=125

 Score =   190 bits (482),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  RAGMGLPVGKHIVPD+PLPVNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRAGMGLPVGKHIVPDRPLPVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGL  F  LGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  83   TGGLSCFVGLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEP  125



>ref|XP_009128982.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   190 bits (482),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GGL FF +LG++AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  84   GGLSFFGALGMLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_010441437.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
 ref|XP_010481304.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
Length=125

 Score =   189 bits (480),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  R+GMGLPVGKHIVP+KPL VNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFFA+LGL+AV+NDKAS +PFTP+VYPYDNL+VELGGEP
Sbjct  83   SGGLGFFAALGLLAVFNDKASTVPFTPRVYPYDNLRVELGGEP  125



>gb|KFK31361.1| hypothetical protein AALP_AA6G102500 [Arabis alpina]
Length=125

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  RAGMGLPVGKHIVP+KPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+
Sbjct  23   VGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFA+LGL+AV+NDKAS +P+TP+VYPYDNL+VELGGEP
Sbjct  83   CGGLGFFAALGLLAVFNDKASTVPWTPRVYPYDNLRVELGGEP  125



>gb|AGL09490.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hydnora 
visseri]
Length=125

 Score =   187 bits (476),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V+ SL  R+GMGLPVG HIVP+ PLPVNDEL+WDNGTPFPEPC+DRIA T+GKYE LAW+
Sbjct  23   VSLSLRHRSGMGLPVGSHIVPNNPLPVNDELVWDNGTPFPEPCVDRIAPTIGKYEGLAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFASLGL+AVWNDKASK+PFTPK+YPYDNL+VELGGEP
Sbjct  83   CGGLGFFASLGLLAVWNDKASKLPFTPKIYPYDNLRVELGGEP  125



>gb|KJB21491.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=126

 Score =   187 bits (474),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASS   R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGKYEALAWM
Sbjct  23   IASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTAFPEPCIDRIADTVGKYEALAWM  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPF-TPKVYPYDNLKVELGGEP  293
            CGGL FFASLG +A WNDKASKIPF  PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFASLGFLAWWNDKASKIPFQAPKVYPYDNLRVELGGEP  126



>ref|XP_008786987.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Phoenix dactylifera]
Length=125

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASSL TR+GMGLPVGKHIVPDKPLP +DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+
Sbjct  23   LASSLRTRSGMGLPVGKHIVPDKPLPTHDELVWDNGTPYPEPCIDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL FFA +GL+ VWNDKASKIP+TPKVYPYDNL+VELGGEP
Sbjct  83   CGGLSFFAVIGLLTVWNDKASKIPYTPKVYPYDNLRVELGGEP  125



>ref|XP_003608732.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90929.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
 gb|AFK36027.1| unknown [Medicago truncatula]
Length=125

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VP+KPLP+N+EL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGL  FA LGL+AVWNDKASK PF PKVYPYDNL+VELGGEP
Sbjct  83   CGGLSCFAGLGLLAVWNDKASKTPFAPKVYPYDNLRVELGGEP  125



>ref|XP_010494996.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Camelina sativa]
Length=125

 Score =   185 bits (470),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  R+GMGLPVGKHIVP+KPL VNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFFA+LGL+AV NDKAS +PFT +VYPYDNL+VELGGEP
Sbjct  83   SGGLGFFAALGLLAVVNDKASTVPFTRRVYPYDNLRVELGGEP  125



>ref|XP_008796817.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X4 [Phoenix dactylifera]
Length=125

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL  R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+
Sbjct  23   LGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCIDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLG FA++GL+AVWNDKASK+P+TPKVYPYDNL+VELG EP
Sbjct  83   CGGLGIFATIGLLAVWNDKASKVPYTPKVYPYDNLRVELGEEP  125



>ref|XP_008381184.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Malus domestica]
Length=125

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
             SSL  R GMGLPVGKHIVPD+PLPVNDEL WD+GT FPEPCIDRI DTVGKYEALAW+C
Sbjct  24   TSSLXLRXGMGLPVGKHIVPDRPLPVNDELXWDDGTSFPEPCIDRITDTVGKYEALAWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            G L  FA LGL+AVWNDKASKIPF PKVYPYDNL+VELGGEP
Sbjct  84   GSLSCFAXLGLLAVWNDKASKIPFAPKVYPYDNLQVELGGEP  125



>ref|XP_009101407.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Brassica rapa]
Length=143

 Score =   183 bits (464),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 96/120 (80%), Gaps = 18/120 (15%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPF------------------TPKVYPYDNLKVELGGEP  293
            GGLGFFA+LGL+AV NDKASK+PF                  TP+VYPYDNL+VELGGEP
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFGYLFSPFHGLSLIVLFLQTPRVYPYDNLRVELGGEP  143



>ref|XP_010919523.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Elaeis guineensis]
Length=122

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 96/103 (93%), Gaps = 3/103 (3%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL TR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPC+DR+A T+GKYEAL W+
Sbjct  23   LVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCVDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFA+LGL+AVWNDKASK   TPKVYPYDNL+VELGGEP
Sbjct  83   CGGLGFFATLGLLAVWNDKASK---TPKVYPYDNLRVELGGEP  122



>ref|XP_006662581.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Oryza brachyantha]
Length=104

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
             AS+L  RAGMGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+
Sbjct  2    AASALRHRAGMGLPVGRHIVPDKPLPTNDELLWDNGTPFPEPCIDRLAPHIGKYEALAWL  61

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            CGGLGFFA+LGL A  NDKASKIP+TPKVYPYDNL+ ELG  P
Sbjct  62   CGGLGFFATLGLAAALNDKASKIPYTPKVYPYDNLREELGDRP  104



>ref|XP_006440353.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 ref|XP_006477235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Citrus sinensis]
 gb|ESR53593.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61490.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=125

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPL VNDEL+WDNGTPFPEPCIDRIADTVGKYEAL W+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTPFPEPCIDRIADTVGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VELGGEP
Sbjct  83   LGGLGFFASLGALAVWNDKASKIPFTPKVYPYDNLRVELGGEP  125



>ref|NP_001131355.1| uncharacterized protein LOC100192676 [Zea mays]
 gb|ACG35760.1| hypothetical protein [Zea mays]
Length=123

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  589  LSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGL  410
            L  RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGL
Sbjct  25   LRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGL  84

Query  409  GFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GFFA+LG+ AV NDKAS IP+TPKVYPYDNL+ ELG  P
Sbjct  85   GFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAELGDRP  123



>ref|XP_009400677.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Musa acuminata subsp. malaccensis]
Length=125

 Score =   174 bits (441),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMG P+GKHIVPDKPLP + +L+WDNGTPFPEPCIDRIA TVGKYEALAW+CGGL FFAS
Sbjct  32   GMGFPLGKHIVPDKPLPADHDLLWDNGTPFPEPCIDRIAPTVGKYEALAWLCGGLSFFAS  91

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            LGL+AVWNDKASKIP+ PKVYPYDNL+VELGGEP
Sbjct  92   LGLLAVWNDKASKIPYAPKVYPYDNLRVELGGEP  125



>ref|NP_001065325.1| Os10g0551600 [Oryza sativa Japonica Group]
 gb|AAG13469.1|AC026758_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54938.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27162.1| Os10g0551600 [Oryza sativa Japonica Group]
 dbj|BAG88471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51371.1| hypothetical protein OsJ_32392 [Oryza sativa Japonica Group]
Length=125

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -1

Query  589  LSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGL  410
            L  RAGMGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGL
Sbjct  27   LRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGL  86

Query  409  GFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GFFA+LGL A  NDKASKIP+TPKVYP+DNL+ ELG  P
Sbjct  87   GFFATLGLAATLNDKASKIPYTPKVYPFDNLREELGDRP  125



>gb|EEC67413.1| hypothetical protein OsI_34583 [Oryza sativa Indica Group]
Length=125

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -1

Query  589  LSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGL  410
            L  RAGMGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGL
Sbjct  27   LRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGL  86

Query  409  GFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            GFFA+LGL A  N+KASKIP+TPKVYP+DNL+ ELG  P
Sbjct  87   GFFATLGLAATLNNKASKIPYTPKVYPFDNLREELGDRP  125



>ref|XP_010518861.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Tarenaya hassleriana]
Length=137

 Score =   169 bits (429),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT FPEPC+DRIADTVGKYEAL W+
Sbjct  23   VGSSLRQRAGMGLPVGKHIVPDKPLPVNDELVWDNGTAFPEPCVDRIADTVGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVY  332
            CGGLGFF +LGL AVWNDKASKIPFTPKV+
Sbjct  83   CGGLGFFVTLGLAAVWNDKASKIPFTPKVF  112



>ref|XP_008659958.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Zea mays]
 gb|ACF79732.1| unknown [Zea mays]
Length=123

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+
Sbjct  30   GMGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAA  89

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            LG+ AV NDKAS IP+TPKVYPYDNL+ ELG  P
Sbjct  90   LGMAAVVNDKASNIPYTPKVYPYDNLRAELGDRP  123



>ref|XP_004983722.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Setaria italica]
Length=123

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  392
            MGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+L
Sbjct  31   MGLPVGRHIVPDKPLPTNDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFATL  90

Query  391  GLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            G+ A  NDKASKIP+TPKVYPYDNL+VELG  P
Sbjct  91   GVAAAVNDKASKIPYTPKVYPYDNLRVELGDRP  123



>ref|XP_003574306.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Brachypodium distachyon]
Length=125

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLP G+HIVPDKPLP NDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+
Sbjct  32   GMGLPAGRHIVPDKPLPTNDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAA  91

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELG  302
            LGL AV NDKASKIPFTPK+YPYDNL+VELG
Sbjct  92   LGLAAVANDKASKIPFTPKIYPYDNLRVELG  122



>ref|XP_010264245.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Nelumbo nucifera]
Length=115

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTPFPEPCLDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKV  335
            CGGLGFFASLGL+ VWNDKASKIPF   +
Sbjct  83   CGGLGFFASLGLLVVWNDKASKIPFVVTI  111



>ref|NP_568684.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FGK0.1|NDUB8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL58924.1|AF462836_1 AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 dbj|BAB09083.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM19870.1| AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 gb|AAM61542.1| unknown [Arabidopsis thaliana]
 gb|AED95533.1| uncharacterized protein AT5G47570 [Arabidopsis thaliana]
Length=125

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFF  LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  83   SGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_002467527.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
 gb|EER94525.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
Length=124

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLPVG+HIVPDKP+PVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA 
Sbjct  30   GMGLPVGRHIVPDKPVPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAV  89

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            LG+ A  NDKASKIP+TPKVYPYDNL+ ELG  P
Sbjct  90   LGVAAAVNDKASKIPYTPKVYPYDNLRAELGDRP  123



>ref|NP_001142497.1| uncharacterized protein LOC100274725 [Zea mays]
 gb|ACG24387.1| hypothetical protein [Zea mays]
 gb|ACG30533.1| hypothetical protein [Zea mays]
 gb|ACG44917.1| hypothetical protein [Zea mays]
 gb|ACG47173.1| hypothetical protein [Zea mays]
 tpg|DAA46215.1| TPA: hypothetical protein ZEAMMB73_636535 [Zea mays]
Length=125

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  392
            MGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+L
Sbjct  33   MGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAAL  92

Query  391  GLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            G+ AV NDKASKIP+TPKVYPYD+L+ ELG  P
Sbjct  93   GVAAVVNDKASKIPYTPKVYPYDSLRAELGDRP  125



>dbj|BAJ85316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=125

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLP G+HIVPDKPLPVNDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+
Sbjct  32   GMGLPAGRHIVPDKPLPVNDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAA  91

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELG  302
            LGL AV NDKASK+P+TPKVYPYDNL+VELG
Sbjct  92   LGLAAVVNDKASKMPYTPKVYPYDNLRVELG  122



>ref|NP_001144293.1| uncharacterized protein LOC100277176 [Zea mays]
 gb|ACG39358.1| hypothetical protein [Zea mays]
Length=123

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  392
            MGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+L
Sbjct  31   MGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAAL  90

Query  391  GLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            G+ AV N+KASKIP+TPKVYPYDNL+ ELG  P
Sbjct  91   GVAAVVNNKASKIPYTPKVYPYDNLRAELGDRP  123



>gb|ACJ84169.1| unknown [Medicago truncatula]
Length=125

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  562  PVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLM  383
            PVGKH VP+KPLP+N+EL WDNGTPFPEPCIDRIADTVGKYEA AW+CGGL  FA LGL+
Sbjct  36   PVGKHYVPNKPLPMNEELTWDNGTPFPEPCIDRIADTVGKYEASAWLCGGLSCFAGLGLL  95

Query  382  AVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            AVWNDKASK PF PKVYPYDNL+VELGGEP
Sbjct  96   AVWNDKASKTPFAPKVYPYDNLRVELGGEP  125



>ref|XP_002863335.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39594.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
Length=125

 Score =   164 bits (416),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V SSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
             GGLGFFA LGL+AV NDKASK+PFTP+VYPYDNL+VELGGEP
Sbjct  83   SGGLGFFAGLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP  125



>ref|XP_010258984.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=113

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPC+DRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTPFPEPCLDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPF  347
            CGGLGFFASLGL+AVWNDKAS IPF
Sbjct  83   CGGLGFFASLGLLAVWNDKASXIPF  107



>ref|XP_011018295.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Populus euphratica]
Length=118

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASS+  R+GMGLPVGKHIVPDKP+PVNDELMWDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPF  347
            CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  83   CGGLGFFASLGLLVVWNDKASTIPF  107



>gb|ABD64969.1| hypothetical protein 25.t00006 [Brassica oleracea]
Length=134

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKV  335
            GGLGFFA+LGL+AV NDKASK+PF  ++
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFVSEI  111



>ref|XP_006355519.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=142

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL TRAGMGLPVGKHIVPDKPL VNDEL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTP  341
            CGGL  F  +GL+AVWNDKASKIPF P
Sbjct  83   CGGLSCFVGIGLLAVWNDKASKIPFFP  109



>gb|ABD64927.1| hypothetical protein 24.t00002 [Brassica oleracea]
Length=126

 Score =   159 bits (401),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDK L VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKRLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVY  332
            GGLGFFA+LGL+AV NDKASK+PF   +Y
Sbjct  84   GGLGFFATLGLLAVVNDKASKVPFVSDLY  112



>ref|XP_008659963.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Zea mays]
Length=89

 Score =   157 bits (398),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  559  VGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  380
            VG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A
Sbjct  1    VGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAA  60

Query  379  VWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            V NDKAS IP+TPKVYPYDNL+ ELG  P
Sbjct  61   VVNDKASNIPYTPKVYPYDNLRAELGDRP  89



>ref|XP_006368197.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
 gb|ERP64766.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
Length=118

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVPDKP+ VNDEL WDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPDKPISVNDELTWDNGTAFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPF  347
            CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  83   CGGLGFFASLGLLVVWNDKASTIPF  107



>gb|ABD64995.1| hypothetical protein 26.t00015 [Brassica oleracea]
Length=125

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  RAGMGLPVGKHIVPDKPL VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  24   ASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  83

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPK  338
            GGL FFA+LG++AV NDKASK+PF  +
Sbjct  84   GGLSFFAALGMLAVLNDKASKVPFVSE  110



>ref|XP_010695116.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=128

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            V +SL  RAGMGLPVGKHIVPDK L VNDEL WDNGT FPEPCIDRIADTVGKYEALAW+
Sbjct  23   VGNSLRQRAGMGLPVGKHIVPDKSLSVNDELTWDNGTSFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNL  317
            CGGLGFFA+LGL AVWNDKASK PF   +    + 
Sbjct  83   CGGLGFFATLGLAAVWNDKASKYPFVSFILQLSDF  117



>gb|KDP39850.1| hypothetical protein JCGZ_03381 [Jatropha curcas]
Length=117

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLPVGKHIVPDKPLPVN+EL+WDNGTPFPEPCIDRIADTVGKYEALAW+CGGLGFFAS
Sbjct  32   GMGLPVGKHIVPDKPLPVNEELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLGFFAS  91

Query  394  LGLMAVWNDKASKIPFT  344
            LGL+ VWNDKASKIP+ 
Sbjct  92   LGLLVVWNDKASKIPYN  108



>ref|XP_003608733.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90930.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
Length=117

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKH VP+KPLP+N+EL WDNGTPFPEPCIDRIADTVGKYEALAW+
Sbjct  23   VASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTPFPEPCIDRIADTVGKYEALAWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFT  344
            CGGL  FA LGL+AVWNDKASK PF 
Sbjct  83   CGGLSCFAGLGLLAVWNDKASKTPFV  108



>ref|XP_008796813.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Phoenix dactylifera]
Length=132

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL  R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+
Sbjct  23   LGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCIDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFT  344
            CGGLG FA++GL+AVWNDKASK+P+ 
Sbjct  83   CGGLGIFATIGLLAVWNDKASKVPYV  108



>ref|XP_008796814.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X3 [Phoenix dactylifera]
Length=128

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL  R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+
Sbjct  23   LGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCIDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPF  347
            CGGLG FA++GL+AVWNDKASK+P+
Sbjct  83   CGGLGIFATIGLLAVWNDKASKVPY  107



>ref|XP_008796812.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=156

 Score =   152 bits (384),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            + SSL  R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP+PEPCIDR+A T+GKYEAL W+
Sbjct  23   LGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTPYPEPCIDRLAPTIGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKV  335
            CGGLG FA++GL+AVWNDKASK+P+  ++
Sbjct  83   CGGLGIFATIGLLAVWNDKASKVPYFRRM  111



>emb|CDY25957.1| BnaC09g20300D [Brassica napus]
Length=553

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            A+SL  RAGMGLPVGKHIVPDK L VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+C
Sbjct  451  AASLRQRAGMGLPVGKHIVPDKRLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLC  510

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVY  332
            GGLGFFA+LGL+AV NDKASK+PF   +Y
Sbjct  511  GGLGFFATLGLLAVVNDKASKVPFVSDLY  539



>gb|AGL09493.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Piper 
nigrum]
Length=77

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPVN+EL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGLGFFASLGL+AVW
Sbjct  1    KHIVXDKPLPVNEELVWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLGFFASLGLLAVW  60

Query  373  NDKASKIPFTPKVYPYD  323
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09494.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Thottea 
sp. JN-2013]
Length=77

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDR+A T+GKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALAWLCGGLSFFASLGLLAVW  60

Query  373  NDKASKIPFTPKVYPYD  323
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09491.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Manekia 
incurva]
Length=77

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPVNDEL+WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGLMAVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLMAVW  60

Query  373  NDKASKIPFTPKVYPYD  323
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09486.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asimina 
triloba]
Length=78

 Score =   147 bits (372),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKP+PVNDEL+WDNGTPFPEPCIDR+A T+GKYEAL W+CGGLGFFA+LGL+AVW
Sbjct  1    KHIVXDKPVPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALGWLCGGLGFFATLGLLAVW  60

Query  373  NDKASKIPFTPKVYPYDN  320
            NDKASKIPFTPKVYPYD 
Sbjct  61   NDKASKIPFTPKVYPYDK  78



>emb|CBI31907.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  392
            MGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWMCGGL FFASL
Sbjct  1    MGLPVGKHIVPNKPLPVNDELIWDNGTPFPEPCIDRIAETVGKYEALAWMCGGLSFFASL  60

Query  391  GLMAVWNDKASKIPF  347
            GL+AVWNDKASKIPF
Sbjct  61   GLLAVWNDKASKIPF  75



>gb|AGL09497.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Zippelia 
begoniifolia]
Length=77

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPV+DEL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVHDELIWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVW  60

Query  373  NDKASKIPFTPKVYPYD  323
            NDKASK+PFTPKVYPYD
Sbjct  61   NDKASKVPFTPKVYPYD  77



>gb|AGL09485.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asarum 
caudatum]
Length=77

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  550  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  371
            HIV DKPLPVNDEL WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGL+AVWN
Sbjct  2    HIVLDKPLPVNDELTWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLLAVWN  61

Query  370  DKASKIPFTPKVYPYD  323
            DKASKIPFTPKVYPYD
Sbjct  62   DKASKIPFTPKVYPYD  77



>gb|AGL09488.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Chloranthus 
fortunei]
Length=78

 Score =   145 bits (365),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  550  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  371
            HIV DKPLPVNDEL+WDNGTPFPEPCIDRIA  +GKYEAL W+CGGL FFASLGL+AVWN
Sbjct  2    HIVXDKPLPVNDELIWDNGTPFPEPCIDRIAPHIGKYEALGWLCGGLSFFASLGLLAVWN  61

Query  370  DKASKIPFTPKVYPYDN  320
            DKASKIPFTPKVYPYD 
Sbjct  62   DKASKIPFTPKVYPYDK  78



>gb|AGL09496.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Xymalos 
monospora]
Length=78

 Score =   145 bits (365),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDRIA ++GKYEALAW  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCIDRIAPSIGKYEALAWWLGGLGFFASIGLLAVW  60

Query  373  NDKASKIPFTPKVYPYDN  320
            NDKASK+PFTPKVYPYD 
Sbjct  61   NDKASKVPFTPKVYPYDK  78



>gb|ABK23873.1| unknown [Picea sitchensis]
 gb|ABR17760.1| unknown [Picea sitchensis]
 gb|ACN39914.1| unknown [Picea sitchensis]
Length=130

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGKYEALAW  425
             + SL  R+GMG+PVG    PDKPL +  EL+WD+G+ +PEP +DRIA   +GKYEALAW
Sbjct  18   ASGSLRLRSGMGMPVGTTPPPDKPLHIQHELIWDDGSAYPEPALDRIAAPQIGKYEALAW  77

Query  424  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
            +CGGL FF  +GL+AVWNDKASKIP+TPK YP+DNL+VELGG+P
Sbjct  78   LCGGLSFFGLVGLLAVWNDKASKIPYTPKEYPFDNLRVELGGDP  121



>gb|AGL09492.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Peperomia 
prostrata]
Length=78

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPV+DEL WDNGTP+PEPCIDRIA  +GKYEALAW+CGGLGFF SLGL++VW
Sbjct  1    KHIVXDKPLPVDDELTWDNGTPYPEPCIDRIAPNIGKYEALAWLCGGLGFFTSLGLLSVW  60

Query  373  NDKASKIPFTPKVYPYDN  320
            NDKAS IPFTPKVYPYD 
Sbjct  61   NDKASSIPFTPKVYPYDK  78



>ref|XP_006440354.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|ESR53594.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61491.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=112

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            VASSL  R+GMGLPVGKHIVP+KPL VNDEL+WDNGTPFPEPCIDRIADTVGKYEAL W+
Sbjct  23   VASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTPFPEPCIDRIADTVGKYEALGWL  82

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPK  338
             GGLGFFASLG +AVWNDKASKIPF  +
Sbjct  83   LGGLGFFASLGALAVWNDKASKIPFVSR  110



>gb|AGL09487.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Calycanthus 
occidentalis]
Length=78

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KH V DKP+PVNDEL+WDNGTP+PEPC+DR+A ++GKYEALAW+CGGLGFFA+LGL AVW
Sbjct  1    KHJVXDKPVPVNDELVWDNGTPYPEPCLDRLAPSIGKYEALAWLCGGLGFFAALGLAAVW  60

Query  373  NDKASKIPFTPKVYPYDN  320
            NDKASK+PFTPKVY YD 
Sbjct  61   NDKASKVPFTPKVYXYDK  78



>ref|XP_001753451.1| predicted protein [Physcomitrella patens]
 gb|EDQ81674.1| predicted protein [Physcomitrella patens]
Length=102

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +AS++  RAG GLPVG   VP  PLP N EL+WD+G+PFPEPC+D +A  VGKYEALAW+
Sbjct  1    MASAMRLRAGAGLPVGSMEVPAHPLPENAELIWDDGSPFPEPCLDNVAPMVGKYEALAWL  60

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
             GG+G FA +G +A WNDKAS+IP+ P+ YPYD+LKVELG E
Sbjct  61   LGGMGLFAGIGGLAAWNDKASRIPWAPREYPYDDLKVELGKE  102



>gb|AFW87915.1| hypothetical protein ZEAMMB73_145461 [Zea mays]
Length=117

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+
Sbjct  30   GMGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAA  89

Query  394  LGLMAVWNDKASKIPF  347
            LG+ AV NDKAS IP+
Sbjct  90   LGMAAVVNDKASNIPY  105



>gb|AGL09489.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hernandia 
nymphaeifolia]
Length=78

 Score =   137 bits (345),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLPVNDEL+WDNGTPFPEPC+DRIA T+GKYE L W  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCLDRIAPTMGKYETLVWWFGGLGFFASIGLLAVW  60

Query  373  NDKASKIPFTPKVYPYDN  320
            NDKASKIP+TPKV PYD 
Sbjct  61   NDKASKIPYTPKVXPYDK  78



>gb|EMT16400.1| hypothetical protein F775_28617 [Aegilops tauschii]
Length=115

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLP G+HIVPDKPLPVNDEL+WDNGTPFPEPC+DR+A  +GKYEALAW+CGGL FFA+
Sbjct  32   GMGLPAGRHIVPDKPLPVNDELVWDNGTPFPEPCVDRLAPHIGKYEALAWLCGGLSFFAA  91

Query  394  LGLMAVWNDKASKIPFT  344
            LGL AV NDKASK+P+ 
Sbjct  92   LGLAAVVNDKASKMPYA  108



>gb|AGL09495.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Verhuellia 
lunaria]
Length=77

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -1

Query  553  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  374
            KHIV DKPLP + +L+WDNG+ F EPCIDRIA TVGKYEAL W+CGGL FFA LGL+AVW
Sbjct  1    KHIVLDKPLPADFDLIWDNGSAFQEPCIDRIAPTVGKYEALGWLCGGLSFFAGLGLLAVW  60

Query  373  NDKASKIPFTPKVYPYD  323
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AFP49345.1| hypothetical protein, partial [Olea europaea]
Length=64

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = -1

Query  475  CIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
            CIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGE
Sbjct  4    CIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGE  63

Query  295  P  293
            P
Sbjct  64   P  64



>gb|ADY38662.1| hypothetical protein [Wolffia arrhiza]
Length=91

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  574  GMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFAS  395
            GMGLPVG+HIVPD+ LP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFAS
Sbjct  26   GMGLPVGRHIVPDRTLPENDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAS  85

Query  394  LGLMA  380
            LGL+A
Sbjct  86   LGLLA  90



>gb|KJB21489.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=93

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 66/103 (64%), Gaps = 32/103 (31%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  422
            +ASS   R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGK       
Sbjct  23   IASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTAFPEPCIDRIADTVGK-------  75

Query  421  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
                                      PKVYPYDNL+VELGGEP
Sbjct  76   -------------------------APKVYPYDNLRVELGGEP  93



>ref|XP_010934141.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 beta subcomplex subunit 8, mitochondrial [Elaeis guineensis]
Length=160

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = -1

Query  601  VASSLSTRAGM--GLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALA  428
            +ASSL  R+GM  GLPVGK IVPDKPLPV+DEL+ DNGTP PEPC DR+A T+GKYEAL 
Sbjct  23   LASSLRNRSGMPRGLPVGKXIVPDKPLPVHDELVXDNGTPCPEPCXDRLAATIGKYEALG  82

Query  427  WMCGGLGFFASLGLMAVWNDKASKIPFTPKV  335
            W+ GGLGFFA+LGL+AVWNDKASK+P+   V
Sbjct  83   WLGGGLGFFATLGLLAVWNDKASKVPYFRNV  113



>gb|KJB51917.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=93

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 65/102 (64%), Gaps = 32/102 (31%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            ASSL  R+GMGLPVGKHIVPDKPL VNDEL+WDNGT FPEPCIDRIADTVGK        
Sbjct  24   ASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTAFPEPCIDRIADTVGK--------  75

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  293
                                     PKVYPYDNL+VELGGEP
Sbjct  76   ------------------------APKVYPYDNLRVELGGEP  93



>ref|XP_002440834.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
 gb|EES19264.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
Length=61

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  529  LPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIP  350
            LPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+C GLGFFA+LG+ A  NDKASKIP
Sbjct  1    LPVNDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCRGLGFFAALGVAAAVNDKASKIP  60

Query  349  F  347
            +
Sbjct  61   Y  61



>gb|KCW71992.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=91

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  598  ASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGK  443
            ASSL  RAGMGLPVGKHIVPDKPL VNDEL+WDNGT FPEPCIDRIADTVGK
Sbjct  24   ASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTAFPEPCIDRIADTVGK  75



>gb|KJB21490.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=100

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGK  443
            +ASS   R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT FPEPCIDRIADTVGK
Sbjct  23   IASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTAFPEPCIDRIADTVGK  75



>ref|NP_001236148.1| uncharacterized protein LOC100306514 [Glycine max]
 gb|ACU14719.1| unknown [Glycine max]
Length=166

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +1

Query  283  QIPTALLQAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQ  462
             +P    QAPL+ CHM I  V    W+LCHS QP++   +K  I HT++PMLHTF++ +Q
Sbjct  31   DLPMVHHQAPLADCHMDILWVQTVSWRLCHSTQPTIPATRKNSIPHTARPMLHTFRQCQQ  90

Query  463  YDQYRVPGTESHCPT*VHHSPGEVYREQYVCRRGGPCR  576
            YD Y V   +  CPT V HS   V RE  VCRRGGPCR
Sbjct  91   YDLYTVREMQCRCPTGVPHSWEGVCREHSVCRRGGPCR  128



>ref|XP_002504368.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65626.1| predicted protein [Micromonas sp. RCC299]
Length=132

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -1

Query  592  SLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGK-YEALAWMCG  416
            + ++RAGMG PV  H VP   LP   EL WD G  +PEP +D +   + K  EA A++ G
Sbjct  34   TAASRAGMGTPVPAHEVPTAELPEESELTWDCGDAYPEPALDVVPPHIVKPAEAAAYLFG  93

Query  415  GLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  302
            GLG F S+  +A   DK S  PF  K +P+DNLK ELG
Sbjct  94   GLGVFYSIYSLAKVVDKPSTQPFADKQFPFDNLKTELG  131



>gb|AGU36714.1| kinesin-related protein, partial [Helianthus petiolaris]
 gb|AGU36719.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36720.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36722.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36723.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36725.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36726.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36730.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36732.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36733.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36735.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36736.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36737.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36738.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  469  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  347
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36715.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36717.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36721.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36727.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36728.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36729.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36731.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36734.1| kinesin-related protein, partial [Helianthus annuus]
Length=41

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  469  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  347
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36716.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  469  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  347
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36718.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  469  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  347
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36724.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  469  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  347
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AFK49234.1| unknown [Lotus japonicus]
Length=125

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  304  QAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQYDQYRVP  483
            ++ L  CHM    V M  W+L HS  P++ E Q   I H ++PMLHTFQ+Y+Q D YRV 
Sbjct  5    KSSLPDCHMDTLWVQMESWRLYHSTLPTIPETQNNSIPHRARPMLHTFQQYQQCDLYRVR  64

Query  484  GTESHCPT*VHHSPGEVYREQYVCRRGGPCR  576
              + H PT VHHS   V + + VCRRG  CR
Sbjct  65   VMKYHYPTQVHHSQEGVCQGRCVCRRGDRCR  95



>ref|XP_005649552.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25008.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
Length=144

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  589  LSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGL  410
            L  R   G PV      D+ LP +DEL+WD+G+  PE C+D+    V KYEAL ++ GGL
Sbjct  22   LPVRGEGGGPVKMGRAIDQALPEHDELLWDDGSAQPEHCLDQFP-LVPKYEALGFLLGGL  80

Query  409  GFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGG  299
            GF+  LG +A +NDKASK P+  K YPYDNLK E+GG
Sbjct  81   GFYFLLGQLARFNDKASKKPYVDKEYPYDNLKAEMGG  117



>ref|XP_001420082.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98375.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=125

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 52/101 (51%), Gaps = 1/101 (1%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI-ADTVGKYEALAW  425
            VA+S   RAG+G  +     P + +P   EL WD G   PEP +D + A  V K  A  +
Sbjct  23   VATSARARAGVGPAIEPTRAPVREIPEEAELTWDAGDAHPEPALDDVPARIVTKARAATY  82

Query  424  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  302
            +     F   +  +A   DK S  PF PK +PY+ L+VELG
Sbjct  83   LASAFAFLGGVYGLATMVDKPSTTPFAPKTFPYNGLEVELG  123



>ref|XP_010229345.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brachypodium distachyon]
Length=108

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 53/117 (45%), Gaps = 37/117 (32%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  392
            MGLP G  + P++P+ VN+EL+WDNGTPFP           G             FFA+L
Sbjct  1    MGLPAGNEVAPERPIRVNEELVWDNGTPFP-----------GDLRRPPRAPTSARFFAAL  49

Query  391  GLMAVWNDKASKIP--------------------------FTPKVYPYDNLKVELGG  299
            GL AV + K   +P                            PKVYPYDNL VELGG
Sbjct  50   GLAAVVSAKMPHVPDLGEVRRASEPLSLTILLSSTLAWQCLAPKVYPYDNLTVELGG  106



>ref|XP_007510211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18556.1| predicted protein [Bathycoccus prasinos]
Length=145

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 54/103 (52%), Gaps = 2/103 (2%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI-ADTVGKYEALAW  425
            +A++    AGMG P G    P +PL    EL+WD G   PE  +D + A  VGKYEAL  
Sbjct  44   IATTTKINAGMGSPTGTAPAPTEPLEEEHELIWDAGDKHPETALDNLPAKIVGKYEALGM  103

Query  424  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
            + G L F   +   A + DKA+  PF  +     +LK ELGG 
Sbjct  104  LVGALCFMGGVYTFAGYYDKAASRPFVERDME-KSLKKELGGR  145



>ref|XP_003064828.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51162.1| predicted protein [Micromonas pusilla CCMP1545]
Length=303

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  529  LPVNDELMWDNGTPFPEPCIDRIADTV-GKYEALAWMCGGLGFFASLGLMAVWNDKASKI  353
            +P   EL WD G   PE  +D++ + V  K  A A +  GLGFF  L   A + DKAS +
Sbjct  217  IPEEAELTWDIGDGNPESALDKVPENVLSKRGAAALLATGLGFFVGLYHFAGYLDKASTV  276

Query  352  PFTPKVYPYDNLKVELGGE  296
            PF P+ YPY+NLK ELGG 
Sbjct  277  PFAPRTYPYNNLKEELGGH  295



>ref|XP_003081497.1| unnamed protein product [Ostreococcus tauri]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 1/103 (1%)
 Frame = -1

Query  601  VASSLSTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGKYEALAW  425
            V ++ +   GMG  +     P + +P   EL WD G    EP +D + +  V K  A  +
Sbjct  21   VRTTSARMGGMGPAIEPTEAPTREMPEEAELTWDAGDKHHEPALDDVPEHIVTKNRAATY  80

Query  424  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
            + G   F   +   AV  DK SK PF PK +PY+ L  ELG E
Sbjct  81   LVGAFCFLGCVYGTAVMVDKPSKTPFVPKEFPYNGLAKELGRE  123



>emb|CEF99290.1| unnamed product [Ostreococcus tauri]
Length=93

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = -1

Query  571  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFAS  395
            MG  +     P + +P   EL WD G    EP +D + +  V K  A  ++ G   F   
Sbjct  1    MGPAIEPTEAPTREMPEEAELTWDAGDKHHEPALDDVPEHIVTKNRAATYLVGAFCFLGC  60

Query  394  LGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  296
            +   AV  DK SK PF PK +PY+ L  ELG E
Sbjct  61   VYGTAVMVDKPSKTPFVPKEFPYNGLAKELGRE  93



>ref|XP_002968302.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
 ref|XP_002976075.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ22980.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ30556.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
Length=136

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 7/91 (8%)
 Frame = -1

Query  595  SSLSTRAG-MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMC  419
            S++ TR+G  GLP+        P+P   EL W          +D     + K+EAL   C
Sbjct  29   SAMRTRSGGWGLPLPPEEEVSAPVPEEYELWWGGER------VDEDPTDIDKWEALGMCC  82

Query  418  GGLGFFASLGLMAVWNDKASKIPFTPKVYPY  326
             GL FFA LG++A +  K SK P+  + +P+
Sbjct  83   AGLSFFAILGVLAHYRAKYSKRPYPLREFPW  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940