BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041N24

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN71209.1|  hypothetical protein VITISV_030057                     168   5e-50   Vitis vinifera
emb|CDP07966.1|  unnamed protein product                                176   5e-48   Coffea canephora [robusta coffee]
ref|XP_009801460.1|  PREDICTED: pentatricopeptide repeat-containi...    172   1e-46   Nicotiana sylvestris
ref|XP_009601923.1|  PREDICTED: pentatricopeptide repeat-containi...    169   8e-46   Nicotiana tomentosiformis
ref|XP_004237182.2|  PREDICTED: pentatricopeptide repeat-containi...    169   1e-45   Solanum lycopersicum
emb|CBI24106.3|  unnamed protein product                                168   1e-45   Vitis vinifera
emb|CBI27495.3|  unnamed protein product                                168   2e-45   Vitis vinifera
ref|XP_002273494.2|  PREDICTED: pentatricopeptide repeat-containi...    168   2e-45   Vitis vinifera
ref|XP_002269531.1|  PREDICTED: pentatricopeptide repeat-containi...    168   2e-45   Vitis vinifera
dbj|BAD95045.1|  putative protein                                       157   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ABK95746.1|  unknown                                                 158   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002521865.1|  pentatricopeptide repeat-containing protein,...    164   1e-44   
ref|XP_006420692.1|  hypothetical protein CICLE_v10004581mg             164   4e-44   Citrus clementina [clementine]
gb|KDO57832.1|  hypothetical protein CISIN_1g007461mg                   163   2e-43   Citrus sinensis [apfelsine]
ref|XP_011090005.1|  PREDICTED: pentatricopeptide repeat-containi...    163   2e-43   Sesamum indicum [beniseed]
ref|XP_006470889.1|  PREDICTED: pentatricopeptide repeat-containi...    162   2e-43   Citrus sinensis [apfelsine]
gb|KDP38220.1|  hypothetical protein JCGZ_04863                         159   3e-43   Jatropha curcas
ref|XP_010270795.1|  PREDICTED: pentatricopeptide repeat-containi...    161   7e-43   Nelumbo nucifera [Indian lotus]
ref|XP_011021682.1|  PREDICTED: pentatricopeptide repeat-containi...    158   9e-43   Populus euphratica
ref|XP_007015128.1|  Pentatricopeptide repeat superfamily protein...    159   4e-42   
ref|XP_003555735.1|  PREDICTED: pentatricopeptide repeat-containi...    158   5e-42   Glycine max [soybeans]
ref|XP_002314741.2|  hypothetical protein POPTR_0010s10900g             158   7e-42   
ref|XP_011021681.1|  PREDICTED: pentatricopeptide repeat-containi...    158   7e-42   Populus euphratica
ref|XP_002871585.1|  pentatricopeptide repeat-containing protein        158   7e-42   Arabidopsis lyrata subsp. lyrata
gb|KJB35742.1|  hypothetical protein B456_006G126500                    156   1e-41   Gossypium raimondii
gb|KHN38588.1|  Pentatricopeptide repeat-containing protein, chlo...    157   1e-41   Glycine soja [wild soybean]
ref|XP_003529243.2|  PREDICTED: pentatricopeptide repeat-containi...    157   1e-41   Glycine max [soybeans]
ref|XP_009125945.1|  PREDICTED: pentatricopeptide repeat-containi...    157   1e-41   Brassica rapa
emb|CDX91096.1|  BnaC02g05010D                                          157   2e-41   
gb|KFK25604.1|  hypothetical protein AALP_AA8G136200                    156   3e-41   Arabis alpina [alpine rockcress]
ref|XP_008778816.1|  PREDICTED: pentatricopeptide repeat-containi...    156   3e-41   Phoenix dactylifera
ref|XP_010492155.1|  PREDICTED: pentatricopeptide repeat-containi...    156   3e-41   Camelina sativa [gold-of-pleasure]
ref|NP_196881.2|  pentatricopeptide repeat-containing protein           156   4e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10598.1|  unnamed protein product                                155   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB35743.1|  hypothetical protein B456_006G126500                    156   4e-41   Gossypium raimondii
ref|XP_006289562.1|  hypothetical protein CARUB_v10003108mg             155   6e-41   Capsella rubella
ref|XP_010043883.1|  PREDICTED: pentatricopeptide repeat-containi...    155   7e-41   Eucalyptus grandis [rose gum]
ref|XP_004151188.1|  PREDICTED: pentatricopeptide repeat-containi...    154   2e-40   Cucumis sativus [cucumbers]
gb|KHN48767.1|  Pentatricopeptide repeat-containing protein, chlo...    147   2e-40   Glycine soja [wild soybean]
ref|XP_004172063.1|  PREDICTED: pentatricopeptide repeat-containi...    154   2e-40   
ref|XP_008465506.1|  PREDICTED: pentatricopeptide repeat-containi...    154   2e-40   Cucumis melo [Oriental melon]
ref|XP_010547300.1|  PREDICTED: pentatricopeptide repeat-containi...    154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_006576030.1|  PREDICTED: pentatricopeptide repeat-containi...    147   5e-40   Glycine max [soybeans]
ref|XP_010453475.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    152   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010668078.1|  PREDICTED: pentatricopeptide repeat-containi...    152   9e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006399876.1|  hypothetical protein EUTSA_v10016019mg             152   1e-39   Eutrema salsugineum [saltwater cress]
ref|XP_007222296.1|  hypothetical protein PRUPE_ppa003348mg             149   8e-39   
ref|XP_007153172.1|  hypothetical protein PHAVU_003G013000g             149   9e-39   Phaseolus vulgaris [French bean]
ref|XP_008220989.1|  PREDICTED: pentatricopeptide repeat-containi...    149   1e-38   Prunus mume [ume]
ref|XP_009351650.1|  PREDICTED: pentatricopeptide repeat-containi...    149   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_006853735.1|  hypothetical protein AMTR_s00056p00173630          148   3e-38   Amborella trichopoda
gb|EYU36097.1|  hypothetical protein MIMGU_mgv1a020159mg                146   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_004298632.1|  PREDICTED: pentatricopeptide repeat-containi...    143   1e-36   Fragaria vesca subsp. vesca
gb|KEH40726.1|  PPR containing plant-like protein                       142   4e-36   Medicago truncatula
ref|XP_008340510.1|  PREDICTED: pentatricopeptide repeat-containi...    142   5e-36   Malus domestica [apple tree]
ref|XP_009400607.1|  PREDICTED: pentatricopeptide repeat-containi...    142   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004498165.1|  PREDICTED: pentatricopeptide repeat-containi...    139   5e-35   Cicer arietinum [garbanzo]
emb|CCI55317.1|  PH01B001I13.13                                         133   1e-32   Phyllostachys edulis [kikko-chiku]
ref|XP_006420695.1|  hypothetical protein CICLE_v10006779mg             128   1e-31   
gb|EMT31983.1|  hypothetical protein F775_29312                         128   4e-31   
ref|NP_001174064.1|  Os04g0583150                                       126   2e-30   
gb|EAY95290.1|  hypothetical protein OsI_17116                          126   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_003580383.1|  PREDICTED: pentatricopeptide repeat-containi...    124   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_004976594.1|  PREDICTED: pentatricopeptide repeat-containi...    123   2e-29   Setaria italica
ref|XP_011025175.1|  PREDICTED: pentatricopeptide repeat-containi...    122   4e-29   Populus euphratica
ref|XP_002312498.2|  hypothetical protein POPTR_0008s14240g             122   4e-29   
ref|XP_008350824.1|  PREDICTED: pentatricopeptide repeat-containi...    121   1e-28   
ref|XP_006652694.1|  PREDICTED: pentatricopeptide repeat-containi...    120   3e-28   Oryza brachyantha
ref|NP_001142291.1|  uncharacterized protein LOC100274460               118   4e-28   Zea mays [maize]
gb|ACG27989.1|  hypothetical protein                                    120   4e-28   Zea mays [maize]
tpg|DAA36322.1|  TPA: hypothetical protein ZEAMMB73_184989              118   1e-27   
gb|KDO42183.1|  hypothetical protein CISIN_1g044084mg                 79.7    1e-14   Citrus sinensis [apfelsine]
ref|XP_008778815.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    3e-10   
ref|XP_001783392.1|  predicted protein                                65.1    4e-09   
emb|CDP08449.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
ref|XP_011090170.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    4e-06   
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   Nicotiana sylvestris
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   Nicotiana sylvestris
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    1e-05   Nicotiana tomentosiformis
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...  53.9    2e-05   Nicotiana tomentosiformis
ref|XP_006338777.1|  PREDICTED: pentatricopeptide repeat-containi...  53.5    2e-05   
gb|AIU48580.1|  tetratricopeptide repeat-like superfamily protein     52.8    3e-05   Houttuynia cordata [chameleon-plant]
ref|XP_002869525.1|  pentatricopeptide repeat-containing protein      53.1    4e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_002313272.1|  hypothetical protein POPTR_0009s07170g           52.8    4e-05   
ref|XP_011036387.1|  PREDICTED: pentatricopeptide repeat-containi...  52.4    5e-05   Populus euphratica
ref|XP_011036388.1|  PREDICTED: pentatricopeptide repeat-containi...  52.4    5e-05   Populus euphratica
ref|XP_006285775.1|  hypothetical protein CARUB_v10007249mg           52.4    7e-05   Capsella rubella
ref|XP_002533283.1|  pentatricopeptide repeat-containing protein,...  52.0    7e-05   
ref|XP_004486551.1|  PREDICTED: pentatricopeptide repeat-containi...  52.0    9e-05   
gb|KDP42575.1|  hypothetical protein JCGZ_24349                       51.6    9e-05   Jatropha curcas
ref|XP_009768471.1|  PREDICTED: pentatricopeptide repeat-containi...  51.2    1e-04   Nicotiana sylvestris
ref|NP_194530.1|  pentatricopeptide repeat-containing protein         51.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237581.1|  PREDICTED: pentatricopeptide repeat-containi...  51.6    1e-04   Solanum lycopersicum
gb|AAM91084.1|  AT4g28010/T13J8_120                                   51.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275891.1|  PREDICTED: pentatricopeptide repeat-containi...  51.2    1e-04   Nelumbo nucifera [Indian lotus]
gb|AIU48553.1|  tetratricopeptide repeat-like superfamily protein     50.8    2e-04   Chimonanthus praecox [wintersweet]
ref|XP_004502213.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    2e-04   Cicer arietinum [garbanzo]
gb|AIU48545.1|  tetratricopeptide repeat-like superfamily protein     50.4    2e-04   Capsella rubella
ref|XP_010527103.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    2e-04   Tarenaya hassleriana [spider flower]
gb|AIU48551.1|  tetratricopeptide repeat-like superfamily protein     50.4    2e-04   Chloranthus japonicus
ref|XP_004970460.1|  PREDICTED: pentatricopeptide repeat-containi...  50.4    3e-04   
ref|XP_009414726.1|  PREDICTED: pentatricopeptide repeat-containi...  50.4    3e-04   
gb|KHM99248.1|  Pentatricopeptide repeat-containing protein           49.3    3e-04   Glycine soja [wild soybean]
ref|XP_002456587.1|  hypothetical protein SORBIDRAFT_03g038900        50.4    3e-04   Sorghum bicolor [broomcorn]
ref|XP_006290805.1|  hypothetical protein CARUB_v10016912mg           50.1    3e-04   Capsella rubella
gb|AIU48560.1|  tetratricopeptide repeat-like superfamily protein     50.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_006447383.1|  hypothetical protein CICLE_v10016159mg           49.7    3e-04   
gb|AIU48549.1|  tetratricopeptide repeat-like superfamily protein     50.1    3e-04   Buxus sinica
ref|XP_010438517.1|  PREDICTED: pentatricopeptide repeat-containi...  50.1    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009379032.1|  PREDICTED: pentatricopeptide repeat-containi...  50.1    3e-04   Pyrus x bretschneideri [bai li]
gb|AIU48532.1|  tetratricopeptide repeat-like superfamily protein     50.1    3e-04   Arabidopsis lyrata [lyrate rockcress]
gb|KDO55772.1|  hypothetical protein CISIN_1g016395mg                 49.7    4e-04   Citrus sinensis [apfelsine]
gb|EPS66249.1|  hypothetical protein M569_08528                       49.7    4e-04   Genlisea aurea
ref|XP_006469838.1|  PREDICTED: pentatricopeptide repeat-containi...  49.7    4e-04   Citrus sinensis [apfelsine]
gb|EYU33512.1|  hypothetical protein MIMGU_mgv1a023422mg              49.7    5e-04   Erythranthe guttata [common monkey flower]
gb|AIU48547.1|  tetratricopeptide repeat-like superfamily protein     49.7    5e-04   Eucalyptus grandis [rose gum]
ref|XP_002878256.1|  pentatricopeptide repeat-containing protein      49.7    5e-04   Arabidopsis lyrata subsp. lyrata
gb|AHC02098.1|  pentatricopeptide repeat-containing protein 123       49.7    5e-04   Aloysia polygalifolia
ref|XP_010259875.1|  PREDICTED: pentatricopeptide repeat-containi...  49.7    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004295757.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  49.7    5e-04   Fragaria vesca subsp. vesca
gb|AIU48541.1|  tetratricopeptide repeat-like superfamily protein     49.3    5e-04   Sarcandra glabra
ref|XP_003621600.1|  Pentatricopeptide repeat-containing protein      49.7    5e-04   Medicago truncatula
ref|XP_010673744.1|  PREDICTED: pentatricopeptide repeat-containi...  49.7    5e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48562.1|  tetratricopeptide repeat-like superfamily protein     49.3    5e-04   Solanum tuberosum [potatoes]
ref|XP_010673748.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    5e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673747.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    6e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673746.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    6e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48544.1|  tetratricopeptide repeat-like superfamily protein     49.3    6e-04   Carica papaya [mamon]
ref|XP_006842614.1|  hypothetical protein AMTR_s00077p00176610        49.3    6e-04   Amborella trichopoda
ref|XP_010673749.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    6e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP43170.1|  hypothetical protein JCGZ_22722                       48.9    6e-04   Jatropha curcas
ref|XP_008464651.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    6e-04   Cucumis melo [Oriental melon]
ref|XP_006357891.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    7e-04   Solanum tuberosum [potatoes]
gb|AIU48578.1|  tetratricopeptide repeat-like superfamily protein     49.3    7e-04   Platanus x hispanica [London plane tree]
ref|XP_003601624.1|  Pentatricopeptide repeat-containing protein      49.3    7e-04   Medicago truncatula
gb|EYU42850.1|  hypothetical protein MIMGU_mgv1a0029291mg             48.9    7e-04   Erythranthe guttata [common monkey flower]
ref|XP_008464650.1|  PREDICTED: pentatricopeptide repeat-containi...  48.9    8e-04   Cucumis melo [Oriental melon]
emb|CAN63985.1|  hypothetical protein VITISV_001389                   48.9    9e-04   Vitis vinifera
gb|AIU48542.1|  tetratricopeptide repeat-like superfamily protein     48.9    9e-04   Citrus clementina [clementine]
ref|XP_002299968.2|  hypothetical protein POPTR_0001s27990g           48.5    0.001   
gb|AHX42011.1|  pentatricopeptide repeat-containing protein 11        48.1    0.001   Campanula laciniata
ref|XP_006656582.1|  PREDICTED: pentatricopeptide repeat-containi...  47.8    0.001   
gb|AIU48533.1|  tetratricopeptide repeat-like superfamily protein     48.5    0.001   Arabidopsis thaliana [mouse-ear cress]



>emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera]
Length=109

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  3    RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  62

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  63   ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  106



>emb|CDP07966.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV+PDRVSYTSVISAYS+A+E E+C++YYQ F+LNGG  DRAMA IMV VFSK+N+ D
Sbjct  509  RRKVLPDRVSYTSVISAYSRAREFETCMRYYQKFRLNGGAIDRAMAAIMVAVFSKLNRAD  568

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            ELVKLLQD+KT+ TKLD RLYRSALNALRDAGL ++AKWLQESF 
Sbjct  569  ELVKLLQDMKTEGTKLDVRLYRSALNALRDAGLHVQAKWLQESFG  613



>ref|XP_009801460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana sylvestris]
Length=641

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PDRVSYTS+ISAYS+A+E + C+ YYQ+F LNGGK DRAMAGIMVGVFSKMN+VD
Sbjct  535  RRKIFPDRVSYTSIISAYSRAREFDKCLTYYQEFTLNGGKIDRAMAGIMVGVFSKMNRVD  594

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  595  ELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  639



>ref|XP_009601923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana tomentosiformis]
Length=619

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PDRVSYTS+I+AYS+A+E + C+ YYQ+F LNGG+ DRAMAGIMVGVFSKMN+VD
Sbjct  513  RRKIFPDRVSYTSIITAYSRAREFDKCLTYYQEFTLNGGRIDRAMAGIMVGVFSKMNRVD  572

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  573  ELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  617



>ref|XP_004237182.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Solanum lycopersicum]
Length=642

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PDRVSYTS+ISAYSKA+E + C+ YYQ+F LNGG+ DRAMAGIMVGVFSKMN+VD
Sbjct  536  RRKIFPDRVSYTSIISAYSKAREFDKCLIYYQEFTLNGGRLDRAMAGIMVGVFSKMNRVD  595

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL+ LLQ++K + TKLD RL +SALN+LRDAGL+I+AKWLQESF 
Sbjct  596  ELISLLQNMKREGTKLDGRLQKSALNSLRDAGLQIQAKWLQESFG  640



>emb|CBI24106.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  421  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  480

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  481  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  524



>emb|CBI27495.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  435  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  494

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  495  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  538



>ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=609

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  498  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  558  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  601



>ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=603

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  497  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  556

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  557  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  600



>dbj|BAD95045.1| putative protein [Arabidopsis thaliana]
Length=126

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  3    RAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  62

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  63   ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  109



>gb|ABK95746.1| unknown [Populus trichocarpa]
Length=184

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  78   RRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  137

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  138  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  181



>ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=449

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+YTSVI+AY+KAKE E+CV+YY +++ NGG  D+A+AG+MVGVFSK+ ++D
Sbjct  343  RRKVAPDKVTYTSVIAAYNKAKEFETCVRYYHEYRFNGGVIDKAVAGVMVGVFSKIGRID  402

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL+KLLQD+KT+ T+LD RLYRSA NALRDAGL+++AKW+QESF
Sbjct  403  ELLKLLQDIKTEGTQLDGRLYRSAFNALRDAGLQMQAKWMQESF  446



>ref|XP_006420692.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
 gb|ESR33932.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
Length=603

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRAMAGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIE  556

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>gb|KDO57832.1| hypothetical protein CISIN_1g007461mg [Citrus sinensis]
Length=603

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIE  556

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>ref|XP_011090005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Sesamum indicum]
Length=621

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK++PDRVSYT+VISAY++A+E E+CVKYY++FKL GGK DRAMAG MV VFSKMN+V+
Sbjct  515  RRKIIPDRVSYTTVISAYNRAREFETCVKYYEEFKLTGGKMDRAMAGTMVAVFSKMNRVE  574

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            E+++LL+D+K   T+LD R YRSA+NALRDAGL+ +A+WLQE+F
Sbjct  575  EVIELLRDMKLQGTELDARFYRSAMNALRDAGLQSQARWLQETF  618



>ref|XP_006470889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Citrus sinensis]
Length=603

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIE  556

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600



>gb|KDP38220.1| hypothetical protein JCGZ_04863 [Jatropha curcas]
Length=415

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PD+V+YTSVISAY+K KE ++CV YY ++++NGG  D+AMAGIMVGVFSK+ ++D
Sbjct  306  RRKIAPDKVTYTSVISAYNKVKEFDTCVSYYHEYRINGGAIDKAMAGIMVGVFSKIGRID  365

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++LL D+K + T LD RLYRSA NALRDAGL+++AKWLQESF
Sbjct  366  ELLRLLHDMKIEGTPLDGRLYRSAFNALRDAGLQMQAKWLQESF  409



>ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nelumbo nucifera]
Length=636

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYTS+I+AYSKA E E+C+K YQ+F+ NGGK DRA+AGIMVGVFSK ++++
Sbjct  502  RRKVAPDKVSYTSLITAYSKAGEFEACIKLYQEFRFNGGKLDRALAGIMVGVFSKSSRIN  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL+KLLQD+K + T LD +LYRSALNALRDAGL+++ KW +ESFA
Sbjct  562  ELMKLLQDMKLEGTGLDVKLYRSALNALRDAGLQVQVKWFEESFA  606



>ref|XP_011021682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=413

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  307  RRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  366

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  367  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  410



>ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=608

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK  PD+VSYT++ISAYS+A+E E C+K YQ+F+LNGG  D+AMAGIMVG+FSK +++D
Sbjct  502  RRKTAPDKVSYTTIISAYSRAREYEMCLKCYQEFRLNGGLIDKAMAGIMVGIFSKTSRID  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLLQD+K + T+LD RLY SA+NALRDAGLE +AKWLQ++F
Sbjct  562  ELVKLLQDMKAEGTQLDGRLYHSAMNALRDAGLETQAKWLQKNF  605



>ref|XP_003555735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
 gb|KHM98995.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=609

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD+VSYTS+I AYSKA E E+CVK++ ++++NGG  DRAMAGIMVGVFSK+  VD
Sbjct  503  RRRVAPDKVSYTSIIGAYSKAGEFETCVKFFNEYRMNGGLIDRAMAGIMVGVFSKVGLVD  562

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLLQD+K + T+LD+RLY+SA NA +DAGL+I+A+W++ESF V 
Sbjct  563  ELVKLLQDMKAEGTRLDQRLYQSAWNAFKDAGLQIQARWMKESFLVT  609



>ref|XP_002314741.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
 gb|EEF00912.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
Length=582

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  476  RRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  535

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  536  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  579



>ref|XP_011021681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=613

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  507  RRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  566

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  567  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  610



>ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=609

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 6/127 (5%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RAKVLPDKVSYTSMISAYNRAKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKP  189
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A       ++  + 
Sbjct  546  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA------QTSASRY  599

Query  188  KNIVNTR  168
             N  NTR
Sbjct  600  SNTKNTR  606



>gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=441

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVGVFSK +++D
Sbjct  329  RRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRID  388

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  389  ELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  432



>gb|KHN38588.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=601

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVGVFSK+ +VD
Sbjct  495  RRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVD  554

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  555  ELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  601



>ref|XP_003529243.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=631

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVGVFSK+ +VD
Sbjct  525  RRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVD  584

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  585  ELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  631



>ref|XP_009125945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brassica rapa]
 emb|CDX85626.1| BnaA02g01870D [Brassica napus]
Length=613

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMISAYNRAKEFEACVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  546  ELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>emb|CDX91096.1| BnaC02g05010D [Brassica napus]
Length=613

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMISAYNRAKEFETCVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  546  ELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592



>gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina]
Length=606

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +V+PD+VSYTS+ISAY++AKE E CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  481  RMRVLPDKVSYTSMISAYNRAKEFEQCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  540

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  541  ELMRLLQDMKAERTKLDVRLYTSALNALRDAGLNSQIRWLQESFDSA  587



>ref|XP_008778816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=614

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD++SYTS+ISAY+KA++L+ C+++Y++FK+N GK DRA+AGIMVGVFSK ++ D
Sbjct  501  RRRVXPDKISYTSIISAYNKARKLDECIRFYEEFKMNRGKVDRALAGIMVGVFSKGSRFD  560

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  231
            ELVKLLQD+K++ T LDERLY SALNALRDAGL++  KW ++SF +
Sbjct  561  ELVKLLQDMKSEGTGLDERLYESALNALRDAGLQVHMKWFEKSFGL  606



>ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Camelina sativa]
Length=614

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKELE C++ YQ+F++N GK DRAM GIMVGVFSK +++D
Sbjct  483  RAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMNRGKIDRAMGGIMVGVFSKTSRID  542

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKP  189
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A    S  S  K  
Sbjct  543  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQTSASRYSNMKNT  602

Query  188  KNI  180
            KN+
Sbjct  603  KNL  605



>ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05481.1| At5g13770 [Arabidopsis thaliana]
 gb|AAU95422.1| At5g13770 [Arabidopsis thaliana]
 gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=609

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  546  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  592



>dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana]
Length=563

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  440  RAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  499

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  500  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  546



>gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=585

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVGVFSK +++D
Sbjct  473  RRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRID  532

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  533  ELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  576



>ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
 gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
Length=612

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKEL+ CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  487  RAKVLPDKVSYTSMISAYNRAKELDRCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  546

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  547  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  593



>ref|XP_010043883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85901.1| hypothetical protein EUGRSUZ_B02618 [Eucalyptus grandis]
Length=615

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+KV PD+VSYTS+I+AY++A+E E+C+K+Y++F+ NGG  DRAM GIMVGVFSK ++++
Sbjct  502  RKKVAPDKVSYTSLIAAYNRAREFETCIKFYEEFRANGGSIDRAMGGIMVGVFSKSSRIE  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++ LQD+K++ T+LD RLY SALNALRD+GL ++A+W QESF++A
Sbjct  562  ELIRFLQDMKSEGTELDGRLYGSALNALRDSGLLVQARWFQESFSMA  608



>ref|XP_004151188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
 gb|KGN49761.1| hypothetical protein Csa_5G114580 [Cucumis sativus]
Length=608

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVD  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            ELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602



>gb|KHN48767.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=221

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD+VSYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVGVFSK+  VD
Sbjct  115  RRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVD  174

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL+KLLQD+K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  175  ELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  221



>ref|XP_004172063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
Length=608

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVD  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            ELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602



>ref|XP_008465506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Cucumis melo]
Length=608

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+K+ PD+VSYTS+I+AY KA E E C +YY++F++NGG  D+A+ GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIINAYVKASEFEKCEQYYREFRMNGGTIDKAIGGIMVGVFSKTSRVD  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            ELVKLL+D+K + T+LDERLYRSALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRSALNALMDAGLQVQAKWLQDHYA  602



>ref|XP_010547300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Tarenaya hassleriana]
Length=632

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KVVPD+V+YTS+ISAY+K KE E CV+ Y +F++N G+ DRAMAGIMVGVFSK+++ D
Sbjct  507  RMKVVPDKVTYTSMISAYNKTKEFERCVELYHEFRMNRGEIDRAMAGIMVGVFSKISRFD  566

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  225
            EL++LLQD+K   T+LD RLY SALNALRDAGL+++ +WLQE+F   T
Sbjct  567  ELMRLLQDMKVQGTRLDGRLYSSALNALRDAGLQVQIRWLQENFEATT  614



>ref|XP_006576030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=258

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PD+VSYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVGVFSK+  VD
Sbjct  152  RRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVD  211

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL+KLLQD+K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  212  ELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  258



>ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g13770, chloroplastic-like [Camelina sativa]
Length=602

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+ISAY++AKELE C++ YQ+F+++ G+ DRAMAGIMVGVFSK +++D
Sbjct  483  RAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMSRGEIDRAMAGIMVGVFSKTSRID  542

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  543  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  589



>ref|XP_010668078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDRVSYTS+I AYS+A+E E+C  +Y +++ +GG  D A+AGIMVGVFSK+N++D
Sbjct  504  RRKVEPDRVSYTSIIGAYSRAREYETCTIFYDEYRKSGGVIDLALAGIMVGVFSKINRID  563

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            E++KLLQDLK + TK+D RLYRSALNALRDAGL+++ +WL+E+F
Sbjct  564  EIIKLLQDLKAEGTKMDTRLYRSALNALRDAGLQMQVRWLEENF  607



>ref|XP_006399876.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
 gb|ESQ41329.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
Length=611

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R KV+PD+VSYTS+I A ++AKELE CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMIGACNRAKELERCVELYNEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            EL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  546  ELMRLLQDMKVERTKLDARLYSSALNALRDAGLNSQIRWLQESFDTA  592



>ref|XP_007222296.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
 gb|EMJ23495.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
Length=583

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVGVFSK  +VD
Sbjct  477  RRKVAPDKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGRVD  536

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLL+D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  537  ELVKLLRDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  583



>ref|XP_007153172.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
 gb|ESW25166.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
Length=609

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+YTS+ISAY+KA E ESC+K + ++++ GG  DRAMAG MVGV++K+ +VD
Sbjct  503  RRKVAPDKVTYTSIISAYNKAGEFESCMKLFDEYRMKGGLIDRAMAGTMVGVYTKVGQVD  562

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            +LVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++AKW++E F VA
Sbjct  563  DLVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQAKWMKEIFLVA  609



>ref|XP_008220989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
 ref|XP_008220990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
Length=615

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVGVFSK  +VD
Sbjct  509  RRKVAPDKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGQVD  568

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLL+D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  569  ELVKLLRDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  615



>ref|XP_009351650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Pyrus x bretschneideri]
Length=608

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+VPD+VSYT++I AY+KA E E C+KYY +F+++GG  D+A+AG+MVG+FSK  ++D
Sbjct  502  RRKIVPDKVSYTTIIGAYNKAGEYEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRID  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLL+D+K + T+LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  562  ELVKLLRDMKAEGTELDGRLYRSALKALSDSGLEMQVKWLQGSFKVT  608



>ref|XP_006853735.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
 gb|ERN15202.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
Length=616

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR+V PDRVSYTSVI AYSKA E E C++++++F++NGG+ D+ M GIMVGVFSK N++D
Sbjct  503  RRRVQPDRVSYTSVILAYSKAGECEECMRFFKEFRMNGGRIDKIMGGIMVGVFSKSNRID  562

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            ELV LLQD+K + T LDERL RSA NALRDAGL+ +  WL ESF 
Sbjct  563  ELVTLLQDMKLEGTLLDERLKRSAANALRDAGLQAQVGWLNESFG  607



>gb|EYU36097.1| hypothetical protein MIMGU_mgv1a020159mg [Erythranthe guttata]
Length=573

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR++VPDRVSYTSVIS Y++ KE + C++YY++FK+ GGK D+AMAG+MV V+SK N+V 
Sbjct  468  RRRIVPDRVSYTSVISGYNRVKEFDKCIEYYEEFKMTGGKIDKAMAGVMVAVYSKTNRVA  527

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELV+LLQD+K +   LD R Y SA++ALRDAGL+++ +WLQE F
Sbjct  528  ELVELLQDMKMEGAVLDARFYSSAMSALRDAGLQVQTRWLQEMF  571



>ref|XP_004298632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=604

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+VSYT+VI AY+KA + E C+++Y +++++GG  D+ MA +MVGVFSK  +VD
Sbjct  498  RRKVAPDKVSYTTVIGAYNKAGDFEMCLRFYNEYRIHGGVLDKTMAAMMVGVFSKSGRVD  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLL+D+K + T LD RLYRSALNAL D+GLE++ KWLQ SF V 
Sbjct  558  ELVKLLRDMKAEGTGLDVRLYRSALNALADSGLEMQVKWLQSSFEVT  604



>gb|KEH40726.1| PPR containing plant-like protein [Medicago truncatula]
Length=605

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+++YTS+I AY KA+E + C+K Y +++LN G  D+AMAG MVGV+SK+  VD
Sbjct  499  RRKVAPDKITYTSIIGAYCKAQEFDKCIKLYNEYRLNKGAIDKAMAGTMVGVYSKVGMVD  558

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLLQD+K + T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  559  ELVKLLQDMKMEGTRLDQRLYQSAWNAFTEAGMQLQVKWMKESFIVT  605



>ref|XP_008340510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Malus domestica]
Length=608

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PD+VSYT++I AY+KA E E C+KYY +F++ GG  D+A+AG+MV +FSK  ++D
Sbjct  502  RRKIAPDKVSYTTIIGAYNKAGEYEMCMKYYHEFRVQGGVLDKALAGMMVAIFSKTGRID  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLL+D+K +  +LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  562  ELVKLLRDMKAEGAELDGRLYRSALKALTDSGLEMQVKWLQGSFKVT  608



>ref|XP_009400607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=614

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR++ PD+VSYTS+ISAYSKA+ ++ C+ ++++FK NGGK DRAMAGIMVGVFSK +++D
Sbjct  503  RRQIAPDKVSYTSIISAYSKARRIDECIDFFEEFKGNGGKVDRAMAGIMVGVFSKGSRLD  562

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL+KLLQD++   T LD RL+ SALNALRDAGL++     ++SF
Sbjct  563  ELIKLLQDMELAGTGLDARLHESALNALRDAGLQVHMNGFRKSF  606



>ref|XP_004498165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
Length=632

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+++YTS+I AY K  E + C++ Y +++LN G  D+AMAG MVGV+SK+ +VD
Sbjct  526  RRKVAPDKITYTSIIGAYCKIGEFDKCIELYNEYRLNKGVIDKAMAGTMVGVYSKVGQVD  585

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            ELVKLLQD+K++ T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  586  ELVKLLQDMKSEGTRLDQRLYQSAWNAFAEAGMQVQVKWMKESFHVT  632



>emb|CCI55317.1| PH01B001I13.13 [Phyllostachys edulis]
Length=636

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR V PDRVSYT++ISA++++ EL+ C+  YQ+F+  GGK D+A+AG+M GVFSK ++ +
Sbjct  494  RRTVQPDRVSYTAIISAFNRSGELDRCMDLYQEFRETGGKVDKALAGLMAGVFSKCSRFN  553

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL+ LL+D+K +  KLD RLY S LN+LR+AGLE+  KWLQ +F+
Sbjct  554  ELIDLLKDMKLEGAKLDRRLYMSVLNSLREAGLEVHVKWLQSNFS  598



>ref|XP_006420695.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
 gb|ESR33935.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
Length=382

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 10/104 (10%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV P+          Y+ A+  +  VK+Y +FK+NGG  DRAMAGIMVGVFSK+++++
Sbjct  286  RRKVTPE----------YNMARGFDMFVKFYNEFKMNGGVIDRAMAGIMVGVFSKLSQIE  335

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            ELVKLL D+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  336  ELVKLLGDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  379



>gb|EMT31983.1| hypothetical protein F775_29312 [Aegilops tauschii]
Length=609

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDRVSYT+++ A++++ EL+ C+ YYQ+F+  GG  D+ +AG+MVGVF K ++ +
Sbjct  499  RRKVQPDRVSYTAIVGAFNRSGELDRCMDYYQEFRETGGTVDKTLAGLMVGVFCKTSRFN  558

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            +L++LL+D+K   TKLD RLY   LN+LR+AGLE+  +WLQ+ F
Sbjct  559  DLIQLLRDMKLQGTKLDRRLYMIVLNSLREAGLEVHVRWLQDYF  602



>ref|NP_001174064.1| Os04g0583150 [Oryza sativa Japonica Group]
 emb|CAE04154.2| OSJNBa0088A01.11 [Oryza sativa Japonica Group]
 gb|EAZ31756.1| hypothetical protein OsJ_15910 [Oryza sativa Japonica Group]
 dbj|BAG89668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92792.1| Os04g0583150 [Oryza sativa Japonica Group]
Length=606

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVGVFSK ++ +
Sbjct  498  RRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFN  557

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  558  ELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  600



>gb|EAY95290.1| hypothetical protein OsI_17116 [Oryza sativa Indica Group]
Length=608

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVGVFSK ++ +
Sbjct  500  RRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFN  559

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  560  ELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  602



>ref|XP_003580383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brachypodium distachyon]
Length=612

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDR+SYT++I A++++ EL+ C+ +YQ+F+  G K D+ MA +MVGVF K ++ +
Sbjct  502  RRKVQPDRISYTAIIGAFNRSGELDRCMNFYQEFRETGMKVDQTMASLMVGVFCKSSRFN  561

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  234
            EL++LL+D+K    KLD RLY   LN+LR+AGLE+  KWLQ  F+
Sbjct  562  ELIELLRDMKLQGIKLDRRLYMIVLNSLREAGLEVHVKWLQNYFS  606



>ref|XP_004976594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Setaria italica]
Length=607

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD++SYT +I A ++A EL  CV+ YQ+F+  GGK D++MAG+M GVFSK ++ +
Sbjct  499  RRKVRPDQISYTGIILANNRAGELHRCVELYQEFREAGGKVDKSMAGLMAGVFSKCSRFN  558

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++LL+D+  + TKLD RLY S L +LRDAGLE+  KWL+ +F
Sbjct  559  ELIELLKDM--NATKLDRRLYMSVLRSLRDAGLEVHVKWLKSNF  600



>ref|XP_011025175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Populus euphratica]
Length=603

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVGVFSK++++D
Sbjct  506  RRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRID  565

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  255
            EL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  566  ELLKLLRDMKSEGAPIDERLYISATNAM--VAKELRGK  601



>ref|XP_002312498.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
 gb|EEE89865.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
Length=603

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVGVFSK++++D
Sbjct  506  RRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRID  565

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  255
            EL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  566  ELLKLLRDMKSEGAPIDERLYVSATNAM--VAKELRGK  601



>ref|XP_008350824.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like, partial [Malus domestica]
Length=585

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKVVPD+VSYT+VISAY+KA E E C+KYY +F+++GG  D+A+AG+MVG+FSK  ++D
Sbjct  502  RRKVVPDKVSYTTVISAYNKAGEFEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRID  561

Query  368  ELVKLLQDLKTDETKLDERLYRSA  297
            ELVKLL+D+K++   LD RLYRSA
Sbjct  562  ELVKLLRDMKSEGMALDGRLYRSA  585



>ref|XP_006652694.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Oryza brachyantha]
Length=608

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDRVSYT++I++++++ EL+ C+  YQ+F+  GG  D+A+ G+MVGVFSK ++ +
Sbjct  500  RRKVQPDRVSYTAIINSFNRSGELDRCMDLYQEFRETGGNVDKALGGLMVGVFSKCSRFN  559

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++L++D++   T+LD RLY + L +LRDAGLE+  KWL+ +F
Sbjct  560  ELIELMKDMQG--TRLDRRLYLTVLRSLRDAGLEVHEKWLETNF  601



>ref|NP_001142291.1| uncharacterized protein LOC100274460 [Zea mays]
 gb|ACF78649.1| unknown [Zea mays]
 gb|ACF88108.1| unknown [Zea mays]
Length=419

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +
Sbjct  311  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFN  370

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  371  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  412



>gb|ACG27989.1| hypothetical protein [Zea mays]
Length=603

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D+ MAG+MVGV SK ++ +
Sbjct  495  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDKVMAGLMVGVLSKTSRFN  554

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  555  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>tpg|DAA36322.1| TPA: hypothetical protein ZEAMMB73_184989 [Zea mays]
Length=603

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +
Sbjct  495  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFN  554

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  237
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  555  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>gb|KDO42183.1| hypothetical protein CISIN_1g044084mg, partial [Citrus sinensis]
Length=343

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  518  YTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  363
            YT+VISAY+ A+E + CVK+Y +F++NGG  DRAMAGIMVGVFSK+++++EL
Sbjct  292  YTTVISAYNMAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIEEL  343



>ref|XP_008778815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=245

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = -2

Query  434  GKTDRAMAGIMVGVFSKM---NKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEI  264
            G     M   +V V+ +M   ++ DELVKLLQD+K   T LD  LY SALNA RD GL++
Sbjct  167  GYNKLHMYNCIVSVYDQMRMSSRFDELVKLLQDMKLKRTGLDGSLYESALNAFRDVGLQV  226

Query  263  RAKWLQESFAV  231
              KW ++SF +
Sbjct  227  HMKWFEKSFGL  237



>ref|XP_001783392.1| predicted protein [Physcomitrella patens]
 gb|EDQ51786.1| predicted protein [Physcomitrella patens]
Length=540

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -2

Query  542  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  363
            K+VPD V+YT++I+AY++    E C++ ++  + +G K DR +  IM+ V+ K  +  +L
Sbjct  404  KLVPDTVTYTTLINAYNRLGRFEECIRVFEQHRADGLKLDRILVAIMINVYGKARQYSKL  463

Query  362  VKLLQDLKTDETKLDERLYRSALNALRDAGL  270
             +LL+ +     + D R+ ++ +    D G+
Sbjct  464  AELLEVMPKSGIQPDTRILKTVVEIYEDGGM  494



>emb|CDP08449.1| unnamed protein product [Coffea canephora]
Length=714

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
             R V+PD VSY+S+I+ +S+   L+  + YY+D K NG   D+ +  I++G F K   + 
Sbjct  355  HRGVIPDLVSYSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGGFCKHGSML  414

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y + LNAL
Sbjct  415  EAMRIRDEMLEKGCLMDVVTYNTILNAL  442



>ref|XP_011090170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Sesamum indicum]
Length=715

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            RR VVPD VSY+S+I  +S+   L+  + YY+D +  G   D+ +  I++G F +   + 
Sbjct  356  RRGVVPDLVSYSSIIGFFSRTGNLDRMMTYYRDMQSKGLTPDKFVYTILIGGFCRHGAIS  415

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            + +K+  ++      +D   Y S LN L
Sbjct  416  DAMKVRDEMMKLGCHMDVVTYNSILNGL  443



>ref|XP_009781997.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009781998.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
Length=726

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +S+   L   + YY+D K  G   D  +  I++G F ++  + E
Sbjct  368  RAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKE  427

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y + LN L
Sbjct  428  AMKMRDEMLEQGLHMDVVTYNTILNGL  454



>ref|XP_009782000.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana sylvestris]
Length=608

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +S+   L   + YY+D K  G   D  +  I++G F ++  + E
Sbjct  250  RAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKE  309

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y + LN L
Sbjct  310  AMKMRDEMLEQGLHMDVVTYNTILNGL  336



>ref|XP_009625746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana tomentosiformis]
Length=608

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +S+   L+  + YY+D K  G   D  +  I++G F +   + E
Sbjct  250  RAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKE  309

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y + LN L
Sbjct  310  AMKMRDEMLEQGLHMDVVTYNTILNGL  336



>ref|XP_009625742.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625743.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
Length=726

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +S+   L+  + YY+D K  G   D  +  I++G F +   + E
Sbjct  368  RAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKE  427

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y + LN L
Sbjct  428  AMKMRDEMLEQGLHMDVVTYNTILNGL  454



>ref|XP_006338777.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Solanum tuberosum]
Length=730

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +S+   L+  + YY+  K  G K D  +  I++G F +   + E
Sbjct  372  RAIIPDLVSYSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKE  431

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y + LN L
Sbjct  432  AMKMRDEMLEQSLVMDVVTYNTILNGL  458



>gb|AIU48580.1| tetratricopeptide repeat-like superfamily protein, partial [Houttuynia 
cordata]
Length=470

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/102 (24%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K  PD  SYT++ISAY  A ++E   K+++  + +G + +    G ++  ++K++ V+
Sbjct  337  RDKCTPDLCSYTTMISAYVNAADMEGAEKFFRRVRQDGFEPNVVTYGALLKGYAKIDDVE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  243
            +++K+ +D++    K ++ ++ + ++A           W +E
Sbjct  397  KIMKIYEDMRIQGIKPNQTIFTTIMDAHGKNDFGCAVTWYKE  438



>ref|XP_002869525.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45784.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=707

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            +  ++PD VSY +VI  + + KELE  ++   + + +G        GI++  F K  K+D
Sbjct  170  QNSLMPDVVSYNTVIRGFCEGKELEKALQLANEMQGSGCSWSLVTWGILIDAFCKAGKMD  229

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            E + LL+++K    + D  +Y S +    D G   R K L
Sbjct  230  EAMGLLKEMKHKGLEADLIVYTSLIRGFCDCGELDRGKAL  269



>ref|XP_002313272.1| hypothetical protein POPTR_0009s07170g [Populus trichocarpa]
 gb|EEE87227.1| hypothetical protein POPTR_0009s07170g [Populus trichocarpa]
Length=382

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD +SY ++++  +K   L+ C  Y++D   NG + D      ++  F +   ++E +
Sbjct  264  ILPDFISYNTLLNQLTKVGRLDLCSVYFRDMVGNGIEPDLLTYTALIWSFGQSGNIEESL  323

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +L  ++KT + +    +YRS + +L+  G +E+   +L+E
Sbjct  324  RLFNEMKTKQIRPSIYIYRSLIASLKKMGKIELAMTFLEE  363



>ref|XP_011036387.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900-like 
isoform X1 [Populus euphratica]
Length=382

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD +SY ++++  +K   L+ C  Y++D   NG + D      ++  F +   ++E +
Sbjct  264  ILPDFISYNTLLNQLTKVGRLDLCSVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESL  323

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +L  ++KT + +    +YRS + +L+  G +E+   +L+E
Sbjct  324  RLFNEMKTKQIRPSIYIYRSLIASLKKMGKVELAMTFLEE  363



>ref|XP_011036388.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900-like 
isoform X2 [Populus euphratica]
Length=375

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD +SY ++++  +K   L+ C  Y++D   NG + D      ++  F +   ++E +
Sbjct  257  ILPDFISYNTLLNQLTKVGRLDLCSVYFRDMVENGIEPDLLTYTALIWSFGQSGNIEESL  316

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +L  ++KT + +    +YRS + +L+  G +E+   +L+E
Sbjct  317  RLFNEMKTKQIRPSIYIYRSLIASLKKMGKVELAMTFLEE  356



>ref|XP_006285775.1| hypothetical protein CARUB_v10007249mg [Capsella rubella]
 gb|EOA18673.1| hypothetical protein CARUB_v10007249mg [Capsella rubella]
Length=699

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            +  ++PD VSY +VI  + + KELE  ++   + + +G        GI++  F K  K++
Sbjct  170  QNSLMPDVVSYNTVIRGFCEGKELEKGLQLANEMQGSGCSWSLVTWGILINAFCKAGKME  229

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  273
            E + LL ++K+   + D  +Y + +    D G
Sbjct  230  EAIGLLSEMKSKGLEADLVVYTTLIRGFCDCG  261



>ref|XP_002533283.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29094.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=405

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            +VPD + Y ++++   KA  L+ C+ Y ++   +G + D      ++  F K   ++E +
Sbjct  287  IVPDFICYNTLLNQLQKAGRLDLCLVYIREMGESGIEADLLTYTALIQSFGKSGHIEESL  346

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQESFAVAT*IISCNSAKKK  192
            +L  D+KT + +    +YRS +N  +  G +E+    L+E  A    +   N  K+K
Sbjct  347  RLFDDMKTRQIRPSIYIYRSLINTAKKMGKVELAMTLLEEMNASPPNLAGPNDFKRK  403



>ref|XP_004486551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Cicer arietinum]
Length=891

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = -2

Query  533  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  354
            P+  +Y++++ AYS+A+  +  +  Y++ K  G   ++ + G+++ + + +   +E V+L
Sbjct  331  PNWATYSALLEAYSRARLSKEALSVYKEMKEKGMTMNKVLYGMLLDMCADVGYAEEAVEL  390

Query  353  LQDLKTDET-KLDERLYRSALNALRDAG--LEIRA-------KWLQESFAVAT*IISCNS  204
             +++K  ET + D  +Y S +N    +G  LE  A       + L+ +  V T  + C  
Sbjct  391  FEEMKRSETCQPDNFIYSSLINMYSCSGNVLEAEAMLNEMISRGLEPNILVLTMFVHCYG  450

Query  203  AKKKPKNIVN  174
              K+P ++VN
Sbjct  451  KAKRPDDVVN  460



>gb|KDP42575.1| hypothetical protein JCGZ_24349 [Jatropha curcas]
Length=500

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 0/92 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+ ++PD V+Y S+I   S AK  ++  K+++D   +G   D     I++  F K + +D
Sbjct  283  RKGLIPDHVTYNSLIHGLSNAKSAQAAYKFFKDLCASGHSPDAVTHNILIDGFCKHHCLD  342

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  273
              + L  +++    K D  +Y   +  + +AG
Sbjct  343  VALSLFHEMQKSSLKPDIIVYNILIVGMFNAG  374



>ref|XP_009768471.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900 
[Nicotiana sylvestris]
Length=403

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD VSY +VI+   K   LESC+ ++++    G K D      ++  F K   ++E +
Sbjct  285  LIPDIVSYNTVITGLRKVGRLESCLVFFKEMCERGIKPDLRTYNALIDSFGKCGNIEESL  344

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +   +LK    +    +YRS ++ L+  G LE+   +  E
Sbjct  345  RFFNELKLRGFRPSIHVYRSLISNLKKMGKLELAVAFSNE  384



>ref|NP_194530.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SUD8.1|PP340_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g28010 
[Arabidopsis thaliana]
 emb|CAB36770.1| putative protein [Arabidopsis thaliana]
 emb|CAB79603.1| putative protein [Arabidopsis thaliana]
 gb|AEE85420.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=704

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  ++PD  SY +VI  + + KELE  ++   + K +G        GI++  F K  K+D
Sbjct  170  RNSLMPDVFSYNTVIRGFCEGKELEKALELANEMKGSGCSWSLVTWGILIDAFCKAGKMD  229

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            E +  L+++K    + D  +Y S +    D G   R K L
Sbjct  230  EAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGKAL  269



>ref|XP_004237581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Solanum lycopersicum]
Length=738

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 6/102 (6%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R ++PD VSY+S+I  +++   L+  + YY+  K  G   D  +  I++G F +   + E
Sbjct  380  RAIIPDLVSYSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKE  439

Query  365  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  240
             +K+  ++      +D   Y + LN L       + K LQE+
Sbjct  440  AMKMRDEMLERSLVMDVVTYNTILNGL------CKGKMLQEA  475



>gb|AAM91084.1| AT4g28010/T13J8_120 [Arabidopsis thaliana]
Length=704

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  ++PD  SY +VI  + + KELE  ++   + K +G        GI++  F K  K+D
Sbjct  170  RNSLMPDVFSYNTVIRGFCEGKELEKALELANEMKGSGCSWSLVTWGILIDAFCKAGKMD  229

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            E +  L+++K    + D  +Y S +    D G   R K L
Sbjct  230  EAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGKAL  269



>ref|XP_010275891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
[Nelumbo nucifera]
Length=586

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K +PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  ++KMN +D
Sbjct  374  RDKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNVVTYGTLIKGYAKMNNLD  433

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            ++++  ++++    + ++ ++ + ++A
Sbjct  434  KMMEKYEEMRIQGIEANQTIFTTIMDA  460



>gb|AIU48553.1| tetratricopeptide repeat-like superfamily protein, partial [Chimonanthus 
praecox]
Length=470

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  ++KMN ++
Sbjct  337  RDKFSPDLCSYTTMLSAYVNASDMEGAEKFFRRIKQDGFEPNIVTYGTLMKGYAKMNNLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            +++ + Q+++    K ++ ++ + ++A
Sbjct  397  KMMGVYQEMRMKGIKANQTIFTTIMDA  423



>ref|XP_004502213.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic-like [Cicer arietinum]
Length=669

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 52/101 (51%), Gaps = 1/101 (1%)
 Frame = -2

Query  548  RRKVVPDRV-SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  372
            +RK VP  V +Y ++IS Y K+ E E      Q+ +  G + +      ++ ++ K  K+
Sbjct  383  QRKGVPQNVVTYNTMISIYGKSLEHEKATNLIQEMQSRGVQPNAITYSTIISIWEKAGKL  442

Query  371  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            D    L   L++   K+D+ LY++ + A + AGL   AK L
Sbjct  443  DRAAMLFHKLRSSGVKIDDVLYQTMIVAYQKAGLVAHAKRL  483



>gb|AIU48545.1| tetratricopeptide repeat-like superfamily protein, partial [Capsella 
rubella]
Length=470

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K+N V+
Sbjct  337  RDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNVVTYGTMIKGYAKVNDVE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            +++++ + ++    K ++ +  + ++A
Sbjct  397  KMMEVYEKMRLSGIKANQTILTTIMDA  423



>ref|XP_010527103.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, 
chloroplastic-like [Tarenaya hassleriana]
Length=851

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+ ++P+ ++YT+VI AY KA + E  ++ +   + +G   +      ++G+  K ++ D
Sbjct  408  RKGIMPNAITYTTVIDAYGKAGKEEEALRLFYGMQESGCVPNTCTYNAVLGMLGKKSRSD  467

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLE  267
            E++K+L+D+K++    +   + + L    + G+ 
Sbjct  468  EMIKILRDMKSNGCSPNRITWNTMLAMCGNKGMH  501



>gb|AIU48551.1| tetratricopeptide repeat-like superfamily protein, partial [Chloranthus 
japonicus]
Length=470

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 72/137 (53%), Gaps = 13/137 (9%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K  PD  SYT+++SAY  A ++E   K+++  K +G K +    G ++  ++K N + 
Sbjct  337  RDKFTPDLCSYTTMLSAYVNAPDMEGAEKFFRRLKQDGFKPNVVTYGTLLKGYAKANNLV  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAK-KK  192
            +++++ ++++    + ++ ++ + ++A           W +E       + +C  A  +K
Sbjct  397  KMMEIYEEMRMQGIEANQTIFTTIMDAHGKNDFGSAVVWFKE-------METCGFAPDQK  449

Query  191  PKNIVNTRWRISLSETL  141
             KNI+     +SL++T+
Sbjct  450  AKNIL-----LSLAQTV  461



>ref|XP_004970460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, 
chloroplastic-like [Setaria italica]
Length=660

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            V P+ V+Y ++I+ Y K+ E E      QD + NG + +      ++ ++ K  K+D   
Sbjct  377  VKPNVVTYNTMIAIYGKSLEDEKAGSLVQDMQANGVQPNAITYSTILSIWVKAGKLDRAA  436

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            KL + L+   T++D  LY++ + A   AGL  +AK L
Sbjct  437  KLFEKLREAGTEIDPVLYQTMVVAYERAGLVSQAKRL  473



>ref|XP_009414726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, 
mitochondrial isoform X2 [Musa acuminata subsp. malaccensis]
Length=486

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (49%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R++  PD  +YT ++  +   ++L S    + +    G K D    GI++  F K  + D
Sbjct  197  RKRFTPDLKTYTILLEGWGHVRDLSSLKAVFHEMIDEGFKPDVVTYGILINAFCKSGRCD  256

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            + VK+  +++ +  K    +Y S +N L
Sbjct  257  DAVKIFHEMEANNCKPSPHIYCSLINGL  284



>gb|KHM99248.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=212

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            RK+VPD V+Y ++I    K   +E  ++ + D K +G   +R   G  V  +  +N++D+
Sbjct  52   RKLVPDVVTYNALIDGCCKTLRMERALELFDDMKRSGVVPNRVTYGCFVSYYCAVNEIDK  111

Query  365  LVKLLQDL-KTDETKLDERLYRSALNALRDAGLEIRA  258
             V++L+++ +  +      LY   ++AL +AG  + A
Sbjct  112  GVEMLREMQRLGDGVASSSLYTPIIHALCEAGRVVEA  148



>ref|XP_002456587.1| hypothetical protein SORBIDRAFT_03g038900 [Sorghum bicolor]
 gb|EES01707.1| hypothetical protein SORBIDRAFT_03g038900 [Sorghum bicolor]
Length=655

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            V P+ V+Y ++I+ Y K+ E E   K  QD +  G + D      ++ ++ K  K+D   
Sbjct  372  VKPNVVTYNTMIAIYGKSLEDEKAGKLVQDMQAIGVQPDAITYSTILSIWVKAGKLDRAA  431

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
            KL + L+   T++D  LY++ + A   AGL  +AK L
Sbjct  432  KLFEKLREAGTEIDPVLYQTMVVAYERAGLVSQAKRL  468



>ref|XP_006290805.1| hypothetical protein CARUB_v10016912mg [Capsella rubella]
 gb|EOA23703.1| hypothetical protein CARUB_v10016912mg [Capsella rubella]
Length=586

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K+N V+
Sbjct  377  RDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNVVTYGTMIKGYAKVNDVE  436

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            +++++ + ++    K ++ +  + ++A
Sbjct  437  KMMEVYEKMRLSGIKANQTILTTIMDA  463



>gb|AIU48560.1| tetratricopeptide repeat-like superfamily protein, partial [Erythranthe 
guttata]
Length=470

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 68/135 (50%), Gaps = 11/135 (8%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A +++   K+++  K +G + +    G ++  ++K N ++
Sbjct  337  RDRCTPDLFSYTTMLSAYVNASDMDGAEKFFKRIKTDGFEPNVVTHGTLIKGYAKANDLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKP  189
            ++++  + ++ D  K +  ++ + ++A           W  E       + S  S  +K 
Sbjct  397  KMLEKYESMRVDGIKPNPTIFTTIMDAFGKNDFGSAVIWFNEM------VSSGVSPDQKA  450

Query  188  KNIVNTRWRISLSET  144
            KNI+     +SL++T
Sbjct  451  KNIL-----LSLAKT  460



>ref|XP_006447383.1| hypothetical protein CICLE_v10016159mg [Citrus clementina]
 gb|ESR60623.1| hypothetical protein CICLE_v10016159mg [Citrus clementina]
 gb|KDO55773.1| hypothetical protein CISIN_1g016395mg [Citrus sinensis]
Length=287

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            VVPD +SY ++++   K + L+ C+ Y+++   +G K D      ++  F +   ++E +
Sbjct  169  VVPDFISYNTLLNNLRKIRRLDLCLIYFREMGESGIKPDLLTYTALIDSFGRTGNIEESL  228

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG  273
            +L  D+K  + +    +YRS ++ L+  G
Sbjct  229  RLFNDMKQQQIRPSIYVYRSLIDNLKKMG  257



>gb|AIU48549.1| tetratricopeptide repeat-like superfamily protein, partial [Buxus 
sinica]
Length=470

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/125 (21%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K  PD  SYT+++SAY  A +++   ++++  K +G + +    G ++  ++K+  ++
Sbjct  337  RDKCTPDLCSYTTMLSAYVNASDMDGAEQFFKRLKQDGFQPNVVTYGTLIKGYAKLKNLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCN-SAKKK  192
            +++++ +++  +  K ++ ++ + ++A           W QE       + SC     +K
Sbjct  397  KMMEIYEEMLAEGIKANQTIFTTIMDAHGKNEFGSAVHWFQE-------MGSCGFPPDQK  449

Query  191  PKNIV  177
             KNI+
Sbjct  450  AKNIL  454



>ref|XP_010438517.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 
[Camelina sativa]
Length=714

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD VSY +VI    + KELE  ++   + + +G        GI++  F K  K++E +
Sbjct  174  LMPDVVSYNTVIRGLCEGKELEKGLQLANEMQGSGCSWSLVTWGILINAFCKAGKMEEAI  233

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG  273
             LL+++K    + D  +Y S +    D G
Sbjct  234  GLLEEMKRMGLEADLVVYTSLIRGFCDCG  262



>ref|XP_009379032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Pyrus x bretschneideri]
 ref|XP_009379037.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Pyrus x bretschneideri]
Length=733

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 50/98 (51%), Gaps = 0/98 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSY  +I+   + K L+   +   D +L+G + +      ++  F K  +VD
Sbjct  171  RNYVTPDIVSYNILINGLCRVKNLKEATELLVDMELSGSEPNVTTYSTLINGFCKDGRVD  230

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  255
            E + LL++LK    + D  +Y + ++A  D G   RAK
Sbjct  231  EAMGLLEELKQKGLEADVVVYSTIISAFCDKGSFDRAK  268



>gb|AIU48532.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis 
lyrata]
Length=470

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K N V+
Sbjct  337  RDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTMIKGYAKANDVE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            +++++ + ++    K ++ +  + ++A
Sbjct  397  KMMEVYEKMRLSGIKANQTILTTIMDA  423



>gb|KDO55772.1| hypothetical protein CISIN_1g016395mg [Citrus sinensis]
Length=390

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            VVPD +SY ++++   K + L+ C+ Y+++   +G K D      ++  F +   ++E +
Sbjct  272  VVPDFISYNTLLNNLRKIRRLDLCLIYFREMGESGIKPDLLTYTALIDSFGRTGNIEESL  331

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG  273
            +L  D+K  + +    +YRS ++ L+  G
Sbjct  332  RLFNDMKQQQIRPSIYVYRSLIDNLKKMG  360



>gb|EPS66249.1| hypothetical protein M569_08528 [Genlisea aurea]
Length=702

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            R + PD  +Y+S+I  ++    L+    YY+D +L G K D+ +  I++G   K   V +
Sbjct  347  RGLAPDLFTYSSIIGIFAGIGNLDRMKSYYEDMQLRGLKPDKIIFTILIGGLCKYGSVSD  406

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      +D   Y S LN L
Sbjct  407  AMKMHDEMAKHGCVIDVVAYNSLLNGL  433



>ref|XP_006469838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900-like 
isoform X1 [Citrus sinensis]
Length=390

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            VVPD +SY ++++   K + L+ C+ Y+++   +G K D      ++  F +   ++E +
Sbjct  272  VVPDFISYNTLLNNLRKIRRLDLCLIYFREMGESGIKPDLLTYTALIDSFGRTGNIEESL  331

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG  273
            +L  D+K  + +    +YRS ++ L+  G
Sbjct  332  RLFNDMKQQQIRPSIYVYRSLIDNLKKMG  360



>gb|EYU33512.1| hypothetical protein MIMGU_mgv1a023422mg, partial [Erythranthe 
guttata]
Length=732

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/97 (26%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            VVP+R+ YT+ +  Y KAK ++  +K  +  K N  + D  + G ++     + + D++ 
Sbjct  454  VVPNRIMYTAFMHGYLKAKRIDDAMKILEIMKDNNIRPDLVLYGTIIWGLCNVGRFDDVN  513

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
             LL ++K    ++ E +Y + +++   AG  + A+ L
Sbjct  514  ALLDEMKEHNVEVSEVIYTALIDSYFKAGKNVEARNL  550



>gb|AIU48547.1| tetratricopeptide repeat-like superfamily protein, partial [Eucalyptus 
grandis]
Length=470

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/102 (21%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R + +PD  SYT+++SAY  A +++   K+++  K +G   +    G M+  ++++NK++
Sbjct  337  RDRYMPDLCSYTTMLSAYVNASDMDGAEKFFRRLKQDGFDPNVVTYGTMIKGYARVNKLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  243
            +++++ ++++    K ++ ++ + ++A      +    W +E
Sbjct  397  KMMEVYEEMRLRGIKANQTVFTTIMDAYGKNDFDSALVWFKE  438



>ref|XP_002878256.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54515.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=582

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G M+  ++K N V+
Sbjct  377  RDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTMIKGYAKANDVE  436

Query  368  ELVKLLQDLKTDETKLDERLYRSALNA  288
            +++++ + ++    K ++ +  + ++A
Sbjct  437  KMMEVYEKMRLSGIKANQTILTTIMDA  463



>gb|AHC02098.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
polygalifolia]
Length=436

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+ +V + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D
Sbjct  218  RKNIVQNVVTYNSMIMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLD  277

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
                L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  278  RAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317



>ref|XP_010259875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, 
mitochondrial [Nelumbo nucifera]
Length=656

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 49/105 (47%), Gaps = 4/105 (4%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            + ++ D V Y  V SA  K K++      Y+  K +G   D     IM+  F +  +VDE
Sbjct  441  KGIIIDTVMYNIVFSALGKLKQISHIHDLYEKMKKDGPSPDIFTYNIMISSFGRAGRVDE  500

Query  365  LVKLLQDLKTDETKLDERLYRSALNALRDAG----LEIRAKWLQE  243
             V+L ++++    K D   Y S +N L   G      +R K +QE
Sbjct  501  AVRLFEEMENSTCKPDVITYNSLINYLGKNGDLDEAHMRFKEMQE  545



>ref|XP_004295757.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At1g12700, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=603

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R+ +VPD ++Y+S+I  + KA  L+   K + +   +G   D     I++       ++ 
Sbjct  394  RKGIVPDTITYSSLIDGFCKAGRLQEAEKLFSEMPSSGQLADVQTYNIILDGLCNNQQLS  453

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAG  273
            E ++LL++++ ++ KLD   Y   + AL +AG
Sbjct  454  EAIELLREMEGNKLKLDVVAYNIIIEALFNAG  485



>gb|AIU48541.1| tetratricopeptide repeat-like superfamily protein, partial [Sarcandra 
glabra]
Length=470

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 70/137 (51%), Gaps = 13/137 (9%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R K  PD  SYT+++SAY  A ++E   K+++  K +G K +    GI++  ++  N + 
Sbjct  337  RDKFTPDLCSYTTMLSAYVNAPDMEGAEKFFRRLKQDGFKPNVVTYGILMKGYAMANNLV  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAK-KK  192
             L+++ ++++    + +  ++ + ++A           W +E       + +C  A  +K
Sbjct  397  RLMEIYEEMRMQGIEANLTIFTTIMDAHGKNDFGSAVTWFKE-------METCGFAPDQK  449

Query  191  PKNIVNTRWRISLSETL  141
             KNI+     +SL++T+
Sbjct  450  AKNIL-----LSLAQTV  461



>ref|XP_003621600.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES77818.1| PPR containing plant protein [Medicago truncatula]
Length=890

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/97 (26%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            ++V P+ V+Y++++  Y+KA  LE  +  Y++ KL     DR     +VG++ K+  +DE
Sbjct  383  KRVWPNVVTYSAMMDGYAKANLLEDALNLYEEMKLRSVCLDRVSYNTLVGIYEKLGNLDE  442

Query  365  LVKLLQDLKTDETKLDERLYRSALNALRDAGL--EIR  261
             ++  ++++      D   Y + L+     G+  E+R
Sbjct  443  AIEKCKEMERSGINRDVVTYNALLSGYGKHGMYDEVR  479



>ref|XP_010673744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=733

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSYTS+I+ +S+ K L+  + ++ D K  G   D  +  I++  F K   V 
Sbjct  374  RLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVS  433

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y S LN +
Sbjct  434  EALRMRNEMLEKGCLMDVVTYNSILNGM  461



>gb|AIU48562.1| tetratricopeptide repeat-like superfamily protein, partial [Solanum 
tuberosum]
Length=470

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/135 (23%), Positives = 69/135 (51%), Gaps = 11/135 (8%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  ++K N ++
Sbjct  337  RDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRIKQDGLEPNVVTYGTLIKGYAKTNDLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCNSAKKKP  189
            ++++  +D++    K ++ ++ + ++A           W  E  +      S  S  +K 
Sbjct  397  KMMEKYEDMRVHGIKANQTIFTTIMDAYGRNDFGSAVAWFNEMAS------SGVSPDQKA  450

Query  188  KNIVNTRWRISLSET  144
            KNI+     +SL++T
Sbjct  451  KNIL-----LSLAKT  460



>ref|XP_010673748.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X4 [Beta vulgaris subsp. vulgaris]
Length=538

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSYTS+I+ +S+ K L+  + ++ D K  G   D  +  I++  F K   V 
Sbjct  179  RLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVS  238

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y S LN +
Sbjct  239  EALRMRNEMLEKGCLMDVVTYNSILNGM  266



>ref|XP_010673747.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=637

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSYTS+I+ +S+ K L+  + ++ D K  G   D  +  I++  F K   V 
Sbjct  278  RLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVS  337

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y S LN +
Sbjct  338  EALRMRNEMLEKGCLMDVVTYNSILNGM  365



>ref|XP_010673746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=685

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSYTS+I+ +S+ K L+  + ++ D K  G   D  +  I++  F K   V 
Sbjct  326  RLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVS  385

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y S LN +
Sbjct  386  EALRMRNEMLEKGCLMDVVTYNSILNGM  413



>gb|AIU48544.1| tetratricopeptide repeat-like superfamily protein, partial [Carica 
papaya]
Length=402

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/102 (22%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E   K+ +  K +G K +    G ++  ++K+N + 
Sbjct  269  RDRCTPDLCSYTTMLSAYVNASDMEGAEKFLKRMKQDGFKPNIVTYGTLIKGYAKLNNLQ  328

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  243
            +++++   ++    K+++ ++ + ++A           W +E
Sbjct  329  KMMEIYDQIRVSGLKVNQTVFTTIMDAFGKNDFASAVVWYKE  370



>ref|XP_006842614.1| hypothetical protein AMTR_s00077p00176610 [Amborella trichopoda]
 gb|ERN04289.1| hypothetical protein AMTR_s00077p00176610 [Amborella trichopoda]
Length=738

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            ++ +  + V+Y ++I  Y K+ E E      Q+ +  G + D      ++ ++ K  K+D
Sbjct  457  KKGIEQNVVTYNTMIGIYGKSLEHEKASNLVQEMQGRGIEPDALTYSTIISIWEKAGKLD  516

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
               +L Q L++   K+D+ LY++ + A   AGL   AK L
Sbjct  517  RAARLFQKLRSSGAKIDQVLYQTMIVAYEKAGLVGHAKRL  556



>ref|XP_010673749.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X5 [Beta vulgaris subsp. vulgaris]
Length=528

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R  V PD VSYTS+I+ +S+ K L+  + ++ D K  G   D  +  I++  F K   V 
Sbjct  169  RLGVAPDIVSYTSLINMFSRNKHLDRALMHFNDMKSKGLAPDSVIYTILIDGFCKSGVVS  228

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL  285
            E +++  ++      +D   Y S LN +
Sbjct  229  EALRMRNEMLEKGCLMDVVTYNSILNGM  256



>gb|KDP43170.1| hypothetical protein JCGZ_22722 [Jatropha curcas]
Length=363

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD +SY ++++   KA  LE C+ Y ++   +G + D      ++    ++ K++E +
Sbjct  244  IIPDFISYNTLLNHLQKAGRLELCLVYIKEMGESGIEPDLLTYTALIHGLGRLGKIEESL  303

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +L  ++K  +      +YRS +N+ +  G +E+    L+E
Sbjct  304  RLFSEMKMKQVHPSIYIYRSLINSSKKMGKMELAMALLEE  343



>ref|XP_008464651.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X2 [Cucumis melo]
Length=500

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 74/137 (54%), Gaps = 14/137 (10%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  ++K+N ++
Sbjct  296  RDRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKGYAKINNLE  355

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*IISCN-SAKK  195
            +++K  +++K +  ++++ +  + ++A  ++   +    W +E       I SC     +
Sbjct  356  KMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKE-------IESCGLRPDQ  408

Query  194  KPKNIVNTRWRISLSET  144
            K KNI+     +SL++T
Sbjct  409  KAKNIL-----LSLAKT  420



>ref|XP_006357891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like 
[Solanum tuberosum]
Length=576

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 71/136 (52%), Gaps = 12/136 (9%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E   K+++  K +G + +    G ++  ++K N ++
Sbjct  379  RDRCSPDLCSYTTMLSAYINASDMEGAEKFFRRIKQDGLEPNVVTYGTLIKGYAKTNDLE  438

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*IISCNSAKKK  192
            ++++  +D++    K ++ ++ + ++A  R+        W  E  +      S  S  +K
Sbjct  439  KMMEKYEDMRVHGIKANQTIFTTIMDAYGRNKDFGSAVAWFNEMAS------SGVSPDQK  492

Query  191  PKNIVNTRWRISLSET  144
             KNI+     +SL++T
Sbjct  493  AKNIL-----LSLAKT  503



>gb|AIU48578.1| tetratricopeptide repeat-like superfamily protein, partial [Platanus 
x acerifolia]
Length=470

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 70/136 (51%), Gaps = 13/136 (10%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  ++K+N ++
Sbjct  337  RDRFTPDLCSYTTMLSAYVNASDMEGAEMFFRRLKQDGFEPNVVTYGTLIKGYAKVNNLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCN-SAKKK  192
            ++++  ++++    K ++ ++ + ++A           W +E       + SC     +K
Sbjct  397  KMMEKYEEMRVQGIKANQTIFTTIMDAYGKNDFGTAVIWFKE-------MGSCGFPPDQK  449

Query  191  PKNIVNTRWRISLSET  144
             KNI+     +SL++T
Sbjct  450  AKNIL-----LSLAKT  460



>ref|XP_003601624.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES71875.1| PPR containing plant-like protein [Medicago truncatula]
Length=684

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 50/99 (51%), Gaps = 1/99 (1%)
 Frame = -2

Query  542  KVVPDRV-SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            K VP  V +Y ++IS Y K+ E +      Q+ +  G + +      ++ ++ K  K+D 
Sbjct  400  KGVPQNVVTYNTMISIYGKSLEHDKATNLIQEMQSRGIQPNAITYSTIISIWEKAGKLDR  459

Query  365  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  249
               L   L+T   K+DE LY++ + A + AGL   AK L
Sbjct  460  AAMLFHKLRTSGVKIDEILYQTMIVAYQKAGLVAHAKRL  498



>gb|EYU42850.1| hypothetical protein MIMGU_mgv1a0029291mg, partial [Erythranthe 
guttata]
Length=424

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 72/138 (52%), Gaps = 16/138 (12%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A +++   K+++  K +G + +    G ++  ++K N ++
Sbjct  185  RDRCTPDLFSYTTMLSAYVNASDMDGAEKFFKRIKTDGFEPNVVTHGTLIKGYAKANDLE  244

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL---RDAGLEIRAKWLQESFAVAT*IISCNSAK  198
            ++++  + ++ D  K +  ++ + ++A    +D G  +   W  E       + S  S  
Sbjct  245  KMLEKYESMRVDGIKPNPTIFTTIMDAFGKNKDFGSAVI--WFNEM------VSSGVSPD  296

Query  197  KKPKNIVNTRWRISLSET  144
            +K KNI+     +SL++T
Sbjct  297  QKAKNIL-----LSLAKT  309



>ref|XP_008464650.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
isoform X1 [Cucumis melo]
Length=580

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 74/137 (54%), Gaps = 14/137 (10%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E    +++  K +G + +    G ++  ++K+N ++
Sbjct  376  RDRCNPDICSYTTMLSAYVNASDMEGAETFFRRLKQDGFRPNVVTYGTLIKGYAKINNLE  435

Query  368  ELVKLLQDLKTDETKLDERLYRSALNAL-RDAGLEIRAKWLQESFAVAT*IISCN-SAKK  195
            +++K  +++K +  ++++ +  + ++A  ++   +    W +E       I SC     +
Sbjct  436  KMIKRYEEMKVNGIRVNQTILTTIMDAYGKNKDFDSAVIWFKE-------IESCGLRPDQ  488

Query  194  KPKNIVNTRWRISLSET  144
            K KNI+     +SL++T
Sbjct  489  KAKNIL-----LSLAKT  500



>emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera]
Length=850

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            + VVPD VS++++I   SK   L+  +KY++D K  G   D  +  I++G F +   + E
Sbjct  492  QGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSE  551

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL  285
             +K+  ++      LD   Y + LN L
Sbjct  552  ALKVRDEMLEQGCXLDVVTYNTILNGL  578



>gb|AIU48542.1| tetratricopeptide repeat-like superfamily protein, partial [Citrus 
clementina]
 gb|AIU48546.1| tetratricopeptide repeat-like superfamily protein, partial [Citrus 
sinensis]
Length=470

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 71/136 (52%), Gaps = 13/136 (10%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R +  PD  SYT+++SAY  A ++E   K+++  K +G   +    G ++  ++K+N ++
Sbjct  337  RDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCN-SAKKK  192
            +++++   ++ +  K ++ ++ + ++A      +    W +E       + SC     +K
Sbjct  397  KMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNDFDSAVVWYKE-------MESCGFPPDQK  449

Query  191  PKNIVNTRWRISLSET  144
             KNI+     +SL++T
Sbjct  450  AKNIL-----LSLAKT  460



>ref|XP_002299968.2| hypothetical protein POPTR_0001s27990g, partial [Populus trichocarpa]
 gb|EEE84773.2| hypothetical protein POPTR_0001s27990g, partial [Populus trichocarpa]
Length=348

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            ++PD +SY ++++   K   L+ C  Y +D   +G + D      ++G F +   ++E +
Sbjct  230  ILPDFISYNTLLNQLRKVGRLDLCSVYSRDMVESGIEPDLLTYTALIGSFGQSGNIEESL  289

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAG-LEIRAKWLQE  243
            +L  ++KT + +    +YRS + +L+  G +E+    L+E
Sbjct  290  RLFNEMKTKQIRPSIYIYRSLIASLKKMGKVELAMTLLEE  329



>gb|AHX42011.1| pentatricopeptide repeat-containing protein 11, partial [Campanula 
laciniata]
 gb|AHX42012.1| pentatricopeptide repeat-containing protein 11, partial [Campanula 
laciniata]
Length=268

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 5/108 (5%)
 Frame = -2

Query  545  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  366
            + +VP+ V YT++++ + K+  +   V+ Y+   + G K D  M   ++ V  K   + E
Sbjct  153  KGLVPNDVIYTTLLNGFCKSGNVSLAVELYRRMLMKGVKPDLIMYNTLINVLCKSGSLTE  212

Query  365  LVKLLQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESF  237
               L++++ T+  K D+  Y + ++        DA  EIR K ++E  
Sbjct  213  ARNLIEEMSTNGLKADKITYTTLIDGCCKEGNLDAAFEIRKKMMREGI  260



>ref|XP_006656582.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, 
mitochondrial-like [Oryza brachyantha]
Length=192

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -2

Query  539  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  360
            + PD V+YT+V++AYS   +LE   K + D   NG + D  M  +++  + +  ++ +  
Sbjct  6    ITPDVVTYTTVLTAYSGKGDLEGAQKLFDDIIANGRRPDVMMYTVLIDGYCQHGRLQDAA  65

Query  359  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  228
            +++ +++    + +E  Y   + A    G    A+ L +   VA
Sbjct  66   RIMDEMEAVGVQPNEVTYSVVIEACCKEGKSSEARDLMQEMLVA  109



>gb|AIU48533.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis 
thaliana]
Length=470

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/125 (22%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = -2

Query  548  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  369
            R ++ PD  SYT+++SAY  A ++E   K+++  K++G + +    G ++  ++K N V+
Sbjct  337  RDRIFPDLWSYTTMLSAYVNASDMEGAEKFFKRIKVDGFEPNIVTYGTLIKGYAKANDVE  396

Query  368  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT*IISCN-SAKKK  192
            +++++ + ++    K ++ +  + ++A           W +E       + SC     +K
Sbjct  397  KMMEVYEKMRLSGIKANQTILTTIMDASGRCNFGSALGWYKE-------MESCGVPPDQK  449

Query  191  PKNIV  177
             KN++
Sbjct  450  AKNVL  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720