BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041L16

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03931.1|  unnamed protein product                                230   6e-70   Coffea canephora [robusta coffee]
ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   7e-66   Nicotiana sylvestris
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    218   1e-64   Vitis vinifera
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    218   1e-64   Nicotiana tomentosiformis
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           213   1e-63   Medicago truncatula
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   2e-63   Solanum lycopersicum
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   4e-63   Solanum tuberosum [potatoes]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    213   5e-63   Citrus sinensis [apfelsine]
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           213   5e-63   Medicago truncatula
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             212   1e-62   Citrus clementina [clementine]
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             210   1e-62   
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    211   4e-62   Prunus mume [ume]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    210   8e-62   Gossypium arboreum [tree cotton]
ref|XP_007049652.1|  O-Glycosyl hydrolases family 17 protein isof...    205   3e-61   
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   5e-61   Cicer arietinum [garbanzo]
gb|KJB10880.1|  hypothetical protein B456_001G230200                    206   5e-61   Gossypium raimondii
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    206   5e-61   Ricinus communis
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   6e-61   Cucumis melo [Oriental melon]
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    209   6e-61   
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    208   6e-61   Gossypium arboreum [tree cotton]
gb|KJB10878.1|  hypothetical protein B456_001G230200                    207   1e-60   Gossypium raimondii
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    214   2e-60   
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    206   2e-60   
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       205   9e-60   Morus notabilis
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   2e-59   Nelumbo nucifera [Indian lotus]
gb|KJB84083.1|  hypothetical protein B456_N004800                       203   3e-59   Gossypium raimondii
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    203   3e-59   Cucumis sativus [cucumbers]
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    202   1e-58   
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   3e-58   Fragaria vesca subsp. vesca
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  198   7e-58   Medicago truncatula
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   2e-57   Sesamum indicum [beniseed]
dbj|BAA89481.1|  beta-1,3-glucanase                                     199   2e-57   Salix gilgiana
ref|XP_003626949.1|  Beta-1 3-glucanase                                 199   2e-57   Medicago truncatula
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             199   2e-57   Phaseolus vulgaris [French bean]
ref|XP_006386885.1|  3-glucanase family protein                         198   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   6e-57   Populus euphratica
ref|XP_007134153.1|  hypothetical protein PHAVU_010G0238001g            194   7e-57   Phaseolus vulgaris [French bean]
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         196   2e-56   Jatropha curcas
emb|CDY28063.1|  BnaC05g44650D                                          194   8e-56   Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          194   9e-56   Brassica napus [oilseed rape]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    195   1e-55   Brassica rapa
ref|XP_002303070.2|  3-glucanase family protein                         193   2e-55   
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    193   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    193   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    192   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             192   5e-55   Capsella rubella
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               192   6e-55   Arabidopsis lyrata subsp. lyrata
emb|CAK18899.1|  glucan 1,3-beta glucosidase                            184   8e-55   Cocos nucifera
emb|CDY24629.1|  BnaA05g30280D                                          192   8e-55   Brassica napus [oilseed rape]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               191   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          191   1e-54   
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    191   1e-54   Arabis alpina [alpine rockcress]
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906169.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   3e-54   Elaeis guineensis
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   3e-54   
gb|KJB10879.1|  hypothetical protein B456_001G230200                    189   5e-54   Gossypium raimondii
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             189   7e-54   Eutrema salsugineum [saltwater cress]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    189   1e-53   Populus euphratica
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   5e-53   Tarenaya hassleriana [spider flower]
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                185   2e-52   Erythranthe guttata [common monkey flower]
emb|CDY08004.1|  BnaC03g35190D                                          185   3e-52   Brassica napus [oilseed rape]
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    185   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   5e-52   Glycine max [soybeans]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             184   1e-51   
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    183   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    183   2e-51   Brassica rapa
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   2e-51   Glycine max [soybeans]
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    179   8e-51   
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    180   2e-50   
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    180   2e-50   Phoenix dactylifera
gb|ACR37660.1|  unknown                                                 174   3e-50   Zea mays [maize]
gb|ACN28576.1|  unknown                                                 174   2e-49   Zea mays [maize]
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             177   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          177   4e-49   Sorghum bicolor [broomcorn]
gb|EPS58986.1|  hypothetical protein M569_15824                         176   6e-49   Genlisea aurea
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         176   7e-49   Jatropha curcas
dbj|BAJ88052.1|  predicted protein                                      176   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002298669.2|  glucan endo-1 family protein                       175   8e-49   
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   9e-49   Brachypodium distachyon [annual false brome]
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    175   1e-48   Populus euphratica
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   3e-48   Populus euphratica
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      174   3e-48   Zea mays [maize]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   1e-47   
emb|CDO96794.1|  unnamed protein product                                172   2e-47   Coffea canephora [robusta coffee]
gb|KJB28087.1|  hypothetical protein B456_005G026800                    172   3e-47   Gossypium raimondii
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   6e-47   
emb|CBI39414.3|  unnamed protein product                                169   1e-46   Vitis vinifera
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            171   2e-46   
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    169   4e-46   Setaria italica
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    168   7e-46   Vitis vinifera
emb|CAA49515.1|  beta-1,3-glucanase homologue                           159   1e-45   Brassica napus [oilseed rape]
gb|EEC84834.1|  hypothetical protein OsI_31928                          167   2e-45   Oryza sativa Indica Group [Indian rice]
ref|NP_001063586.1|  Os09g0502200                                       167   3e-45   
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    167   3e-45   
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          166   4e-45   
dbj|BAK04571.1|  predicted protein                                      166   8e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    165   9e-45   
emb|CDX74052.1|  BnaA03g29950D                                          166   2e-44   
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           164   2e-44   Medicago truncatula
dbj|BAK05423.1|  predicted protein                                      164   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    164   4e-44   
gb|EMT13087.1|  Putative glucan endo-1,3-beta-glucosidase A6            161   5e-44   
emb|CDY50110.1|  BnaC01g43580D                                          161   2e-43   Brassica napus [oilseed rape]
emb|CDP15106.1|  unnamed protein product                                160   7e-43   Coffea canephora [robusta coffee]
emb|CDY18092.1|  BnaA01g23530D                                          160   8e-43   Brassica napus [oilseed rape]
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    160   8e-43   Brassica rapa
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    160   9e-43   
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    159   2e-42   
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    159   2e-42   Brassica rapa
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             159   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    159   2e-42   Solanum tuberosum [potatoes]
emb|CDP15107.1|  unnamed protein product                                155   4e-42   Coffea canephora [robusta coffee]
gb|KFK39673.1|  a6 anther-specific protein                              158   5e-42   Arabis alpina [alpine rockcress]
emb|CDY08310.1|  BnaA05g13090D                                          158   5e-42   Brassica napus [oilseed rape]
emb|CDY63754.1|  BnaAnng19080D                                          158   6e-42   Brassica napus [oilseed rape]
emb|CDY59775.1|  BnaCnng35540D                                          157   6e-42   Brassica napus [oilseed rape]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    157   6e-42   Brassica rapa
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   157   8e-42   Citrus sinensis [apfelsine]
emb|CDY12371.1|  BnaC08g08340D                                          157   8e-42   Brassica napus [oilseed rape]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    157   9e-42   Tarenaya hassleriana [spider flower]
emb|CAA49513.1|  beta-1,3-glucanase homologue                           157   1e-41   Brassica napus [oilseed rape]
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             156   1e-41   
emb|CDY06469.1|  BnaC06g11750D                                          157   2e-41   
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             156   3e-41   
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                156   3e-41   Erythranthe guttata [common monkey flower]
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         155   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             155   3e-41   
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               155   4e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67322.1|  BnaA03g57600D                                          150   4e-41   Brassica napus [oilseed rape]
gb|ABK28569.1|  unknown                                                 155   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB37880.1|  hypothetical protein B456_006G224700                    155   5e-41   Gossypium raimondii
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          155   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|ADE76604.1|  unknown                                                 155   6e-41   Picea sitchensis
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   1e-40   Setaria italica
gb|AAM64490.1|  beta-1,3-glucanase, putative                            154   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    154   1e-40   
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             154   1e-40   Capsella rubella
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    154   2e-40   Arabis alpina [alpine rockcress]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    154   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   2e-40   Nicotiana tomentosiformis
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             153   2e-40   
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   3e-40   Nicotiana tomentosiformis
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             152   5e-40   Eutrema salsugineum [saltwater cress]
emb|CDY27122.1|  BnaA08g07600D                                          152   6e-40   Brassica napus [oilseed rape]
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    152   6e-40   Brassica rapa
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    152   1e-39   
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    152   1e-39   Camelina sativa [gold-of-pleasure]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     150   2e-39   Eucalyptus grandis [rose gum]
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             151   2e-39   Capsella rubella
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   2e-39   Brassica rapa
emb|CDY53213.1|  BnaC03g74070D                                          150   3e-39   Brassica napus [oilseed rape]
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   3e-39   
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   4e-39   Nicotiana sylvestris
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   4e-39   Cucumis melo [Oriental melon]
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   6e-39   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   7e-39   Brassica rapa
emb|CDY01191.1|  BnaA04g06280D                                          149   8e-39   
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   9e-39   Camelina sativa [gold-of-pleasure]
ref|NP_001168659.1|  uncharacterized protein LOC100382447               147   2e-38   Zea mays [maize]
emb|CDY12732.1|  BnaC04g29090D                                          148   3e-38   Brassica napus [oilseed rape]
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    147   6e-38   Zea mays [maize]
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    146   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    145   1e-37   Zea mays [maize]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    144   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    144   9e-37   Brachypodium distachyon [annual false brome]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    141   7e-36   Tarenaya hassleriana [spider flower]
gb|EEC76518.1|  hypothetical protein OsI_14304                          132   5e-35   Oryza sativa Indica Group [Indian rice]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       134   2e-33   
gb|EEC76519.1|  hypothetical protein OsI_14305                          133   4e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001051879.1|  Os03g0845600                                       133   4e-33   
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    134   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          128   2e-31   Sorghum bicolor [broomcorn]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             127   3e-31   Brassica rapa var. perviridis [kabuna]
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             126   9e-31   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_001777261.1|  predicted protein                                  126   1e-30   
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          124   6e-30   Sorghum bicolor [broomcorn]
ref|XP_001780045.1|  predicted protein                                  124   6e-30   
dbj|BAE80092.1|  glycosyl hydrolase family 17                           121   7e-29   Silene latifolia
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              119   3e-28   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              119   3e-28   
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   1e-26   Glycine max [soybeans]
gb|KHG21190.1|  hypothetical protein F383_01641                         114   2e-26   Gossypium arboreum [tree cotton]
gb|KJB13749.1|  hypothetical protein B456_002G092600                    114   3e-26   Gossypium raimondii
gb|KJB62900.1|  hypothetical protein B456_009G442700                    112   2e-25   Gossypium raimondii
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      111   3e-25   Fragaria vesca subsp. vesca
gb|ADU15553.1|  GLU                                                     111   3e-25   Gossypium hirsutum [American cotton]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               110   5e-25   
gb|KHG04965.1|  hypothetical protein F383_30444                         110   8e-25   Gossypium arboreum [tree cotton]
ref|NP_001062294.2|  Os08g0525800                                       109   1e-24   
ref|XP_001784285.1|  predicted protein                                  109   1e-24   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            108   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07710.1|  hypothetical protein OsI_29967                          110   4e-24   Oryza sativa Indica Group [Indian rice]
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     107   5e-24   Glycine soja [wild soybean]
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   5e-24   
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             107   9e-24   Capsella rubella
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    107   1e-23   
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   1e-23   Cicer arietinum [garbanzo]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     106   1e-23   Cucumis melo [Oriental melon]
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             106   1e-23   Capsella rubella
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      106   1e-23   Sesamum indicum [beniseed]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   2e-23   Tarenaya hassleriana [spider flower]
emb|CDX92794.1|  BnaC07g40520D                                          106   2e-23   
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   2e-23   
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   2e-23   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     106   2e-23   Glycine soja [wild soybean]
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   2e-23   Citrus sinensis [apfelsine]
emb|CDY14214.1|  BnaA08g13450D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             106   2e-23   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   2e-23   Glycine max [soybeans]
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               105   2e-23   
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      106   2e-23   Prunus mume [ume]
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   3e-23   Glycine max [soybeans]
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             105   3e-23   Prunus persica
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            104   4e-23   Glycine soja [wild soybean]
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     105   4e-23   Brassica rapa
gb|ABR16205.1|  unknown                                                 105   4e-23   Picea sitchensis
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    105   6e-23   
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    104   8e-23   Arabis alpina [alpine rockcress]
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    104   8e-23   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   8e-23   Cucumis sativus [cucumbers]
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   9e-23   Sesamum indicum [beniseed]
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    104   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   1e-22   Cucumis sativus [cucumbers]
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             104   1e-22   Selaginella moellendorffii
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             103   1e-22   Selaginella moellendorffii
ref|XP_006849034.1|  hypothetical protein AMTR_s00028p00159770        99.0    1e-22   
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 104   1e-22   Morus notabilis
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             103   2e-22   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               103   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAL77689.1|  AT5g55180/MCO15_13                                      103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            103   2e-22   
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     103   2e-22   Populus euphratica
gb|KHG21189.1|  hypothetical protein F383_01641                         103   2e-22   Gossypium arboreum [tree cotton]
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             103   2e-22   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   103   2e-22   Medicago truncatula
ref|XP_006661539.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  97.8    2e-22   
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     103   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-22   Nicotiana tomentosiformis
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    103   3e-22   
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-22   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                102   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      103   4e-22   Brassica rapa
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             102   5e-22   
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     102   5e-22   Tarenaya hassleriana [spider flower]
emb|CDP14397.1|  unnamed protein product                                102   5e-22   Coffea canephora [robusta coffee]
ref|XP_004504425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.4    6e-22   Cicer arietinum [garbanzo]
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     102   6e-22   Cucumis melo [Oriental melon]
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        102   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   7e-22   Eucalyptus grandis [rose gum]
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   7e-22   Cucumis sativus [cucumbers]
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             102   7e-22   Citrus clementina [clementine]
emb|CDY46679.1|  BnaA03g48290D                                          101   7e-22   Brassica napus [oilseed rape]
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                102   7e-22   Erythranthe guttata [common monkey flower]
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    102   8e-22   
ref|XP_009392476.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  99.0    8e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     101   8e-22   Populus euphratica
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     102   8e-22   Cucumis melo [Oriental melon]
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     101   9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   101   1e-21   Medicago truncatula
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             101   1e-21   Phaseolus vulgaris [French bean]
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     101   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_009379327.1|  PREDICTED: formin-like protein 13                  100   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    101   1e-21   Solanum tuberosum [potatoes]
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        100   1e-21   
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        100   2e-21   
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   2e-21   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   2e-21   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             100   2e-21   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      101   2e-21   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    100   2e-21   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    101   2e-21   
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   2e-21   
emb|CDY12009.1|  BnaC03g14350D                                          100   2e-21   
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     100   2e-21   
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    100   2e-21   
dbj|BAF01977.1|  putative beta-1,3-glucanase                          99.4    2e-21   
emb|CDP16794.1|  unnamed protein product                                100   2e-21   
ref|XP_008361434.1|  PREDICTED: uncharacterized protein LOC103425141  99.8    2e-21   
gb|KHG04722.1|  hypothetical protein F383_29074                         100   3e-21   
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   3e-21   
emb|CDP13790.1|  unnamed protein product                                101   3e-21   
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             100   3e-21   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     100   4e-21   
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     100   4e-21   
gb|EEC83912.1|  hypothetical protein OsI_29966                        96.7    4e-21   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         100   4e-21   
gb|AFK37243.1|  unknown                                                 100   4e-21   
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   4e-21   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds      99.8    5e-21   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280           99.8    5e-21   
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   5e-21   
ref|XP_010092491.1|  hypothetical protein L484_019250                 97.8    5e-21   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.4    6e-21   
ref|XP_010907602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1    94.4    6e-21   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    100   6e-21   
gb|KHG18393.1|  hypothetical protein F383_22096                       99.8    6e-21   
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   99.8    6e-21   
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   6e-21   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.4    6e-21   
ref|XP_008809867.1|  PREDICTED: extensin isoform X2                   97.1    7e-21   
gb|KDP39185.1|  hypothetical protein JCGZ_00942                       99.4    7e-21   
ref|XP_004491338.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.4    7e-21   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                       99.0    8e-21   
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.4    8e-21   
ref|XP_006858991.1|  hypothetical protein AMTR_s00068p00134210        99.4    8e-21   
emb|CDY19908.1|  BnaC09g31740D                                        99.0    9e-21   
gb|KDP22732.1|  hypothetical protein JCGZ_02520                       95.1    9e-21   
ref|XP_008229628.1|  PREDICTED: proline-rich receptor-like protei...  97.4    9e-21   
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein             99.0    9e-21   
ref|XP_002520569.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  96.7    1e-20   
ref|XP_002975447.1|  hypothetical protein SELMODRAFT_103293           93.6    1e-20   
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.0    1e-20   
ref|XP_004500462.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  94.4    1e-20   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  99.0    1e-20   
ref|XP_006575649.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    1e-20   
ref|XP_007217381.1|  hypothetical protein PRUPE_ppa024492mg           95.9    1e-20   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.6    1e-20   
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  99.0    1e-20   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g           98.2    1e-20   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   98.6    1e-20   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein      98.6    1e-20   
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                    99.0    1e-20   
gb|KJB23365.1|  hypothetical protein B456_004G094500                  98.6    1e-20   
emb|CDY36734.1|  BnaA03g11520D                                        98.2    2e-20   
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   98.6    2e-20   
ref|XP_006279725.1|  hypothetical protein CARUB_v10027495mg           97.4    2e-20   
gb|KHN38331.1|  Glucan endo-1,3-beta-glucosidase 1                    97.1    2e-20   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.6    2e-20   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.2    2e-20   
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.2    2e-20   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein      98.2    2e-20   
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    98.6    2e-20   
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...  97.4    2e-20   
ref|XP_001781801.1|  predicted protein                                97.8    2e-20   
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440        98.2    2e-20   
ref|XP_011082909.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.9    2e-20   
ref|XP_009407040.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  94.7    2e-20   
ref|XP_004504426.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  92.8    2e-20   
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.2    2e-20   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.8    2e-20   
ref|NP_201547.1|  O-Glycosyl hydrolases family 17 protein             96.7    2e-20   
emb|CDP05678.1|  unnamed protein product                              97.8    2e-20   
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.1    3e-20   
ref|XP_010484493.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    3e-20   
gb|EPS73917.1|  hypothetical protein M569_00835                       97.4    3e-20   
gb|KHG11646.1|  hypothetical protein F383_12119                       95.5    3e-20   
ref|XP_009397186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.2    3e-20   
ref|XP_004504427.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  92.4    3e-20   
ref|XP_002865000.1|  glycosyl hydrolase family protein 17             96.7    3e-20   
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   97.8    3e-20   
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   97.4    3e-20   
ref|XP_010464009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    3e-20   
ref|XP_008792567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.1    3e-20   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.4    3e-20   
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                97.8    3e-20   
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    97.8    3e-20   
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.4    3e-20   
ref|XP_009388881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.8    3e-20   
ref|XP_006481384.1|  PREDICTED: proline-rich receptor-like protei...  95.9    4e-20   
emb|CDY62033.1|  BnaC03g77660D                                        97.8    4e-20   
ref|XP_010444643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    4e-20   
gb|EPS59841.1|  hypothetical protein M569_14964                       97.1    4e-20   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...  97.4    4e-20   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   97.1    4e-20   
gb|KHG05496.1|  hypothetical protein F383_30989                       97.1    4e-20   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg           97.1    4e-20   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.4    4e-20   
ref|XP_007156489.1|  hypothetical protein PHAVU_003G290300g           92.0    4e-20   
ref|XP_001761806.1|  predicted protein                                97.1    4e-20   
ref|XP_004976780.1|  PREDICTED: proline-rich proteoglycan 2-like      95.9    5e-20   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    5e-20   
emb|CDP04414.1|  unnamed protein product                              98.6    5e-20   
ref|XP_010679624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   95.9    5e-20   
gb|KJB27172.1|  hypothetical protein B456_004G282300                  97.1    5e-20   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   96.7    5e-20   
ref|XP_001772420.1|  predicted protein                                97.4    5e-20   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein             96.7    6e-20   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    6e-20   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871            96.3    6e-20   
ref|XP_006855690.1|  hypothetical protein AMTR_s00044p00136030        94.0    6e-20   
emb|CDY20780.1|  BnaA02g09200D                                        96.3    6e-20   
ref|XP_011099365.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   95.9    6e-20   
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...  96.7    6e-20   
ref|XP_006393950.1|  hypothetical protein EUTSA_v10004376mg           95.5    6e-20   
ref|XP_008349221.1|  PREDICTED: extensin-like                         95.1    7e-20   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479            96.3    7e-20   
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg              97.1    7e-20   
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.1    7e-20   
emb|CDY06601.1|  BnaC02g13250D                                        96.3    7e-20   
gb|AAZ40342.1|  beta-1,3-glucanase 2                                  96.3    7e-20   
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    7e-20   
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.1    7e-20   
ref|XP_009771299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    7e-20   
ref|XP_010905646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    7e-20   
gb|ACU22745.1|  unknown                                               93.6    8e-20   
ref|XP_008238064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   96.3    8e-20   
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    8e-20   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    8e-20   
ref|XP_009589790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    9e-20   
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    9e-20   
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   96.3    9e-20   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg           95.9    9e-20   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   96.7    9e-20   
emb|CDY17308.1|  BnaA10g09420D                                        95.9    9e-20   
gb|KJB10704.1|  hypothetical protein B456_001G216900                  94.7    1e-19   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg           95.9    1e-19   
ref|XP_003539283.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    1e-19   
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    1e-19   
ref|XP_006595754.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.0    1e-19   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   96.7    1e-19   
gb|KHN12992.1|  Glucan endo-1,3-beta-glucosidase 13                   95.1    1e-19   
gb|ACN39797.1|  unknown                                               95.9    1e-19   
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    1e-19   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    1e-19   
ref|XP_006369883.1|  hypothetical protein POPTR_0001s34420g           94.4    1e-19   
ref|XP_006849035.1|  hypothetical protein AMTR_s00028p00160540        90.9    1e-19   
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.9    1e-19   
ref|XP_008380145.1|  PREDICTED: vegetative cell wall protein gp1-...  94.0    1e-19   
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    1e-19   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4    95.9    1e-19   
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    1e-19   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg           95.5    1e-19   
ref|XP_006358731.1|  PREDICTED: sulfated surface glycoprotein 185...  94.0    1e-19   
gb|KJB54309.1|  hypothetical protein B456_009G028300                  95.5    1e-19   
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    2e-19   
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   96.3    2e-19   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    2e-19   
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein             95.9    2e-19   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg           94.7    2e-19   
ref|XP_008787178.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    2e-19   
gb|EPS68573.1|  hypothetical protein M569_06194                       94.7    2e-19   
ref|XP_008787177.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.0    2e-19   
ref|XP_010684179.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    2e-19   
ref|XP_009402144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.7    2e-19   
gb|KHG26459.1|  hypothetical protein F383_04538                       95.5    2e-19   
ref|NP_001275265.1|  glucan endo-1,3-beta-glucosidase 12-like pre...  92.8    2e-19   
ref|XP_002976328.1|  hypothetical protein SELMODRAFT_19025            89.4    2e-19   
ref|XP_009421107.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    94.0    2e-19   
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    2e-19   
gb|KJB66065.1|  hypothetical protein B456_010G126400                  94.7    2e-19   
ref|XP_007212991.1|  hypothetical protein PRUPE_ppa022594mg           93.6    2e-19   
ref|XP_011005841.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  93.6    2e-19   
ref|XP_011026266.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    2e-19   
ref|XP_003629685.1|  Glucan endo-1 3-beta-glucosidase                 90.1    3e-19   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    3e-19   
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  94.4    3e-19   
ref|XP_011005840.1|  PREDICTED: mucin-2-like isoform X1               93.2    3e-19   
dbj|BAH57260.1|  AT3G13560                                            94.7    3e-19   
gb|AFW81253.1|  hypothetical protein ZEAMMB73_668683                  92.4    3e-19   
emb|CDY18049.1|  BnaC07g04210D                                        94.4    3e-19   
ref|XP_004491585.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    3e-19   
emb|CDP02593.1|  unnamed protein product                              94.0    3e-19   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                     95.1    3e-19   
emb|CDY06818.1|  BnaC01g09170D                                        95.1    3e-19   
gb|ACF87545.1|  unknown                                               94.4    3e-19   
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    3e-19   
gb|KJB66066.1|  hypothetical protein B456_010G126400                  95.1    3e-19   
ref|XP_004158003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    3e-19   
gb|AET00920.2|  carbohydrate-binding X8 domain protein                89.7    3e-19   
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g           95.1    3e-19   
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                 94.0    3e-19   
gb|KFK28432.1|  hypothetical protein AALP_AA8G513900                  93.6    3e-19   
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g           95.1    3e-19   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890        94.4    3e-19   
ref|XP_009365677.1|  PREDICTED: sulfated surface glycoprotein 185...  92.8    3e-19   
gb|EPS73640.1|  hypothetical protein M569_01113                       94.7    3e-19   
ref|XP_003517342.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3    93.6    3e-19   
emb|CDP00829.1|  unnamed protein product                              94.7    4e-19   
ref|XP_011098085.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  92.4    4e-19   
ref|XP_010942819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    4e-19   
ref|XP_006838401.1|  hypothetical protein AMTR_s00002p00090370        93.2    4e-19   
ref|XP_003544378.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    4e-19   
ref|XP_010942820.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    4e-19   
gb|KJB62904.1|  hypothetical protein B456_009G443100                  89.4    4e-19   
ref|XP_008340994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   93.6    4e-19   
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg              94.4    4e-19   
gb|KJB10701.1|  hypothetical protein B456_001G216900                  94.4    4e-19   
ref|XP_009619756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   93.2    4e-19   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                 94.7    4e-19   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    4e-19   
ref|XP_009381292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    4e-19   
ref|XP_008656072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  92.0    4e-19   
ref|XP_011460394.1|  PREDICTED: carbohydrate-binding X8 domain-co...  92.8    4e-19   
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g           94.4    4e-19   



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGT +Y IDLSGKTPESE+ PLPKPT N+PYKGK+WCVV   AN TA+A A
Sbjct  285  ERHFGLLYPNGTRVYEIDLSGKTPESEYEPLPKPTNNEPYKGKIWCVVGEGANRTALAAA  344

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YACGQGN TC+PIQPGG CY PNSL+ HAS+AFSSYWAQFR +GGTCYF+GLA +TI 
Sbjct  345  LGYACGQGNGTCDPIQPGGKCYEPNSLVHHASFAFSSYWAQFRKVGGTCYFSGLATQTIR  404

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  405  DPSYGSCKFPSVTL  418



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGTNIY IDLSGKTP SE+ PLP+P  N+PYKGK+WCVV   A++T V+ A
Sbjct  333  ERHFGLLYPNGTNIYEIDLSGKTPLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +
Sbjct  393  LAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKS  452

Query  232  DPSYGACKYPSITL  191
            DPSYGACK+PS+TL
Sbjct  453  DPSYGACKFPSVTL  466



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+LYPN +++Y IDL+G+TPESE+PPLP P  N+PYKGK+WCVVA  AN T +  A
Sbjct  334  ERHWGLLYPNESSVYQIDLTGETPESEYPPLPAPENNEPYKGKIWCVVAKGANRTELGSA  393

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YACGQGN TC P+QPG  CY P SL+RHAS+AFSSYWAQFRS GGTCYFNGLAV+T+ 
Sbjct  394  LTYACGQGNGTCEPVQPGRKCYKPVSLVRHASFAFSSYWAQFRSTGGTCYFNGLAVQTMK  453

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  454  DPSYGSCKFPSVTL  467



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGTNIY IDLSGKT  SE+ PLP+P  N+PYKGK+WCVV   A++T V+ A
Sbjct  332  ERHFGLLYPNGTNIYGIDLSGKTSLSEYEPLPRPRNNEPYKGKIWCVVGRKASVTEVSGA  391

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA+ T +
Sbjct  392  LAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLAIPTKS  451

Query  232  DPSYGACKYPSITL  191
            DPSYGACK+PS+TL
Sbjct  452  DPSYGACKFPSVTL  465



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+TA+ +A
Sbjct  253  ERHFGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEA  312

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  
Sbjct  313  LTYACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAK  372

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  373  DPSYGSCKFPSVTL  386



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGTNIY IDLSGKTPESE+  LP+   N+PY GK+WCVV+ +AN + +  A
Sbjct  331  ERHFGLLYPNGTNIYGIDLSGKTPESEYKALPRARNNEPYTGKIWCVVSRSANASELGGA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +SYACGQGNRTC+ IQPGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  
Sbjct  391  MSYACGQGNRTCDEIQPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKK  450

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  451  DPSYGSCKFPSVTL  464



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGTN+Y IDLSGKTPESE+  LP+   N+PYKGK+WCVV   AN + +  A
Sbjct  331  ERHFGLLYPNGTNVYGIDLSGKTPESEYKALPRARNNEPYKGKIWCVVGRNANASELGGA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +SYACGQGNRTC+ I+PGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL + T  
Sbjct  391  MSYACGQGNRTCDEIRPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLTIPTKK  450

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  451  DPSYGSCKFPSVTL  464



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ A
Sbjct  333  ERHFGLLYPNGSHVYEIDLSGNAPEKEYEPLPKPTNNEPYKGKIWCVAAKVANTTALSSA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI 
Sbjct  393  LSYACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIK  452

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+PS+TL
Sbjct  453  DPSHGSCKFPSVTL  466



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+TA+ +A
Sbjct  330  ERHFGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  
Sbjct  390  LTYACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  450  DPSYGSCKFPSVTL  463



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN TA++ A
Sbjct  333  ERHFGLLYPNGSHVYEIDLSGNAPEKEYGPLPKPTNNEPYKGKIWCVAAKVANTTALSSA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA +TI 
Sbjct  393  LSYACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLATQTIK  452

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+PS+TL
Sbjct  453  DPSHGSCKFPSVTL  466



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +AVA A
Sbjct  254  ERNFGLLYPNGSNVYPIDLSGKTPESEYGPLPVATNNVPYKGPIWCLVAKGANRSAVASA  313

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR +GG+CYF GLA +TI 
Sbjct  314  LSYACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRKVGGSCYFGGLATQTIK  373

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+P   L
Sbjct  374  DPSYGSCKFPGAKL  387



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +AVA A
Sbjct  329  ERNFGLLYPNGSNVYPIDLSGKTPESEYGPLPAATNNVPYKGPIWCLVAKGANRSAVASA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR++GG+CYF GLA +TI 
Sbjct  389  LSYACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRNVGGSCYFGGLATQTIK  448

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+P   L
Sbjct  449  DPSFGSCKFPGAKL  462



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGTN+Y IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ A
Sbjct  328  ERHFGLLYPNGTNVYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q+R  G TCYFNGLA +T  
Sbjct  388  LSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQYRKTGATCYFNGLATQTAK  447

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  448  DPSFGHCKFPSVTL  461



>ref|XP_007049652.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93809.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=328

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N + +  A
Sbjct  195  ERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSA  254

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  
Sbjct  255  LSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAK  314

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  315  DPSFGHCKFPSVTL  328



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+ +Y IDL GKTPES+FP LP P  N+PYKGK+WCV A  +NLT + +A
Sbjct  330  ERNFGLLYPNGSRVYEIDLFGKTPESDFPALPPPENNEPYKGKIWCVAARGSNLTELGEA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGNRTC+ +QPG  C+ P S+  HASYAFSSYWAQF+ +GGTCYFNGLA +T  
Sbjct  390  LSYACSQGNRTCDAVQPGKKCFKPESIFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  450  DPSYGSCKFPSVTL  463



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ A
Sbjct  253  ERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSA  312

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  
Sbjct  313  LSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAK  372

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  373  DPSFGHCKFPSVTL  386



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERHFG+LYPNG+NIY IDLSG+T +SE+  PLP PT N+PYKGK+WCVVA  AN TAVA 
Sbjct  253  ERHFGLLYPNGSNIYEIDLSGETLDSEYKEPLPVPTNNEPYKGKIWCVVAKGANKTAVAG  312

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL+YAC QGN+TC+PIQPG  C+ P SL  HASYAFSSYWAQF+ +GGTC FNGLA +T+
Sbjct  313  ALTYACSQGNKTCDPIQPGKQCFKPESLYWHASYAFSSYWAQFKKIGGTCQFNGLATQTV  372

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK PS+TL
Sbjct  373  MDPSFGHCKLPSVTL  387



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYP+G  +Y +DLSG T E++F PLP+  TN+PYKG++WCVV    N++ V  A
Sbjct  330  ERHFGLLYPSGKAVYEMDLSGSTAETKFKPLPEAETNEPYKGRIWCVVGKGVNMSEVVGA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI 
Sbjct  390  LSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKIGGTCYFNGLATQTIK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG CK+PS+TL
Sbjct  450  DPSYGKCKFPSVTL  463



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG LYPNG+N+YPIDLSGKTPESE+ PLP  T N+PYKG +WC+VA  AN +AVA A
Sbjct  382  ERNFGFLYPNGSNVYPIDLSGKTPESEYAPLPVATNNEPYKGPIWCMVAKGANQSAVASA  441

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YW+QFR  GG+CYF GLA +TI 
Sbjct  442  LSYACSQGNKTCDPIQPGGKCFKPDSLAWHASYAFSAYWSQFRKAGGSCYFGGLATQTIK  501

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+P   L
Sbjct  502  DPSYGSCKFPGAKL  515



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+N+Y IDLSGKTP+S + PLPKPT N+PYKGK+WCV A   N + +  A
Sbjct  331  ERHFGLLYPNGSNVYAIDLSGKTPDSAYEPLPKPTNNEPYKGKIWCVAARGVNASELGSA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  
Sbjct  391  LSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAK  450

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  451  DPSFGRCKFPSVTL  464



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ A
Sbjct  328  ERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  
Sbjct  388  LSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAK  447

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  448  DPSFGHCKFPSVTL  461



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   214 bits (546),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = -1

Query  592   ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
             ERHFG+LYPNG+++Y IDLSGKT  SEF PLP P   + YKGK WCVVA  AN TAVA+A
Sbjct  1109  ERHFGLLYPNGSSVYEIDLSGKTLASEFKPLPPP---ENYKGKAWCVVAEGANETAVAEA  1165

Query  412   LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
             LSYAC QGNRTC+P+QPG  C+ P S+I HASYAFSSYWAQFR++GGTC FNGLA++   
Sbjct  1166  LSYACSQGNRTCDPVQPGKPCFEPVSVIGHASYAFSSYWAQFRNVGGTCQFNGLAIQIAK  1225

Query  232   DPSYGACKYPSITL  191
             DPSYG+CKYPS+TL
Sbjct  1226  DPSYGSCKYPSVTL  1239



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N + +  A
Sbjct  328  ERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNASELGSA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA +T  
Sbjct  388  LSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLATQTAK  447

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  448  DPSFGHCKFPSVTL  461



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+PY+G +WC+VA  AN +AVA A
Sbjct  330  ERNFGLLYPNGSHVYPIDLSGKTPLSEYPPLPAAKNNKPYEGPIWCIVAKGANRSAVASA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YWAQFR  GG+CYF GLA +TI 
Sbjct  390  LSYACSQGNKTCDPIQPGGKCFKPDSLFWHASYAFSAYWAQFRKAGGSCYFGGLATQTIK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+P   L
Sbjct  450  DPSYGSCKFPGAKL  463



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAV  422
            ERHFG+LYP+G NIYPI+LSG+TP S++PPLP P  N PYKGK+WCVVA  A   N T +
Sbjct  334  ERHFGLLYPSGKNIYPINLSGETPLSDYPPLPAPENNTPYKGKIWCVVAKEAMRGNKTEL  393

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
            A ALSYAC QGN+TC+ IQPGG C  P+SL+R ASYAFSSYWAQF+ LGG CYFNGLAV+
Sbjct  394  AAALSYACSQGNKTCDAIQPGGICSRPDSLVRRASYAFSSYWAQFKKLGGGCYFNGLAVQ  453

Query  241  TINDPSYGACKYPSITL  191
            T  DPSYG CKY S+TL
Sbjct  454  TTKDPSYGYCKYASVTL  470



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPN + +Y IDLSG+TP++E+  LP PT N+PY+GK+WCVVA  AN +A+A A
Sbjct  333  ERHFGLLYPNDSFVYDIDLSGETPDTEYGKLPAPTNNEPYEGKIWCVVAKRANRSALASA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC PIQPG AC+   SL+R ASYAFSSYWAQFR  GG+CYFNGLA +TI 
Sbjct  393  LSYACSQGNATCGPIQPGKACHRKGSLVRQASYAFSSYWAQFRKTGGSCYFNGLATQTIE  452

Query  232  DPSYGACKYPSITL  191
            DPSYG+C++P++TL
Sbjct  453  DPSYGSCEFPAVTL  466



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT++Y +DL+GK PE ++ PLP P  N+PYKGK+WCVVA  AN TA+  A
Sbjct  331  ERHWGLLNPDGTSVYEVDLTGKRPEFDYKPLPAPLNNEPYKGKIWCVVARGANRTALGSA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            + YACGQGN TC  I+PG  CY P SL+RHASYAFSSYWAQFR  GGTCYFNGLAV+T  
Sbjct  391  IKYACGQGNGTCEEIRPGSDCYEPVSLVRHASYAFSSYWAQFRKFGGTCYFNGLAVQTTK  450

Query  232  DPSYGACKYPSITL  191
            DP +G+CKYPS+TL
Sbjct  451  DPGHGSCKYPSVTL  464



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+N+Y IDLSGKTP+S + PLPKPT ++PYKGKVWCV A   N + +  A
Sbjct  331  ERHFGLLYPNGSNVYGIDLSGKTPDSAYEPLPKPTNDEPYKGKVWCVAARRVNASELGSA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQ G  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA  T  
Sbjct  391  LSYACSQGNKTCDPIQSGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLATPTAK  450

Query  232  DPSYGACKYPSITL  191
            DPS+G CK+PS+TL
Sbjct  451  DPSFGRCKFPSVTL  464



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYP G  +Y +DLSG   E++F PLP+   N+PYKGK+WCVV    N++ V  A
Sbjct  330  ERHFGLLYPKGKAVYEMDLSGSRAETKFKPLPEAERNEPYKGKIWCVVGKGVNMSDVVGA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA +TI 
Sbjct  390  LSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKVGGTCYFNGLATQTIK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG CK+PS+TL
Sbjct  450  DPSYGKCKFPSVTL  463



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+P KG +WC+VA  AN +AVA A
Sbjct  330  ERNFGLLYPNGSHVYPIDLSGKTPVSEYPPLPAAKNNKPXKGPIWCMVAKGANRSAVASA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ P++L  HASYAFS+YWAQFR  GG+CYF GLA +TI 
Sbjct  390  LSYACSQGNKTCDPIQPGGKCFKPDTLSWHASYAFSAYWAQFRKAGGSCYFGGLATQTIK  449

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+P   L
Sbjct  450  DPSYGSCKFPGAKL  463



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+N+Y IDL+GKTP  EF PLP  T N+PY G +WC+V   AN TAVA+A
Sbjct  330  ERNFGLLYPNGSNVYEIDLTGKTPVLEFKPLPPATNNKPYPGPIWCLVKEGANKTAVAEA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPGG C+ PN+L +HASYAFS+YWAQFR  GG+C F GLAV+TI 
Sbjct  390  LSYACSQGNKTCDPIQPGGKCFKPNTLAQHASYAFSAYWAQFRKAGGSCSFGGLAVQTIK  449

Query  232  DPSYGACKYP  203
            DPSYG+CKYP
Sbjct  450  DPSYGSCKYP  459



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN TAV +A
Sbjct  253  ERHFGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEA  309

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   
Sbjct  310  LSYACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAE  369

Query  232  DPSYGACKYPSITL  191
            DPSYG+CKYPS+ L
Sbjct  370  DPSYGSCKYPSVIL  383



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA--ANLTAVA  419
            ERH+G+ YP   ++YPIDL+G+T  + +P LPKP  N+PYKGK+WCVVA A  AN+TA+ 
Sbjct  331  ERHWGLFYPTEAHVYPIDLTGETDLASYPALPKPKNNEPYKGKIWCVVAEAKGANMTALG  390

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
            DA++YACGQGN TC  IQP G CYNP SLI HA+YAFSSYWAQF+S G TC+FNGLAV+T
Sbjct  391  DAVTYACGQGNGTCAAIQPKGLCYNPKSLIYHANYAFSSYWAQFKSQGATCFFNGLAVQT  450

Query  238  INDPSYGACKYPSITL  191
              DPS+G CKYPS+TL
Sbjct  451  TKDPSHGKCKYPSVTL  466



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 4/134 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+++YPIDLSGKT  S++PPL KP  N    GK+WCVVA  AN TA+  A
Sbjct  332  ERNFGLLYPNGSHVYPIDLSGKTQVSDYPPLAKPANN----GKLWCVVAEGANKTALTGA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGNRTC+PIQPGG CY PNSLI+HASYAFSSYWAQ R+ G TC F+GLAV    
Sbjct  388  LSYACSQGNRTCDPIQPGGKCYKPNSLIKHASYAFSSYWAQMRAAGATCSFSGLAVMISK  447

Query  232  DPSYGACKYPSITL  191
            DPSYGACKYPS+ L
Sbjct  448  DPSYGACKYPSVNL  461



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERHFG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WCVVA  AN +AV D
Sbjct  344  ERHFGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCVVAKEANRSAVKD  403

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL++AC QGN+TC+ IQPG  CY P SL RHASYAFSSYWA+F+ +GG C FNGLA  T 
Sbjct  404  ALAWACSQGNKTCDEIQPGKECYKPVSLFRHASYAFSSYWAEFKKIGGVCSFNGLATTTF  463

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+PS+TL
Sbjct  464  KDPSFGQCKFPSVTL  478



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN TAV +A
Sbjct  333  ERHFGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKTAVVEA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA +   
Sbjct  390  LSYACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAE  449

Query  232  DPSYGACKYPSITL  191
            DPSYG+CKYPS+ L
Sbjct  450  DPSYGSCKYPSVIL  463



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ ++ IDLSGKTPES+F PLP P  N+ +KGK+WCV A   N+T +A A
Sbjct  332  ERHFGLLHPNGSRVFDIDLSGKTPESDFQPLPAPENNEKFKGKIWCVAARRDNVTELAAA  391

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQ  G C+ P S+  HASYAFS+YWAQF+ +G TCYFNGLA +T  
Sbjct  392  LSYACSQGNGTCDPIQTRGKCFKPGSVFWHASYAFSAYWAQFKKIGATCYFNGLATQTAK  451

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  452  DPSYGSCKFPSVTL  465



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERHFG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N TAV D
Sbjct  331  ERHFGLLYPNGTKIYEIDLSGDTPLSEYTKPLPAPTNNEPYKGKIWCMVAKGVNETAVGD  390

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            ALSYAC QGN+TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T 
Sbjct  391  ALSYACSQGNKTCDAIQTGKECYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTP  450

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+P  TL
Sbjct  451  KDPSFGHCKFPGTTL  465



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERHFG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N TAV D
Sbjct  331  ERHFGLLYPNGTKIYEIDLSGDTPLSEYKKPLPAPTNNEPYKGKIWCMVAKGVNETAVRD  390

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            ALSYAC QGN TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGLA  T 
Sbjct  391  ALSYACSQGNGTCDAIQTGKKCYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGLATMTP  450

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+P +TL
Sbjct  451  KDPSFGHCKFPGVTL  465



>ref|XP_007134153.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
 gb|ESW06147.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
Length=335

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ +Y IDLSG TPESE  P+P P  +  YKGK WCVVA  AN+T VA A
Sbjct  205  ERHFGLLYPNGSRVYDIDLSGNTPESELAPVP-PAMD--YKGKAWCVVAEGANVTEVAAA  261

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSY+C QGN TC+PIQPG  C+ P+S+  HA YAFS+YWAQFR +GGTCYFNGLA +T  
Sbjct  262  LSYSCSQGNGTCDPIQPGHPCFKPDSVTSHADYAFSAYWAQFRRVGGTCYFNGLATQTAK  321

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  322  DPSYGSCKFPSVTL  335



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERHFG+LYPNG+ +Y IDLSG+  ESE+  PLP P  N PY GK+WCVVA  AN TA+ D
Sbjct  330  ERHFGLLYPNGSKVYDIDLSGEKTESEYTKPLPAPINNAPYTGKIWCVVAKGANRTALGD  389

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL YAC QGN+TC+PIQPG  C+ P+S++ HASYAFSS+WAQ R  G TCYFNGLA +T 
Sbjct  390  ALGYACSQGNKTCDPIQPGKKCFKPDSVVWHASYAFSSFWAQMRQAGATCYFNGLATQTT  449

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+PS++L
Sbjct  450  KDPSFGHCKFPSVSL  464



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  328  ERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DP YG C++PS+TL
Sbjct  447  DPGYGRCEFPSVTL  460



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  328  ERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DP YG C++PS+TL
Sbjct  447  DPGYGRCEFPSVTL  460



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  369  ERHFGLLHPNGSQVYEIELSGKTTEYK-EALPGPENNEGYKGKIWCVVAKGANWTQLGDA  427

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI 
Sbjct  428  LSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIK  487

Query  232  DPSYGACKYPSITL  191
            DP YG C++PS+TL
Sbjct  488  DPGYGRCEFPSVTL  501



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER FG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN +AV D
Sbjct  331  ERQFGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKD  390

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL++AC QGN+TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+
Sbjct  391  ALAWACSQGNKTCDEIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTV  450

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+PS+TL
Sbjct  451  KDPSFGQCKFPSVTL  465



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKTTEYG-GELPAPENNEVYKGKIWCVVAKGANWTQLGEA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  388  LSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIK  447

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  448  DPSYGRCEFPSVTL  461



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKTTEYG-GALPAPENNEVYKGKIWCVVAKGANWTQLGEA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  388  LSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIK  447

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  448  DPSYGRCEFPSVTL  461



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKTTEYG-GALPVPENNEVYKGKIWCVVAKGANWTQLGEA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  388  LSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIK  447

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  448  DPSYGRCEFPSVTL  461



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  328  ERHFGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWTELGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNKTCDPIQSGGPCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  328  ERHFGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEFYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIQRGGPCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>emb|CAK18899.1| glucan 1,3-beta glucosidase [Cocos nucifera]
Length=179

 Score =   184 bits (466),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAV  422
            ERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV      + N TAV
Sbjct  6    ERHWGLLYPNATRVYEVDLTGRLPDAGYGPLPPPGNNKPYKGKIWCVFGRRGKSVNATAV  65

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              A+SYACGQG  TC+ IQPGG CY P+SL  HASYAF+SYW QFR  GGTCYFNGLAV+
Sbjct  66   GSAISYACGQGKGTCDAIQPGGPCYRPDSLTAHASYAFNSYWQQFRRSGGTCYFNGLAVQ  125

Query  241  TINDPSYGACKYPSI  197
               DPSYG+CK+PSI
Sbjct  126  AAQDPSYGSCKFPSI  140



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  328  ERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEGYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+ I+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA +TI 
Sbjct  387  LSYACSQGNNTCDSIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DP YG C++PS+TL
Sbjct  447  DPGYGRCEFPSVTL  460



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCVVA  AN T + DA
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+LYPNG+ +Y +DL+G+TP S++ PLP+P  N+ YKGK+WCVV P AN+TA+  A
Sbjct  330  ERHWGLLYPNGSRVYEVDLTGRTPNSKYAPLPEPKNNEQYKGKIWCVVVPGANVTALGPA  389

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC Q N TCN IQ G  C+ PN+L+ HASYAF+SYW  FR  GGTC+FNGLAV+T  
Sbjct  390  LSYACSQANDTCNAIQRGKKCFMPNTLVSHASYAFNSYWQMFRGTGGTCFFNGLAVQTAI  449

Query  232  DPSYGACKYPSIT  194
            +PSYG+CK+P+++
Sbjct  450  NPSYGSCKFPTLS  462



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  330  ERHFGLLHPNGSQVYEIELSGKTTEFK-DSLPAPENNELYKGKIWCVVAKGANWTQLRDA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA +TI 
Sbjct  389  LSYACSQGNNTCEPIQTGGLCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLATQTIK  448

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  449  DPSYGRCEFPSVTL  462



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGK    E   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKMEYKE--SLPAPDNNELYKGKIWCVVAKGANWTQLGDA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>ref|XP_010906169.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Elaeis 
guineensis]
Length=222

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAV  422
            ERH+G+LYPN T +Y +DL+G+ P+S + PLP P  N+PYKGK+WCV      + N TAV
Sbjct  88   ERHWGLLYPNATRVYEVDLTGRLPDSAYGPLPLPDNNEPYKGKIWCVFGGGGKSVNATAV  147

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              A++YACGQG+ TCN IQPGG CY P SL   ASYAF+SYW QFR  GGTCYFNGLAV+
Sbjct  148  GSAIAYACGQGSGTCNAIQPGGQCYRPGSLTARASYAFNSYWQQFRRSGGTCYFNGLAVQ  207

Query  241  TINDPSYGACKYPS  200
            T  DPSYG+CK+PS
Sbjct  208  TAQDPSYGSCKFPS  221



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+LYPNG+ +Y +DLSG+ P   +PPLP P  N+PYKGK+WCV       AAN T 
Sbjct  337  ERHWGLLYPNGSKVYEVDLSGRRPLDSYPPLPPPDNNEPYKGKIWCVFGGDRKAAANATT  396

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V  AL+YACGQGN TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV
Sbjct  397  VGAALAYACGQGNGTCDAIRPGGPCYKPNTLLAHASYAFNSYWQQFRQAGGTCFFDGLAV  456

Query  244  KTINDPSYGACKYPSIT  194
            +T  DPSYG CKY S+T
Sbjct  457  QTKTDPSYGTCKYASLT  473



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N TA++ A
Sbjct  328  ERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNETALSSA  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA +T  
Sbjct  388  LSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLATQTAK  447

Query  232  DPS  224
            DPS
Sbjct  448  DPS  450



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  337  ERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDA  395

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA +TI 
Sbjct  396  LSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIK  455

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  456  DPSYGRCEFPSVTL  469



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER FG+ YPNGT +  IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN +AV D
Sbjct  331  ERQFGLYYPNGTEVLEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANRSAVKD  390

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL++AC QGN TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGLA  T+
Sbjct  391  ALAWACSQGNTTCDKIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGLATTTV  450

Query  235  NDPSYGACKYPSIT  194
             DPS+G CK+PS+T
Sbjct  451  KDPSFGQCKFPSVT  464



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+ +PNGT +Y IDLSGK  E E   LP+P  N+PYKG++WCVVA  AN T + +A
Sbjct  328  ERHFGMYHPNGTRVYDIDLSGKRTEYE-DVLPEPENNEPYKGRIWCVVAKGANWTELGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC PI+PGG C  P+ ++ HASYAFSSYWAQ R  G TC+FNGLA +TI 
Sbjct  387  LSYACSQGNNTCAPIRPGGECSKPDLIVLHASYAFSSYWAQSRKSGATCFFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER+FG+LYPNG+N+YPIDLSGKT +S +PPLP P        K+WCV    ANL A+  A
Sbjct  332  ERNFGLLYPNGSNVYPIDLSGKTRDSRYPPLPNPNR------KLWCVAVKGANLRAMGGA  385

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +SYAC QGNRTC+PIQPGG C+NPNSL  HASYAFSSYWAQ    G TC+F+GLA  T  
Sbjct  386  MSYACSQGNRTCDPIQPGGKCFNPNSLAVHASYAFSSYWAQLWKEGATCFFDGLAFMTSK  445

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+PSI +
Sbjct  446  DPSFGSCKFPSIDI  459



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  328  ERHFGLLHPNGSRVYEIELSGETTEYK-ETLPAPENNEVYKGKIWCVVAKGANWTQLGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIKPGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPS+G C++PS+TL
Sbjct  447  DPSFGRCEFPSVTL  460



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G++ P+GT +Y +DL+GK PE++F  LP P  N+ YKGK+WCVVA  AN T +  A
Sbjct  331  ERHWGLMNPDGTPVYEVDLNGKRPENDFKSLPAPLNNELYKGKIWCVVADGANSTELESA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            + +AC  GN TC+ I+PG  CY+P SL+ HASYAFSSYWAQF+  GGTCYFNGLAV+T  
Sbjct  391  IEFACRLGNNTCDAIRPGSECYHPVSLVSHASYAFSSYWAQFKQSGGTCYFNGLAVQTTE  450

Query  232  DPSYGACKYPSITL  191
            DPS G+CK+PS+TL
Sbjct  451  DPSNGSCKFPSVTL  464



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y +DLSG+TPE+EF PLP P  N+ +KG++WCV A   N TA+  A
Sbjct  334  ERHFGLLHPNGSRVYDVDLSGETPEAEFRPLPVPENNEKFKGRIWCVAARRDNATALTAA  393

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC QGN TC+PIQ  G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  
Sbjct  394  LAYACSQGNGTCDPIQSKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAK  453

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  454  DPSYGSCKFPSVTL  467



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T + DA
Sbjct  337  ERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWTQLGDA  395

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA +TI 
Sbjct  396  LSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLATQTIK  455

Query  232  DPS-YGACKYPSITL  191
            DP+ YG C++PS+TL
Sbjct  456  DPTGYGRCEFPSVTL  470



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+  PNG  +Y +DLSGKT E E   LP+P  N+PYKGK+WCVVA  AN T + +A
Sbjct  328  ERHFGLYNPNGNPVYDMDLSGKTTEYE-DVLPEPGNNEPYKGKIWCVVAKGANWTELGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+PGG C  P  ++ HAS+AFSSYWA+FR  G TC+FNGLA +T+ 
Sbjct  387  LSYACSQGNNTCDPIRPGGPCNKPEFILTHASFAFSSYWAEFRKSGATCHFNGLATQTVK  446

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  447  DPSYGRCEFPSVTL  460



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  328  ERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIK  446

Query  232  DPSYGACKYPSITL  191
            DPS+G C++PS+TL
Sbjct  447  DPSFGRCEFPSVTL  460



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APAANLTA  425
            ERH+G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       AN TA
Sbjct  318  ERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKATANTTA  377

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V  AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV
Sbjct  378  VGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFFDGLAV  437

Query  244  KTINDPSYGACKYPSIT  194
            +T  DPSYG+CKYPS+T
Sbjct  438  QTKADPSYGSCKYPSLT  454



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y +DLSG+TPE+ F PLP P  N+ +KG++WCV A   N TA+A A
Sbjct  334  ERHFGLLHPNGSRVYDVDLSGETPEAGFRPLPVPENNEKFKGEIWCVAARPHNATALAAA  393

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC QGN TC+PIQP G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T  
Sbjct  394  LAYACSQGNGTCDPIQPKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAK  453

Query  232  DPSYGACKYPSITL  191
            DPSYG+CK+PS+TL
Sbjct  454  DPSYGSCKFPSVTL  467



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APAANLTA  425
            ERH+G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       AN TA
Sbjct  332  ERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKATANTTA  391

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V  AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F+GLAV
Sbjct  392  VGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFFDGLAV  451

Query  244  KTINDPSYGACKYPSIT  194
            +T  DPSYG+CKYPS+T
Sbjct  452  QTKADPSYGSCKYPSLT  468



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAV  422
            ERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V
Sbjct  255  ERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEV  314

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+
Sbjct  315  GAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQ  374

Query  241  TINDPSYGACKYPS  200
            T  DPS+G+CKYPS
Sbjct  375  TAQDPSHGSCKYPS  388



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAV  422
            ERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V
Sbjct  333  ERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEV  392

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+
Sbjct  393  GAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQ  452

Query  241  TINDPSYGACKYPS  200
            T  DPS+G+CKYPS
Sbjct  453  TAQDPSHGSCKYPS  466



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLTAV  422
            ERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       AN T V
Sbjct  336  ERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEV  395

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFNGLAV+
Sbjct  396  GAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQ  455

Query  241  TINDPSYGACKYPS  200
            T  DPS+G+CKYPS
Sbjct  456  TAQDPSHGSCKYPS  469



>gb|ACR37660.1| unknown [Zea mays]
Length=225

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TA
Sbjct  86   ERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETA  145

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA 
Sbjct  146  VGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAE  205

Query  244  KTINDPSYGACKYPS  200
            +TI DPS+G+C++PS
Sbjct  206  QTIKDPSHGSCRFPS  220



>gb|ACN28576.1| unknown [Zea mays]
Length=335

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TA
Sbjct  196  ERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETA  255

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA 
Sbjct  256  VGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAE  315

Query  244  KTINDPSYGACKYPS  200
            +TI DPS+G+C++PS
Sbjct  316  QTIKDPSHGSCRFPS  330



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV  P  NLT +  A
Sbjct  333  ERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATHNDMPYEGKSWCVATPDVNLTELERA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++AC QGN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T +
Sbjct  393  LTFACSQGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTS  452

Query  232  DPSYGACKYPSITL  191
            DPS G C++PS+T+
Sbjct  453  DPSRGLCQFPSVTI  466



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WC+++ AA    N TA
Sbjct  344  ERHWGLYYANGTAVYEIDLTGRRPLWSYPPLPAPENNTPYKGPIWCLLSAAASNKLNETA  403

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V +AL+YACGQGN TC+ IQPG  CY PN+ + HASYAF+SYW QFR +G TCYFN LA 
Sbjct  404  VGNALTYACGQGNGTCDAIQPGKNCYMPNTTVAHASYAFNSYWQQFRKIGATCYFNNLAE  463

Query  244  KTINDPSYGACKYPS  200
            +TI DPS+G+CK+PS
Sbjct  464  QTIKDPSHGSCKFPS  478



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 5/135 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVAD  416
            ERHFG LYP+G  +YPIDLSGKTP S +PPL KP +N    G++WCVVA    N T++  
Sbjct  323  ERHFGQLYPDGKFVYPIDLSGKTPISAYPPLRKPASN----GRLWCVVANGVRNATSLTA  378

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL+YACG GN TC+ I+PGG C+ P+SLIRHASY FSSYWAQF + G TC FNGLA  T 
Sbjct  379  ALTYACGNGNGTCDGIRPGGKCFRPDSLIRHASYGFSSYWAQFSAQGATCSFNGLATLTS  438

Query  235  NDPSYGACKYPSITL  191
             DPSYG CKYPS+ L
Sbjct  439  KDPSYGYCKYPSVNL  453



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+GV   NG  IY IDLSG+  ESE+ PLP+   N+PYKGK+WCVV   A L  V   
Sbjct  346  ERHWGVFNENGKAIYDIDLSGQRQESEYEPLPEGINNRPYKGKLWCVVRREAGLMEVERE  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LS  C QGN TC  + PG  CY P S+I HASYAFSSYWAQFRS G +CYFNGLA +T  
Sbjct  406  LSTVCSQGNETCEALAPGNDCYEPISVIWHASYAFSSYWAQFRSQGASCYFNGLAKQTTT  465

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+PS+T+
Sbjct  466  DPSHGSCKFPSVTV  479



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N TA
Sbjct  351  ERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLNETA  410

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA 
Sbjct  411  VGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAE  470

Query  244  KTINDPSYGACKYPS  200
            +TI DPS+G+CK+ S
Sbjct  471  QTIKDPSHGSCKFRS  485



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT +  A
Sbjct  283  ERHWGLLHPNGTSIYQIDLTGKRASSDYETLPPAQNNVPYKGKLWCIAAPEVNLTELESA  342

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA +T +
Sbjct  343  LTFACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTS  402

Query  232  DPSYGACKYPSITL  191
            +PS G+C++PS+T+
Sbjct  403  NPSRGSCQFPSVTI  416



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAV  422
            ERH+G+ YP+GT +Y IDL+G+ P   +PPLP P  N PYKG +WCV+A      N TAV
Sbjct  341  ERHWGLYYPDGTEVYQIDLTGRRPLWAYPPLPAPENNTPYKGPIWCVLATHGRKLNETAV  400

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
             DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR +G TCYFN LA +
Sbjct  401  GDALTYACGQGNGTCDAVQPGGECFQPNTGEAHASYAFNSYWQQFRKIGATCYFNNLAEQ  460

Query  241  TINDPSYGACKYPS  200
            TI DPS+G+CK+ S
Sbjct  461  TIKDPSHGSCKFHS  474



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV AP  NLT +  A
Sbjct  333  ERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATQNDMPYEGKSWCVAAPDVNLTELERA  392

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++AC +GN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLAV+T  
Sbjct  393  LNFACSKGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLAVQTTR  452

Query  232  DPSYGACKYPSITL  191
            +PS G C++PS+T+
Sbjct  453  NPSRGLCQFPSVTI  466



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT +  A
Sbjct  342  ERHWGLLHPNGTSIYQIDLTGKRASSDYETLPPAHNNVPYKGKLWCIAAPEVNLTELERA  401

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA +T +
Sbjct  402  LTFACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTS  461

Query  232  DPSYGACKYPSITL  191
            +PS G+C++PS+T+
Sbjct  462  NPSRGSCQFPSVTI  475



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N TA
Sbjct  340  ERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLNETA  399

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN LA 
Sbjct  400  VGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNNLAE  459

Query  244  KTINDPSYGACKYPS  200
            +TI DPS+G+C++PS
Sbjct  460  QTIKDPSHGSCRFPS  474



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A+N TA
Sbjct  338  ERHWGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATA  397

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V  AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA+
Sbjct  398  VGAALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLAL  457

Query  244  KTINDPSYGACKYPSI  197
            +T  DPSYG+CKY S+
Sbjct  458  QTKTDPSYGSCKYRSL  473



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A+N TA
Sbjct  339  ERHWGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATA  398

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V  AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F+GLA+
Sbjct  399  VGAALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLAL  458

Query  244  KTINDPSYGACKYPSI  197
            +T  DPSYG+CKY S+
Sbjct  459  QTKTDPSYGSCKYRSL  474



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA +A+L A+  A
Sbjct  256  ERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARSADLLALTSA  315

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI 
Sbjct  316  LGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTII  375

Query  232  DPSYGACKYPSITL  191
            +PS G C++PS+TL
Sbjct  376  NPSRGNCRFPSVTL  389



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 20/134 (15%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNGT++Y IDLSG TP+S + PLP+PT N+PYKGK+WCV             
Sbjct  333  ERHFGLLYPNGTSVYDIDLSGHTPDSTYSPLPQPTNNKPYKGKLWCV-------------  379

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
                    NRTC  I+PGG CY PN L+ HASYAFS+YWAQFRS G TC+FNGLAV+T  
Sbjct  380  -------DNRTCEAIRPGGKCYKPNWLVLHASYAFSAYWAQFRSSGATCFFNGLAVQTTK  432

Query  232  DPSYGACKYPSITL  191
            DPSY +C++PS+ L
Sbjct  433  DPSYLSCQFPSVNL  446



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  NGT+IY IDL+GK P S + PLP    N PYKGK+WC VAP A+   ++ A
Sbjct  329  ERHWGLLRSNGTSIYEIDLTGKRPLSSYKPLPAARNNVPYKGKIWCEVAPGADAMNLSLA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYACGQGN+TC  + PG  CY P S+  HASYAFSSYWA+FR  G TC FNGLA +T  
Sbjct  389  LSYACGQGNQTCAALNPGKQCYEPVSVFWHASYAFSSYWARFRKQGATCNFNGLARQTRA  448

Query  232  DPSYGACKYPSITL  191
            +PS G C +PS+TL
Sbjct  449  NPSRGHCSFPSVTL  462



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  NG   Y +DL+G  PE+ +  LPKP+ N PYKGK+WCV    A+LT +  A
Sbjct  335  ERHWGLLSNNGKPTYEVDLTGTRPETSYAILPKPSNNHPYKGKLWCVADSRASLTDLGPA  394

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACGQGN TCN + PG  CY P S+  HASYAFSSYWA+FR+ G  CYF+GLAV+T  
Sbjct  395  LDFACGQGNGTCNELAPGKGCYQPVSISAHASYAFSSYWAKFRNAGAVCYFDGLAVQTTT  454

Query  232  DPSYGACKYPSITL  191
            DPS+G+C++PS+ L
Sbjct  455  DPSHGSCQFPSVLL  468



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  NG  +Y +DL+G+  ES    LP P  N+PY+GK+WCVVA   N   +  A
Sbjct  243  ERHWGLLDCNGKPVYGVDLTGEL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSA  301

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YAC QGN TC+ + PG  CY P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  
Sbjct  302  LIYACSQGNGTCDALMPGKECYEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTE  361

Query  232  DPSYGACKYPSITL  191
            DPS G+CK+P++TL
Sbjct  362  DPSRGSCKFPTVTL  375



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NGT IY IDL+GK   S++ PLP    N PYKGKVWC VAP ANL  ++ A
Sbjct  419  ERHWGLLHSNGTAIYDIDLTGKRLASDYKPLPPAQNNVPYKGKVWCEVAPGANLMNLSSA  478

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC Q N+TC  + PG  CY P S+  H+SYAFSSYWA+FRS G TCYF+GLA +T  
Sbjct  479  LTYACSQDNQTCAALSPGKECYEPISVFWHSSYAFSSYWAKFRSQGATCYFSGLARQTTV  538

Query  232  DPSYGACKYPSITL  191
            +PS G CK+PS+ L
Sbjct  539  NPSRGRCKFPSVIL  552



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +YPIDL+G+ P   +PPLP    N PYKG +WCV++ AA    N TA
Sbjct  345  ERHWGLYYANGTAVYPIDLTGRRPLWSYPPLPALENNTPYKGPIWCVLSAAASKKLNETA  404

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V +AL+YACGQGN TC  IQPG  CY PN+ + HASYAF+SYW QFR  G TCYFN LA 
Sbjct  405  VGNALAYACGQGNGTCAAIQPGEKCYLPNTTVAHASYAFNSYWQQFRKTGATCYFNNLAE  464

Query  244  KTINDPSYGACKYPS  200
            +TI +PS+G+CK+ S
Sbjct  465  QTIKNPSHGSCKFRS  479



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  NG  +Y +DL+G+  ES    LP P  N+PY+GK+WCVVA   N   +  A
Sbjct  342  ERHWGLLDCNGKPVYGVDLTGEL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YAC QGN TC+ + PG  CY P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  
Sbjct  401  LIYACSQGNGTCDALMPGKECYEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTE  460

Query  232  DPSYGACKYPSITL  191
            DPS G+CK+P++TL
Sbjct  461  DPSRGSCKFPTVTL  474



>emb|CAA49515.1| beta-1,3-glucanase homologue [Brassica napus]
Length=139

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  A
Sbjct  6    ERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQA  65

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  66   LDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  125

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  126  NPGNEQCKFPSVTL  139



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+ Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N TA
Sbjct  340  ERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLNETA  399

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V DAL+YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN LA 
Sbjct  400  VGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNNLAE  459

Query  244  KTINDPSYGACKYPS  200
            +T  DPS+G+CK+ S
Sbjct  460  ETTKDPSHGSCKFHS  474



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+ Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N TA
Sbjct  343  ERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLNETA  402

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V DAL+YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN LA 
Sbjct  403  VGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNNLAE  462

Query  244  KTINDPSYGACKYPS  200
            +T  DPS+G+CK+ S
Sbjct  463  ETTKDPSHGSCKFHS  477



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NLTAV  422
            ERH+G+ Y NGT +YPIDL+G  P   +PPLP P  + PYKG VWCV+A      NLTAV
Sbjct  385  ERHWGLYYANGTAVYPIDLTGARPLWSYPPLPPPENDTPYKGPVWCVLADRGGKLNLTAV  444

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
             DAL+YACGQGN TC  IQPG  C+ PN+   HASYAF+SYW Q R  G TCYFN LA +
Sbjct  445  GDALAYACGQGNGTCATIQPGRECFQPNTTAAHASYAFNSYWQQLRKNGATCYFNNLAEE  504

Query  241  TINDPSYGACKYPS  200
            T  DPS+G+CK+ S
Sbjct  505  TTKDPSHGSCKFHS  518



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+LYPNG+ ++ IDL+G+  +SE+ PLP+P  N+ +KGK+WCVV   AN++AV  A
Sbjct  337  ERHWGLLYPNGSRVFEIDLNGRKLDSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAVGPA  396

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +AC QGN TC+ I+ G  CY PN+++ HASYAF++YW +FR  GGTCYF+GLA +T  
Sbjct  397  LDHACAQGNGTCDAIKSGRECYEPNTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQTAV  456

Query  232  DPSYGACKYPS  200
            DPS  +  YP+
Sbjct  457  DPSEFSNLYPT  467



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N TA
Sbjct  399  ERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLNETA  458

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA 
Sbjct  459  VGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAE  518

Query  244  KTINDPS  224
            +TI DPS
Sbjct  519  QTIKDPS  525



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NG  +Y IDL+ K P S + PLP PT N+PYKGK+WCV    AN+T +  A
Sbjct  308  ERHWGLLHANGDAVYEIDLTEKRPASTYGPLPLPTNNRPYKGKLWCVARIDANVTDLGSA  367

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LS AC + N  C+ + PG  C+ P S  RHASYAFS+YWA+FRS G TCYF+GLA +T+ 
Sbjct  368  LSSAC-RVNGMCDILMPGRECHEPASTFRHASYAFSAYWARFRSRGATCYFDGLAEQTVG  426

Query  232  DPSYGACKYPSITL  191
            DPS G+CK+PS+TL
Sbjct  427  DPSRGSCKFPSVTL  440



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T + +A
Sbjct  328  ERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWTQLGEA  386

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA +TI 
Sbjct  387  LSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLATQTIK  446

Query  232  DPS  224
            DPS
Sbjct  447  DPS  449



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ +GT IY +DL+GK   +++ PL  P  N PYKGKVWCV A  AN   +A A
Sbjct  329  ERHWGLLHTDGTPIYDLDLTGKKTNTDYAPLQAPKNNVPYKGKVWCVAAEGANEIELAAA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YAC   N TC+ + PG  CY P S+  HASY FS+YWAQF+S G TCYFNGLA +T  
Sbjct  389  LTYACNVANMTCDALSPGNECYEPVSIPLHASYVFSTYWAQFKSSGATCYFNGLATETTK  448

Query  232  DPSYGACKYPSITL  191
            DPS  +CK+PS+ L
Sbjct  449  DPSRNSCKFPSVIL  462



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA---ANLTAV  422
            ERH+G+ YPNGT +Y IDL+G+     +PPLP P  N+  K + WCV+A      N TAV
Sbjct  338  ERHWGMFYPNGTWVYQIDLTGRRTARSYPPLPPPD-NKTAKLE-WCVLAGGGKPVNETAV  395

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
            ADAL+YAC QG  TC  IQPGGACY PN+L  HASYAF++YW QF+  GG+CYFNGLAVK
Sbjct  396  ADALNYACQQGTGTCAAIQPGGACYEPNTLDAHASYAFNAYWQQFKGTGGSCYFNGLAVK  455

Query  241  TINDPSYGACKYPS  200
            T  DPSYG+CK+PS
Sbjct  456  TNKDPSYGSCKFPS  469



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N   +  A
Sbjct  342  ERHWGLLHADGTPIYDIDLAGKRRLEDYEPLPEANNNSPYKGSVWCVVAKGVNNDELGSA  401

Query  412  LSYAC--GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
            L+  C  G GN TC+ + PG  CY P S I HASYAFSSYWA+FRS G TCYFNGLA +T
Sbjct  402  LTNLCNSGAGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFRSHGATCYFNGLAEQT  461

Query  238  INDPSYGACKYPSITL  191
              DPS+G+CK+PS+TL
Sbjct  462  TVDPSHGSCKFPSVTL  477



>gb|EMT13087.1| Putative glucan endo-1,3-beta-glucosidase A6 [Aegilops tauschii]
Length=362

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----NLTA  425
            ERH+G+ Y NGT +YP+DL+G+ P   +PPLP    + PYKG +WCV+A  A    N TA
Sbjct  199  ERHWGLYYANGTAVYPVDLTGRRPLWAYPPLPAADNDTPYKGPIWCVLAAHAGRKLNETA  258

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V DAL+YACGQGN TC  IQPGG C+ PN+   HASYAF+SYW QFR  G TCYFN LA 
Sbjct  259  VGDALTYACGQGNGTCGAIQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNNLAE  318

Query  244  KTINDP  227
            +TI DP
Sbjct  319  QTIKDP  324



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L PNGT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  A
Sbjct  343  ERHWGILNPNGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNEQCKFPSVTL  476



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L PNG   Y IDL+G   ES +P LP+PT N+P+KGK+WCVVAP + +T +   
Sbjct  336  ERHWGLLQPNGLPNYEIDLTGVQSESNYPTLPQPTNNKPFKGKIWCVVAPGSRITDLGPV  395

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR-SLGGTCYFNGLAVKTI  236
            L+  C + N  C+ + PG  CY P SL+ HASYA SSYWA+ R S G TCYFNG A +T 
Sbjct  396  LNSVCKEDNGACDALAPGKECYEPVSLVAHASYALSSYWAKHRDSAGATCYFNGFAEQTT  455

Query  235  NDPSYGACKYPSITL  191
             DPS+G CK+PS++L
Sbjct  456  RDPSHGPCKFPSVSL  470



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  A
Sbjct  343  ERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNEQCKFPSVTL  476



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T +  A
Sbjct  343  ERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNEQCKFPSVTL  476



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +GT IY +DL+GK   ++F  LP P  N P+KGKVWCV A  AN   +A A
Sbjct  329  ERHWGLLETDGTPIYDLDLTGKKHITDFASLPAPENNVPFKGKVWCVAAKGANEIELASA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LSYAC + N TC  + PG  CY P S+  HASY FS++WA+F++ G TCYFNGLA +T  
Sbjct  389  LSYACNEVNMTCEALSPGNECYEPVSVTDHASYVFSTFWAKFKTTGATCYFNGLAEQTTK  448

Query  232  DPSYGACKYPSITL  191
            DPS   CK+PS+T+
Sbjct  449  DPSRPFCKFPSVTI  462



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA-PAANLTAVAD  416
            ERH+G+L PNG  +Y IDL+G+T ++EF  LP+PT N PY GK+WCVV     N   +  
Sbjct  330  ERHWGMLNPNGRPMYDIDLTGQTLDTEFIDLPQPTNNGPYHGKLWCVVTNDTMNEMDLGQ  389

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA++R  G TCYFNGLAV+T 
Sbjct  390  ALEFACRR-NETCDDISPGKSCYQPVSIVSHANYAFSSYWAKYREDGETCYFNGLAVQTN  448

Query  235  NDPSYGACKYPSITL  191
             DPS+G+CK+P ++L
Sbjct  449  VDPSHGSCKFPYVSL  463



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN T + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANETELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  
Sbjct  406  LRMACARSNTTCAALAPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +A
Sbjct  346  QRHWGLLHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACGQ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRLACGQSNTTCAALAPGRECYEPVSIYWHASYAVSSYWAQFRTQDVRCYFNGLAHETTI  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA--PAANLTAVA  419
            ERH+G+L+PNG  +Y IDL+G+T +SEF  LP+PT N P+ GK+WCVV      N   + 
Sbjct  336  ERHWGMLHPNGRPMYDIDLTGQTLDSEFIDLPQPTNNGPFHGKLWCVVTNDHTMNEMDLG  395

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
             AL +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA+++  G TCYFNGLAV+T
Sbjct  396  QALEFACRR-NETCDEISPGKSCYQPVSIVSHANYAFSSYWAKYKEDGETCYFNGLAVQT  454

Query  238  INDPSYGACKYPSITL  191
              DPS+G+CK+P ++L
Sbjct  455  NVDPSHGSCKFPYVSL  470



>emb|CDP15107.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  410
            RHFG+L  N   +Y +DL+GK  E ++PPLP P+ N+P+KG +WCVVA  AN+  +   L
Sbjct  198  RHFGILQANSWPVYDLDLTGKLGEGDYPPLPLPSNNEPFKGNLWCVVASEANIMELVPQL  257

Query  409  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  230
               C  GN  C+ + PG  CY P ++  HASYAFSSYW +FRS G  C+FNGLAV +  D
Sbjct  258  ESVCSLGNGICDALSPGNDCYEPVTIRAHASYAFSSYWVKFRSRGAACHFNGLAVLSTTD  317

Query  229  PSYGACKYPSI  197
            PS+G+CK+PS+
Sbjct  318  PSHGSCKFPSV  328



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P + F  LPKP+ N P+KG VWCVVA  A+   +  A
Sbjct  341  ERHWGILNPDGTPIYEIDFSGTRPVNSFGSLPKPSNNVPFKGNVWCVVAEGASEAELGQA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  401  LNFACGESNATCAALAPGRECYEPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTT  460

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+T+
Sbjct  461  NPGNERCKFPSVTM  474



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  
Sbjct  406  LRMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRSQNVQCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  A
Sbjct  345  ERHWGILNPDGTQIYDIDFSGTKPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQA  404

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  405  LDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  464

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  465  NPGNERCKFPSVTL  478



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  A
Sbjct  341  ERHWGILNPDGTQIYDIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  401  LDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  460

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  461  NPGNERCKFPSVTL  474



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+   +  A
Sbjct  345  ERHWGILNPDGTQIYEIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQA  404

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  405  LDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  464

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  465  NPGNERCKFPSVTL  478



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L A+  A
Sbjct  335  ERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSA  394

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI 
Sbjct  395  LGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTII  454

Query  232  DPS  224
            +PS
Sbjct  455  NPS  457



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY+P S+  HASYA SSYWAQFR+    CYFNGLA ++  
Sbjct  406  LRIACGRSNTTCAALAPGKECYDPVSIYWHASYAVSSYWAQFRTQNVGCYFNGLAHESTI  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT +Y +D +GK   S + PLP P  N PYKG VWCV    A++ A+ +A
Sbjct  347  ERHWGILRPSGTPVYEVDFTGKKQVSGYGPLPAPDNNVPYKGNVWCVANEGADMAALGEA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFRS    CYF+GLA +T  
Sbjct  407  LRFACGRSNDTCQALAPGRECYEPVSVTWHASYAFSSYWAQFRSQNARCYFDGLARETTT  466

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  467  NPGNDRCKFPSVTL  480



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +A
Sbjct  341  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  
Sbjct  401  LRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTT  460

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  461  NPGNDRCKFPSVTL  474



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N   +  A
Sbjct  317  ERHWGLLHADGTPIYDIDLTGKRRLEDYKPLPEANNNSPYKGMVWCVVAKGVNNDELDSA  376

Query  412  LSYACGQ--GNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
            L+  C    GN TC+ + PG  CY P S I HASYAFSSYWA+F S G TCYF+GLA +T
Sbjct  377  LNNLCSSSSGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFWSHGATCYFDGLAEQT  436

Query  238  INDPSYGACKYPSITL  191
              DPS+G+CK+PS+TL
Sbjct  437  TVDPSHGSCKFPSVTL  452



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA +T  
Sbjct  406  LRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+G+ IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + + 
Sbjct  345  QRHWGILHPDGSPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEET  404

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC Q N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  405  LRMACAQSNTTCAALAPGRECYEPVSIYWHASYALSSYWAQFRNQSIQCYFNGLAHETTT  464

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  465  NPGNDRCKFPSVTL  478



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L   G+ IY +DL+G + E+    L +P+ N PY GK+WCVVA  A+   +  A
Sbjct  339  ERHWGLLSNTGSPIYEVDLTGTSHENN-TKLSEPSNNGPYNGKIWCVVASTASPDDLGPA  397

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +AC QGN TC+ + PG  CY P S++ HASYAFSS+WAQFRS G +CYF GLAV+TI 
Sbjct  398  LEFACRQGNGTCDQLAPGKECYEPISIVSHASYAFSSFWAQFRSAGASCYFGGLAVQTIT  457

Query  232  DPSYGACKYPSITL  191
            DP +G+C++PS+ L
Sbjct  458  DPGHGSCEFPSVLL  471



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 88/134 (66%), Gaps = 22/134 (16%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCV             
Sbjct  329  ERHFGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCV-------------  373

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
                   GN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA +TI 
Sbjct  374  -------GNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLATQTIK  426

Query  232  DPSYGACKYPSITL  191
            DPSYG C++PS+TL
Sbjct  427  DPSYGRCEFPSVTL  440



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L A+  A
Sbjct  335  ERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLLALTSA  394

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA +TI 
Sbjct  395  LGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLAQQTII  454

Query  232  DP  227
            +P
Sbjct  455  NP  456



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+   +  A
Sbjct  343  ERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>emb|CDY67322.1| BnaA03g57600D [Brassica napus]
Length=221

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  A
Sbjct  88   ERHWGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQA  147

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  148  LNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTT  207

Query  232  DPSYGACKYPSITL  191
            +P    C +PS+TL
Sbjct  208  NPGNEHCTFPSVTL  221



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+   +  A
Sbjct  343  ERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>gb|KJB37880.1| hypothetical protein B456_006G224700 [Gossypium raimondii]
Length=462

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L+ NGT +Y IDL+G    SE+ PLP    N PYKGK+WC VAP  N  ++  A
Sbjct  329  ERHWGMLHTNGTPVYEIDLTGNRKISEYKPLPPAVNNVPYKGKLWCEVAPWVNEMSLPAA  388

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            LS  C   N TC  + PG  CY P S++ HASYAFSSYWA+FRS G  C FNGLA +T  
Sbjct  389  LSNVCSIDNETCAALAPGKDCYEPVSVVWHASYAFSSYWAKFRSQGAICSFNGLARETTV  448

Query  232  DPSYGACKYPSITL  191
            DPS G C +PS+T+
Sbjct  449  DPSRGRCNFPSVTV  462



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+G+ IY +D +G+TP + F PLPKPT N PYKG+VWCV    AN T + + 
Sbjct  345  QRHWGILHPDGSPIYDVDFTGQTPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEET  404

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  AC Q N TC  + PG  CY P S+  HASYA +SYWAQFR+    C+FNGLA +T  
Sbjct  405  LRMACAQSNTTCAALAPGRECYEPVSIYWHASYALNSYWAQFRNQSIQCFFNGLAHETTT  464

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  465  NPGNDRCKFPSVTL  478



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+LYPNG+ +Y IDL+G+  +SE+ P   P    PYKGK+WCVV   AN++A+  A
Sbjct  333  ERHWGLLYPNGSRLYEIDLTGELQDSEYKP--LPPPPPPYKGKLWCVVDANANVSALPSA  390

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            ++YAC QGN TC  IQPG  CY PN++I HASYAF+SYW QF++ GGTCYFNG A     
Sbjct  391  ITYACSQGNNTCVAIQPGKPCYQPNTVIDHASYAFNSYWQQFKNSGGTCYFNGAATLVTK  450

Query  232  DPSYGACKYP  203
            DPS   C+YP
Sbjct  451  DPSSKICRYP  460



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 10/137 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVA----PAANL  431
            ERH+G+ YPN T +Y +DL+G+ P   +PPLP    T + P     WCV+A     AAN 
Sbjct  254  ERHWGLYYPNQTRVYEVDLTGQRPSRSYPPLPPAGDTDSSP----AWCVLASGEGKAANE  309

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAV  AL YAC QG+ TC  IQPGGAC+ P++L  HASYAF+SYW QFR+ GGTC+FNGL
Sbjct  310  TAVQAALEYACQQGSGTCAAIQPGGACHEPDTLDAHASYAFNSYWQQFRNAGGTCFFNGL  369

Query  250  AVKTINDPSYGACKYPS  200
            A  T  DPS+G+CK+ S
Sbjct  370  AEATTKDPSHGSCKFQS  386



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+   +  A
Sbjct  343  ERHWGILNPDGTPIYDIDFSGTRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AANLTAVA  419
            ERH+G+L+ +GT IY +DL+GK P  ++ PLP+   N+PYKG VWCVVA   + N   + 
Sbjct  332  ERHWGLLHADGTPIYDVDLTGKRPLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVNDEELG  391

Query  418  DALSYACGQGNRT--CNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
             A++ AC  GN T  C+ + PG  CY P SL  HASYAFSSYWA+FRS G TC+FNGLA 
Sbjct  392  SAVNNACIAGNATGTCDALSPGKECYEPVSLTWHASYAFSSYWAKFRSQGATCHFNGLAE  451

Query  244  KTINDPSYGACKYPSITL  191
            +T  DPS+G+CK+PS+  
Sbjct  452  QTSLDPSHGSCKFPSVIF  469



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID +G  P S F  LPKP  N P+KG VWCV    A+   +  A
Sbjct  343  ERHWGILNPDGTPIYEIDFTGTRPVSSFGELPKPDNNVPFKGNVWCVAIDGASEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRSNETCAALAPGKECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+GVL+P+GT IY ID +G+   + F PLPKPT N PYKG+VWCV    AN T + + 
Sbjct  346  QRHWGVLHPDGTPIYDIDFTGQKNLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEET  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRIACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAQFRNESIQCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + D 
Sbjct  346  QRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEDT  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANLTAVAD  416
            ERH+G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N   +  
Sbjct  307  ERHWGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQ  366

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T 
Sbjct  367  ALEFACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTT  425

Query  235  NDPSYGACKYPSITL  191
             DPS+G+CK+P ++L
Sbjct  426  VDPSHGSCKFPYVSL  440



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+   +  A
Sbjct  343  ERHWGILNPDGTPIYDIDFSGTRSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEAELGLA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRNNETCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTI  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANLTAVAD  416
            ERH+G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N   +  
Sbjct  337  ERHWGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQ  396

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T 
Sbjct  397  ALEFACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTT  455

Query  235  NDPSYGACKYPSITL  191
             DPS+G+CK+P ++L
Sbjct  456  VDPSHGSCKFPYVSL  470



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG    + F  +PKP+ N P+KG VWCVV   A+   +  A
Sbjct  341  ERHWGILNPDGTRIYEIDFSGTRQVNSFGSMPKPSNNVPFKGNVWCVVVEGASEAELGQA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  401  LEFACGRSNVTCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTT  460

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS++L
Sbjct  461  NPGNERCKFPSVSL  474



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A    + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A    + +A
Sbjct  346  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEAELEEA  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + + 
Sbjct  346  QRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEET  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN   + + 
Sbjct  346  QRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEAELEET  405

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  406  LRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLAHETTT  465

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  466  NPGNDRCKFPSVTL  479



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 19/134 (14%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERHFG+LYPNG+ +Y IDL GKT  S + PLP+PT N+ YKG ++C              
Sbjct  304  ERHFGLLYPNGSKVYQIDLRGKTTSSGYEPLPEPTNNKQYKGPMYC--------------  349

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
                  QGN TC  I+PG AC+NP+  + HA+YAFSSYWA+FR+ G +C+ NGLA +TI 
Sbjct  350  -----SQGNNTCEAIRPGKACHNPDLSLFHANYAFSSYWAEFRNSGASCFLNGLATQTIK  404

Query  232  DPSYGACKYPSITL  191
            DPS+G+CK+PS+ L
Sbjct  405  DPSHGSCKFPSVAL  418



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN++ + + 
Sbjct  345  QRHWGILHPDGIPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVDGANVSELEET  404

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L   C + N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA +T  
Sbjct  405  LRTTCSRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVQCYFNGLAHETTT  464

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  465  NPGNDRCKFPSVTL  478



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  A
Sbjct  347  ERHWGILKPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  407  LNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTT  466

Query  232  DPSYGACKYPSITL  191
            +P    C +PS+TL
Sbjct  467  NPGNEHCTFPSVTL  480



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+   +  A
Sbjct  347  ERHWGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  407  LNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTT  466

Query  232  DPSYGACKYPSITL  191
            +P    C +PS+TL
Sbjct  467  NPGNEHCTFPSVTL  480



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 4/138 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AANLTAVA  419
            ERH+G+L+ +GT IY +DL+GK    ++ PLP+   N+PYKG VWCVVA   + N   + 
Sbjct  332  ERHWGLLHADGTPIYDVDLTGKRVLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVNDEELG  391

Query  418  DALSYACGQGNR--TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
             A++ AC  GN   TC+ + PG  CY P SL  HAS+AFSSYWA+FRS G TC+FNGLA 
Sbjct  392  SAVNNACIAGNASGTCDALSPGKECYEPVSLTWHASFAFSSYWAKFRSQGATCHFNGLAE  451

Query  244  KTINDPSYGACKYPSITL  191
            +T  DPS+G+CK+PS+  
Sbjct  452  QTSLDPSHGSCKFPSVIF  469



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  A
Sbjct  343  ERHWGILDHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  403  LNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANLTAVAD  416
            ERH+G+L PNG  IY IDL+G+  ESE   LP P  N P+ GK+WCV+A    N   +  
Sbjct  337  ERHWGLLQPNGKAIYDIDLTGEISESELSKLPVPKNNGPFHGKLWCVLAKDIVNEKDLGQ  396

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL +AC + +  C+ + P  +CY P S++ HA+YAFSSYWA+FR  G TC+FNGLAV+T 
Sbjct  397  ALEFACKR-DGICDELSPEKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTT  455

Query  235  NDPSYGACKYPSITL  191
             DPS+G+CK+P ++L
Sbjct  456  LDPSHGSCKFPYVSL  470



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +  A
Sbjct  334  ERHWGLLRSDGSPNYQIDLTGKESSVEYDPLPVVENNAPFRGRLWCVAARGVDLMELEAA  393

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  
Sbjct  394  VDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTV  453

Query  232  DPSYGACKYPSITL  191
            DPS G+C++PS+T 
Sbjct  454  DPSNGSCRFPSVTF  467



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +   
Sbjct  328  ERHWGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGAT  387

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  
Sbjct  388  VDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTT  447

Query  232  DPSYGACKYPSITL  191
            DPS G+C++PS+T 
Sbjct  448  DPSNGSCRFPSVTF  461



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+   + +A
Sbjct  347  QRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  
Sbjct  407  LRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTV  466

Query  232  DPSYGACKYPSITL  191
            +P    CK+P +TL
Sbjct  467  NPGNDRCKFPGVTL  480



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+   + +A
Sbjct  347  QRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEAQLEEA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  
Sbjct  407  LRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTV  466

Query  232  DPSYGACKYPSITL  191
            +P    CK+P +TL
Sbjct  467  NPGNDRCKFPGVTL  480



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  A
Sbjct  343  ERHWGILNHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGSVWCVAVDGAGEAELGQA  402

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGL+ +T  
Sbjct  403  LNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLSRETTT  462

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  463  NPGNERCKFPSVTL  476



>ref|NP_001168659.1| uncharacterized protein LOC100382447 [Zea mays]
 gb|ACN29077.1| unknown [Zea mays]
Length=384

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 11/133 (8%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+ YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN TA
Sbjct  254  ERHWGLYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAANETA  306

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V+ A++YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+GLA 
Sbjct  307  VSAAVAYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAE  366

Query  244  KTINDPSYGACKY  206
             T  DPS+G CK+
Sbjct  367  TTTEDPSHGLCKF  379



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKP  N PYKG VWCV    A+   + +A
Sbjct  347  QRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPKNNVPYKGIVWCVPVEGASEAQLEEA  406

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA  T  
Sbjct  407  LRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLARMTTI  466

Query  232  DPSYGACKYPSITL  191
            +P    CK+P +TL
Sbjct  467  NPGNDRCKFPGVTL  480



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 11/133 (8%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAANLTA  425
            ERH+G+ YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN TA
Sbjct  352  ERHWGLYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAANETA  404

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V+ A++YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+GLA 
Sbjct  405  VSAAVAYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAE  464

Query  244  KTINDPSYGACKY  206
             T  DPS+G CK+
Sbjct  465  TTTEDPSHGLCKF  477



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A    +  A
Sbjct  343  ERHWGILNHDGTPIYEIDFSGTI--SSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQA  400

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA +T  
Sbjct  401  LNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTT  460

Query  232  DPSYGACKYPSITL  191
            +P    CK+PS+TL
Sbjct  461  NPGNERCKFPSVTL  474



>ref|XP_008669802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Zea 
mays]
 tpg|DAA38972.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=472

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 4/138 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTAVAD  416
            ERH+G+ YPNG+ +Y +DL+G+ P + +PPLP  T +QPY+G +WCVV  A  N TAV +
Sbjct  334  ERHWGLFYPNGSAVYEVDLTGRRPLASYPPLPPATNDQPYRGPLWCVVRTAGINETAVRE  393

Query  415  ALSYACGQG---NRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
             ++  C      +  C+P++PGGAC+ PN++  HASY FS++W +F    G CYF+G  +
Sbjct  394  QVAAVCDDDEAEDALCDPVRPGGACFLPNTVAAHASYVFSAHWNRFSEDYGACYFDGWGM  453

Query  244  KTINDPSYGACKYPSITL  191
            +T  DPS+G+CK+PSI L
Sbjct  454  ETTIDPSHGSCKFPSIHL  471



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L P+GT +YPIDL+G   ++ F PL +P  N  YKGKVWCVV   AN+T +  A
Sbjct  341  ERHWGLLKPDGTPVYPIDLTGA--QTNFGPLRQPENNMGYKGKVWCVVDKMANITELGPA  398

Query  412  LSYACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            L   C + N TC   + PG  CY P S++ HAS+AF++YWA+FR  G  CYF GLA  T 
Sbjct  399  LRRTCSRLNETCELSLGPGKHCYEPVSVVWHASFAFNAYWAKFRDSGEICYFGGLASLTT  458

Query  235  NDPSYGACKYPSITL  191
             +PS+G+C +PS+T+
Sbjct  459  RNPSHGSCHFPSVTI  473



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ERH+G+ YPN + +Y +DLSG+ T  S +PPLP  T + PY GK+WC+    AN TAV +
Sbjct  337  ERHWGLFYPNSSAVYEVDLSGRRTAASSYPPLPPATNDAPYPGKLWCMTKKLANGTAVRE  396

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF-RSLGGTCYFNGLAVKT  239
             ++ AC      C+P++PGG C+ P+++  HASY FS++W +F +  GG CYF GLAV+T
Sbjct  397  QVAAACKDEAALCDPVRPGGRCHLPDTVAAHASYVFSAHWNRFSKQYGGWCYFAGLAVET  456

Query  238  INDPSYGACKYPSI  197
              DPS+G+C+YPS+
Sbjct  457  TIDPSHGSCRYPSV  470



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 88/139 (63%), Gaps = 5/139 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP-----YKGKVWCVVAPAANLT  428
            ERH+G+L P+GT +Y ID +G+ P S + P  KP           K + WCVV   A++ 
Sbjct  351  ERHWGILRPSGTPVYEIDFTGRKPVSGYGPPAKPGNGGVGVAPCKKRRAWCVVKEGADVA  410

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  AL +ACG+ N TC+ + PG  CY P ++  HASYAFSSYWAQFRS    CYFNGLA
Sbjct  411  ALGQALGFACGRSNETCSALAPGRECYQPVTITWHASYAFSSYWAQFRSQNARCYFNGLA  470

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DP  G CK+PS+ L
Sbjct  471  RETTVDPGNGRCKFPSVAL  489



>gb|EEC76518.1| hypothetical protein OsI_14304 [Oryza sativa Indica Group]
Length=175

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVA  419
            ERH+G+ +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN TAV 
Sbjct  38   ERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVR  97

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVK  242
            + +  AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GLA++
Sbjct  98   EQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAME  157

Query  241  TINDPSYGACKYPSIT  194
            T  DPS+G+CK+PS+T
Sbjct  158  TTTDPSHGSCKFPSVT  173



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L  +   
Sbjct  334  ERHWGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLMELGAT  393

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            +   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA +T  
Sbjct  394  VDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLAEQTTT  453

Query  232  DPS  224
            DP+
Sbjct  454  DPN  456



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVA  419
            ERH+G+ +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN TAV 
Sbjct  337  ERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVR  396

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVK  242
            + +  AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GLA++
Sbjct  397  EQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAME  456

Query  241  TINDPSYGACKYPSIT  194
            T  DPS+G+CK+PS+T
Sbjct  457  TTTDPSHGSCKFPSVT  472



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVA  419
            ERH+G+ +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN TAV 
Sbjct  337  ERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVR  396

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVK  242
            + +  AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GLA++
Sbjct  397  EQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAME  456

Query  241  TINDPSYGACKYPSIT  194
            T  DPS+G+CK+PS+T
Sbjct  457  TTTDPSHGSCKFPSVT  472



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 87/135 (64%), Gaps = 6/135 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK------TPESEFPPLPKPTTNQPYKGKVWCVVAPAANL  431
            ERH+G+ YPNGT +Y +DL G+       P     P P    + P +  +WCV+ P  + 
Sbjct  347  ERHWGLFYPNGTAVYQVDLGGRRRSYPPLPSPPPSPSPSTPPSPPAEQGLWCVLLPGKDE  406

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
             AVA AL+YACGQG+ TC  IQPG  C+ PN+L  HASYAF+SYW QFR  G +C FNGL
Sbjct  407  KAVAAALNYACGQGSGTCAAIQPGAVCFEPNTLDAHASYAFNSYWQQFRKSGASCSFNGL  466

Query  250  AVKTINDPSYGACKY  206
            A  T  DPS+G+CK+
Sbjct  467  ATTTTTDPSHGSCKF  481


 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
            VWCV+AP  +  AV  AL+YACGQG  TC  IQPGGAC+ PN+L  HASYAF+SYW QFR
Sbjct  500  VWCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQQFR  559

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
              GG+C FNGLAV T  DPS+G+CK+PS
Sbjct  560  KTGGSCSFNGLAVTTTADPSHGSCKFPS  587



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVAP--AANLTA  425
            ERH+G+ YPNG+ +Y +DL+G+   S +PPLP    T + P     WCV+    AAN TA
Sbjct  353  ERHWGLYYPNGSRVYEVDLTGR--RSSYPPLPPADDTDSAP----AWCVLGSKAAANETA  406

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            VA A++YAC QG+ TC  IQPGGAC+ P+ +  HASYAF++YW QFR  GGTC+F+GLAV
Sbjct  407  VAAAVAYACQQGSGTCAAIQPGGACHEPDMMDAHASYAFNAYWQQFRGAGGTCFFDGLAV  466

Query  244  KTINDPSYGACKYPS  200
             T  DPS+G+CK+ S
Sbjct  467  TTTKDPSHGSCKFAS  481



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN   + +A
Sbjct  293  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEA  352

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  353  LRMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRS  396



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            +RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T + +A
Sbjct  293  QRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEA  352

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
            L  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  353  LRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRS  396



>ref|XP_001777261.1| predicted protein [Physcomitrella patens]
 gb|EDQ57916.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 12/143 (8%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPK------------PTTNQPYKGKVWCVV  449
            E+H+G+LYPNGTN+Y ID++G   + ++ PL              P  N P     WCV 
Sbjct  310  EKHWGLLYPNGTNVYSIDMTGTLSDGQYTPLSDNPIFTTAPPPTLPPGNVPSTTGTWCVA  369

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
             P  N   +  AL +ACG G   C P+Q GG+CYNP++++ H+SYAF+SY+ + ++ GG+
Sbjct  370  KPGMNPPMLQAALDFACGPGGADCQPLQVGGSCYNPDTILDHSSYAFNSYYQRTKAAGGS  429

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A  T  DPS+  CK+P+
Sbjct  430  CNFGGAATLTTTDPSHDTCKFPT  452



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTN-QPYKGKVWCVVAPA---ANLTA  425
            ERH+G+ YPNG+ +Y +DL+G+       P   P +N +PY G +WCVVA      N TA
Sbjct  345  ERHWGLFYPNGSAVYEVDLTGRRRSLPSYPPLPPASNDRPYPGPLWCVVATDKGPVNETA  404

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            V   ++ AC      C+P++PGGAC+ P+++  HASY FS++W +F    G CYF G AV
Sbjct  405  VRAQVAAACADVPGLCDPVRPGGACFLPDTVSAHASYVFSAHWNRFSEDYGGCYFAGFAV  464

Query  244  KTINDPSYGACKYPSITL  191
            +T  DPS+G+CK+PSI L
Sbjct  465  ETTVDPSHGSCKFPSILL  482



>ref|XP_001780045.1| predicted protein [Physcomitrella patens]
 gb|EDQ55148.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 12/142 (8%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPL---------PKPTTN---QPYKGKVWCVV  449
            E+H+G+LYPNGTN+Y ID++G   + ++ PL         P PT +    P     WCV 
Sbjct  310  EKHWGLLYPNGTNVYSIDMTGMLSDGQYSPLSDNPVFTSAPPPTFSPGLVPSTSGTWCVA  369

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
                    +  AL +ACG G   C P+Q GG+C+NPN++  H+SYAF+SY+ + ++ GG+
Sbjct  370  KSGIGQEMLQGALDFACGAGGADCQPLQAGGSCFNPNTIHDHSSYAFNSYYQKTKAAGGS  429

Query  268  CYFNGLAVKTINDPSYGACKYP  203
            C F G A+ +  DPS+G CK+P
Sbjct  430  CNFGGAAMLSTTDPSHGTCKFP  451



>dbj|BAE80092.1| glycosyl hydrolase family 17 [Silene latifolia]
Length=439

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ERH+G++ PNGT +Y IDL+G   ++EF PLP  T N PYKG+VWCVV  +AN+T +   
Sbjct  330  ERHWGLVKPNGTPVYQIDLTGT--QTEFDPLPNATNNMPYKGEVWCVVQRSANMTELGSM  387

Query  412  LSYACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            ++  C + N TC   I PG  CY P S++ HASY FS+YWAQFR  G  C F
Sbjct  388  VTNLCSRLNGTCEAAIGPGNDCYQPVSILWHASYTFSAYWAQFRRHGTYCQF  439



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 10/139 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCVV-APAANLT  428
            ER++G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV  A   +  
Sbjct  309  ERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCVAKADYVSTA  367

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  GGTC FNG A
Sbjct  368  DVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSGGTCAFNGFA  427

Query  247  VKTINDPSYGACKYPSITL  191
              T  DPS    K+ S +L
Sbjct  428  KLTSVDPS----KFRSFSL  442



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 10/139 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCVV-APAANLT  428
            ER++G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV  A   +  
Sbjct  309  ERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCVAKADYVSTA  367

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  GGTC FNG A
Sbjct  368  DVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSGGTCAFNGFA  427

Query  247  VKTINDPSYGACKYPSITL  191
              T  DPS    K+ S +L
Sbjct  428  KLTSVDPS----KFRSFSL  442



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            ER++G+ YP+   +Y I L+ + P     +S+ P     TT+   KG+ WCV    ++  
Sbjct  326  ERNYGLFYPSQKKVYDIQLTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEK  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL+YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF G A
Sbjct  384  KLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTA  443

Query  247  VKTINDPSYGACKYPS  200
                  P YG C++P+
Sbjct  444  YVVTQPPKYGNCEFPT  459



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 13/143 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVV  449
            ER++G+ YPN   +Y I LS K       P P    NQ               G+ WC+ 
Sbjct  327  ERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMA  385

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
            +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+
Sbjct  386  SPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGS  445

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C+F+G A  +   PS+G C++P+
Sbjct  446  CFFSGTAYVSTQRPSFGNCQFPT  468



>gb|KJB13749.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
 gb|KJB13750.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
Length=470

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 13/143 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVV  449
            ER++G+ YPN   +Y I LS K       P P    NQ               G+ WC+ 
Sbjct  327  ERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNWGGVSKATSGQTWCMA  385

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
            +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+
Sbjct  386  SPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGS  445

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C+F+G A  +   PS+G C++P+
Sbjct  446  CFFSGTAYVSTQPPSFGNCQFPT  468



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 9/140 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPES-EFPPL-----PKPTTNQPYKGKV---WCVVAPA  440
            ER++G+ YPN   +Y I L+ +  ++ E  P+     P P   +  K KV   WCV    
Sbjct  328  ERNYGLFYPNEQKVYTIPLTKEEVKTGESTPVNTNTSPAPVAGEVSKAKVGQTWCVANEK  387

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F
Sbjct  388  ADEKKLQAALDYACGEGEADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEF  447

Query  259  NGLAVKTINDPSYGACKYPS  200
            +G A      P+YG C++P+
Sbjct  448  DGAAYVVTQRPTYGNCEFPT  467



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 13/129 (10%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GVL+ NG+ +YP+ L   TP                   ++CV    A+   + D 
Sbjct  329  EKNWGVLFTNGSTVYPLTLGTSTPTGN-------------SSGLFCVAKSEADPDKLEDG  375

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C PIQ G  CY PN+L+ HASYA++ Y+ + +S+GGTC F+G A  T  
Sbjct  376  LNWACGQGQADCTPIQQGQGCYLPNTLVNHASYAYNDYYQRMQSVGGTCDFDGTAKTTTI  435

Query  232  DPSYGACKY  206
            DPSYG+CK+
Sbjct  436  DPSYGSCKF  444



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 9/140 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPA  440
            ER++G+ YPN   +Y I L+ +  ++ +  P+   T+  P  G+V        WCV    
Sbjct  328  ERNYGLFYPNEQKVYNIPLTKEEAKTGQSTPVNSNTSQVPVAGEVSKAKVGQTWCVANGK  387

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +   + GTC F
Sbjct  388  ADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRVTGTCEF  447

Query  259  NGLAVKTINDPSYGACKYPS  200
             G A      P+YG+C++P+
Sbjct  448  GGAAYVVSQRPTYGSCEFPT  467



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (59%), Gaps = 11/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+L+PNGT++YP+ LSG +  +                 ++CV    A+   + D 
Sbjct  329  ERNWGILFPNGTSVYPLSLSGGSNSAAL-----------NDSSMFCVAKADADDDKLIDG  377

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C  IQPG  CY PN +  HAS+AF+ Y+ + +S GGTC F+G A+ T  
Sbjct  378  LNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTR  437

Query  232  DPSYGACKY  206
            DPSY  C Y
Sbjct  438  DPSYRTCAY  446



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 9/140 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPA  440
            ER++G+ YPN   +Y I L+ +  ++ E  P+   T+  P  G+V        WCV    
Sbjct  328  ERNYGLFYPNEQKVYNIPLTKEEAKTGESTPVNSNTSQVPVAGEVSKAKVGQTWCVANGK  387

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F
Sbjct  388  ADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEF  447

Query  259  NGLAVKTINDPSYGACKYPS  200
             G A      P+YG C++P+
Sbjct  448  GGAAYVVSQRPTYGNCEFPT  467



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVAPAANLTAVAD  416
            ERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A      A   
Sbjct  340  ERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANET  399

Query  415  AL----SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+     YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA
Sbjct  400  AVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLA  459

Query  247  VKTINDPS  224
             KT  DPS
Sbjct  460  EKTTIDPS  467



>ref|XP_001784285.1| predicted protein [Physcomitrella patens]
 gb|EDQ50891.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPP----LPKPTTNQPYKGKVWCVVAPAANLTA  425
            ER++G+LYP+ T +Y +DL+G+  + ++ P       P++        WCV + AA+   
Sbjct  303  ERNWGLLYPDLTPVYAVDLTGQLLDHQYAPNSVSTGPPSSPSSAGSGSWCVSSAAADPVT  362

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            + + L+YAC      C  +QPG +C+ PN++  HAS+AF+SYW ++RS GG+C F+G A 
Sbjct  363  LENGLNYACNANEEFCAALQPGQSCHLPNTVASHASWAFNSYWQKYRSAGGSCSFDGAAT  422

Query  244  KTINDPSYGACKYP  203
             T  DPS+G C +P
Sbjct  423  LTSIDPSFGTCLFP  436



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVAPAANLTAVAD  416
            ERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A      A   
Sbjct  340  ERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANET  399

Query  415  AL----SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+     YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA
Sbjct  400  AVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLA  459

Query  247  VKTINDPS  224
             KT  DP+
Sbjct  460  EKTTIDPT  467



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVA----PAANLT  428
            ERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A     AAN T
Sbjct  340  ERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAANET  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA A+ YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFNGLA
Sbjct  400  AVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFNGLA  459

Query  247  VKTINDPSY  221
             KT  DP++
Sbjct  460  EKTTIDPTF  468



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 0/131 (0%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+ YP    +Y I L          P+    +    KG+ WCV +  ++   + +A
Sbjct  249  ERNYGLFYPTEKKVYDIPLPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNA  308

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L+YACG+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A     
Sbjct  309  LNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQ  368

Query  232  DPSYGACKYPS  200
             P YG C++P+
Sbjct  369  PPKYGNCEFPT  379



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 9/137 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLS-GKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPAANL  431
            ER++G+ YPN   +Y + LS GK+      + + PP+ KP++   + G+ WCV       
Sbjct  325  ERNYGLFYPNENKVYDVSLSSGKSTPVEDNKEKVPPVVKPSS---HVGQTWCVANGKTTK  381

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              + + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G 
Sbjct  382  EKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGVGTCDFKGA  441

Query  250  AVKTINDPSYGACKYPS  200
            A      P YG C++P+
Sbjct  442  AYVVSQPPKYGKCEFPT  458



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 8/139 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFP--------PLPKPTTNQPYKGKVWCVVAPAA  437
            ER++G+ YP    +Y I L+ +  +   P        P+    +    KG+ WCV +  +
Sbjct  332  ERNYGLFYPTEKKVYDIPLTAEEIKEAPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGS  391

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            +   + +AL+YACG+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F 
Sbjct  392  SEKKLQNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFG  451

Query  256  GLAVKTINDPSYGACKYPS  200
            G A      P YG C++P+
Sbjct  452  GTAYVVTQPPKYGNCEFPT  470



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 76/129 (59%), Gaps = 11/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++G+L+PNGT++YP+ LSG              +  P    ++CV    A    + D 
Sbjct  329  EKNWGILFPNGTSVYPLSLSGGA-----------NSASPNGSSLFCVAKADAEDDKLVDG  377

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C  IQPG  CY P+++  HAS+A++ Y+ + +S GGTC F+G A+ T  
Sbjct  378  LNWACGQGQANCAAIQPGHPCYLPDNIKSHASFAYNDYYQKMKSAGGTCDFSGTAITTTR  437

Query  232  DPSYGACKY  206
            DPSY  C Y
Sbjct  438  DPSYKTCAY  446



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV Y NG+ +YP+ L+            + T N      V+CV    A+   + D 
Sbjct  304  EKNWGVFYTNGSAVYPLSLNDSN---------QITGN---SSGVFCVAKADADPDKLQDG  351

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C PIQ G  CY P+S++ HASYAF+ Y+ + +S GGTC F+G A+ T  
Sbjct  352  LNWACGQGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTV  411

Query  232  DPSYGACKY  206
            DPS+GACK+
Sbjct  412  DPSHGACKF  420



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV Y NG+ +YP+ L+            + T N      V+CV    A+   + D 
Sbjct  329  EKNWGVFYTNGSAVYPLSLNDSN---------QITGN---SSGVFCVAKADADPDKLQDG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C PIQ G  CY P++++ HASYAF+ Y+ + +S GGTC F+G A+ T  
Sbjct  377  LNWACGQGGANCTPIQKGQRCYLPDTIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTV  436

Query  232  DPSYGACKY  206
            DPSYGACK+
Sbjct  437  DPSYGACKF  445



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 82/150 (55%), Gaps = 20/150 (13%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPT------TNQPY-------------K  470
            ER+FG+ YP+   +Y I L+ +  ++ +   P P       TNQP               
Sbjct  325  ERNFGLFYPSEEKVYDIPLTVEALKN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTT  383

Query  469  GKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQ  290
            G  WCV  P A+   +  AL +ACG+G   C  IQPG  CYNPN+L+ HAS+AF+SY+ +
Sbjct  384  GDTWCVANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQK  443

Query  289  FRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
                GG+C+F G +     +P YG+C++P+
Sbjct  444  QARAGGSCFFGGTSYVVTQEPKYGSCEFPT  473



>ref|XP_008449141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=454

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 2/131 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+ YPN   +Y I L+G    +  PP    +  +   G+ WCV         +   
Sbjct  325  ERNYGLFYPNEEKVYEISLTGDVVGAT-PPDSNGSKVE-VTGQTWCVANENVGAEKLQAG  382

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L YACG+G   C  IQ GGACY+PNSL  HASYAF+SY+ + +   GTC F G A     
Sbjct  383  LDYACGEGQADCRSIQQGGACYDPNSLQAHASYAFNSYYQKMKRAAGTCDFGGAAYIVTQ  442

Query  232  DPSYGACKYPS  200
             P YG C +PS
Sbjct  443  PPQYGKCDFPS  453



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 11/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++G+L+PNGT++YP+ LSG +  +                 ++CV    A+   + D 
Sbjct  329  EKNWGILFPNGTSVYPLSLSGGSNSASV-----------NGSSMFCVAKADADDDKLVDG  377

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C  IQPG  CY PN++  HAS+A++ Y+ + +S GGTC F+G A+ T  
Sbjct  378  LNWACGQGQANCAAIQPGHPCYLPNNVKSHASFAYNDYFQKMKSAGGTCDFSGTAITTTR  437

Query  232  DPSYGACKY  206
            DPSY  C Y
Sbjct  438  DPSYKTCAY  446



>ref|XP_006280442.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
 gb|EOA13340.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
Length=457

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKT----PESEFPPLPKPTTNQPYKGKVWCVVAPAANLTA  425
            ER++G+ YPN   +Y + LSGK+     E E     KP+    + G+ WCV         
Sbjct  325  ERNYGLFYPNENKVYDVSLSGKSTPVNDEKEKVTPVKPS----HVGQTWCVANGKTTKEK  380

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            + + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G A 
Sbjct  381  LQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGTGTCDFKGAAY  440

Query  244  KTINDPSYGACKYPS  200
                 P YG C++P+
Sbjct  441  VVSQPPKYGKCEFPT  455



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-----GKVWCVVAPAANLT  428
            ER+FG+ YPN   +Y I L+ +  +S +  +  P T    +     G+ WCV    A   
Sbjct  328  ERNFGLFYPNQKKVYDIPLTAEGLKS-YRDIQSPVTGGEQRVSTANGQTWCVAKEEAGKE  386

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
              +  L YACG+G   C+PIQPG  C++PN+L  HAS+AF+SY+ +     GTCYF G A
Sbjct  387  KQSSGLDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYYQKKGRAIGTCYFGGAA  446

Query  247  VKTINDPSYGACKYP  203
                  P YG C +P
Sbjct  447  YIVTQQPKYGKCDFP  461



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+ Y NG+ +YP+ LSG  P +               G V+C+     +   + D 
Sbjct  329  ERNWGMFYSNGSAVYPLSLSGSEPAA-----------LNGSGGVFCMAREETDPDKLQDG  377

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C  IQ G  CY PN+L  HAS+A++ Y+ + RS+GGTC F+G A+ T  
Sbjct  378  LNWACGQGRANCAAIQQGQPCYLPNNLKSHASFAYNDYYQKMRSVGGTCDFDGTAITTTR  437

Query  232  DPSYGACKY  206
            DPSYG C Y
Sbjct  438  DPSYGKCIY  446



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 71/133 (53%), Gaps = 14/133 (11%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVA  419
            ER++G+ YPN   +Y +            P P  T   P  ++G+ WCV    A    + 
Sbjct  329  ERNYGLFYPNERRVYAV------------PFPATTEQAPVAHEGESWCVSNGDAAKEKLQ  376

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
             AL YACG+G   C PIQPG  CYNP SL  HAS+AF+SY+ +     GTCYF G A   
Sbjct  377  AALDYACGEGGADCRPIQPGATCYNPKSLEAHASFAFNSYYQKNARRVGTCYFGGTAHVV  436

Query  238  INDPSYGACKYPS  200
               P YG CK+P+
Sbjct  437  TQHPRYGKCKFPT  449



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV Y NG+ +YP+ L+            + T N      V+CV    A+   + D 
Sbjct  310  EKNWGVFYTNGSAVYPLSLNDSN---------QITGN---SSGVFCVAKADADPDKLQDG  357

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C PIQ G  CY P+S++ HASYAF+ Y+ + +S GGTC F+G A+ T  
Sbjct  358  LNWACGQGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTV  417

Query  232  DPSYGACKY  206
            DPS+GACK+
Sbjct  418  DPSHGACKF  426



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV Y NG+ +YP+ L+            + T N      V+CV    A+   + D 
Sbjct  329  EKNWGVFYTNGSAVYPLSLNDSN---------QITGN---SSGVFCVAKADADPDKLQDG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C PIQ G  CY P+S++ HASYAF+ Y+ + +S GGTC F+G A+ T  
Sbjct  377  LNWACGQGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTV  436

Query  232  DPSYGACKY  206
            DPS+GACK+
Sbjct  437  DPSHGACKF  445



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 8/135 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTP----ESEFPPLPKPTTNQPYKGKVWCVVAPAANLTA  425
            ER++G+ YP    +Y  D +   P    +S+ P     TT+   KG+ WCV    ++   
Sbjct  326  ERNYGLFYPTEKKVY--DTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSSEKK  381

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            + +AL+YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF G A 
Sbjct  382  LQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFGGTAY  441

Query  244  KTINDPSYGACKYPS  200
                 P YG C++P+
Sbjct  442  VVTQPPKYGNCEFPT  456



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV + NGT++YP++ SG           +   N      V+CV    A+   + + 
Sbjct  329  EKNWGVFFTNGTSVYPLNFSGSG---------QIIGN---SSGVFCVAKDDADSDKLQNG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG+  C+ IQPG  CY PN++  HASYA++ Y+ + RS+GGTC F+G A+ T  
Sbjct  377  LNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDGTAMTTTK  436

Query  232  DPSYGACKY  206
            DPSYG+C Y
Sbjct  437  DPSYGSCTY  445



>emb|CDY14214.1| BnaA08g13450D [Brassica napus]
Length=513

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 78/129 (60%), Gaps = 4/129 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+ Y NGT++Y +D +G++      P P   +N     K WCV +  A++T +  A
Sbjct  327  ERNWGMFYANGTSVYALDFTGEST----VPGPVSPSNSTTGAKKWCVASSQASVTELQSA  382

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG GN  C+ +QP   C+ P++++ HASYAF++Y+ Q       C F G++V+   
Sbjct  383  LDWACGPGNVDCSAVQPNQLCFEPDTVLSHASYAFNTYYQQSGGSSLDCSFGGVSVEVDK  442

Query  232  DPSYGACKY  206
            DPSYG C Y
Sbjct  443  DPSYGNCLY  451



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GV + NGT++YP++ SG           +   N      V+CV    A+   + + 
Sbjct  329  EKNWGVFFTNGTSVYPLNFSGSG---------QIIGN---SSGVFCVAKDDADSDKLQNG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG+  C+ IQPG  CY PN++  HASYA++ Y+ + RS+GGTC F+G A+ T  
Sbjct  377  LNWACGQGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDGTAMTTTK  436

Query  232  DPSYGACKY  206
            DPSYG+C Y
Sbjct  437  DPSYGSCTY  445



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 17/148 (11%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLS----------------GKTPESEFP-PLPKPTTNQPYKGK  464
            ER+FG+ YP+   +Y + L+                G   + E P P+     ++   G 
Sbjct  322  ERNFGLFYPDERRVYNVPLTVEELKDYHDRPSAPVNGGGQKKETPAPVVSGGVSKSTTGN  381

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV  P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+ +  
Sbjct  382  TWCVANPDADKVKLQAALDFACGEGGSDCGPIQRGATCYDPNTLVAHASFAFNSYYQKQS  441

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
              GG+CYF G +     +P YG+C++P+
Sbjct  442  RKGGSCYFGGTSYVVTQEPRYGSCEFPT  469



>ref|XP_002864380.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40639.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 73/132 (55%), Gaps = 2/132 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER++G+ YPN   +Y + LSGK TP ++      P     + G+ WCV         + +
Sbjct  329  ERNYGLFYPNENKVYDVSLSGKSTPVNDNKEKVVPV-KPSHVGQTWCVANGKTTKEKLQE  387

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A    
Sbjct  388  GLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCDFGGAAYVVS  447

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  448  QPPKYGKCEFPT  459



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 16/130 (12%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPY--KGKVWCVVAPAANLTAVAD  416
            +++GVL+ NG+++YP+ LS              T+NQ       V+CV    A+   + D
Sbjct  330  KNWGVLFTNGSSVYPLSLS--------------TSNQITGNSSGVFCVAKADADPDKLQD  375

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L++ACGQG   C PIQ G  CY PN++  HASYAF+ Y+ + +S+GGTC F+  A+ T 
Sbjct  376  GLNWACGQGQANCTPIQKGQRCYLPNTIANHASYAFNDYYQKMQSVGGTCDFDDTAMTTT  435

Query  235  NDPSYGACKY  206
             DPSYG+CK+
Sbjct  436  VDPSYGSCKF  445



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 80/149 (54%), Gaps = 18/149 (12%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTP--------------ESEFPPLPKPTTN----QPYKG  467
            ER+FG+ YP+   +Y + L+ +                + +  P P P  +    +   G
Sbjct  322  ERNFGLFYPDERRVYNVPLTTEELKDYHDRPAPVSGGGQQKGTPAPAPVVSGGVSKSTTG  381

Query  466  KVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF  287
              WCV  P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+ + 
Sbjct  382  NTWCVANPDADKVKLQAALDFACGEGGADCRPIQRGSTCYDPNTLVAHASFAFNSYYQKQ  441

Query  286  RSLGGTCYFNGLAVKTINDPSYGACKYPS  200
               GG+CYF G +     +P YG+C++P+
Sbjct  442  SRKGGSCYFGGTSYVVTQEPKYGSCEFPT  470



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 16/130 (12%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPY--KGKVWCVVAPAANLTAVAD  416
            +++GVL+ NG+++YP+ LS              T+NQ       V+CV    A+   + D
Sbjct  330  KNWGVLFTNGSSVYPLSLS--------------TSNQITGNSSGVFCVAKADADPDKLQD  375

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L++ACGQG   C PIQ G  CY PN++  HASYAF+ Y+ + +S+GGTC F+  A+ T 
Sbjct  376  GLNWACGQGQANCTPIQEGQRCYLPNTIANHASYAFNDYYQKMQSVGGTCDFDDTAMTTS  435

Query  235  NDPSYGACKY  206
             DPSYG+CK+
Sbjct  436  VDPSYGSCKF  445



>gb|KHN10950.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=397

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
            AL+YAC QGN TC+PIQP G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA +T 
Sbjct  330  ALAYACSQGNGTCDPIQPKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTA  389

Query  235  NDPS  224
             DPS
Sbjct  390  KDPS  393



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLTAVA  419
            ER++G+ YPN   +Y +  +  T      P+ +     P  ++G+ WCV    A    + 
Sbjct  335  ERNYGLFYPNERKVYAVPFAATTST----PVNRNKEQAPVAHEGETWCVSNGDAAKEKLQ  390

Query  418  DALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKT  239
             AL YACG+G   C PIQPG  CY+P SL  HAS+AF+SY+ +     GTCYF G A   
Sbjct  391  AALDYACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVV  450

Query  238  INDPSYGACKYPS  200
               P YG CK+P+
Sbjct  451  TQHPRYGKCKFPT  463



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 79/139 (57%), Gaps = 11/139 (8%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKV------WCVVAPAA--  437
            ER++G+ YP+GT +YPI LS   P      +P                  WCVV+P A  
Sbjct  354  ERNWGLFYPDGTPVYPIVLSNDAPALSHISVPSQNNGPLPASPPSPVSPQWCVVSPVAVA  413

Query  436  --NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCY  263
              + T++  AL YACG G   C+ I+PG  CY PN+L+ HASYAF+SYW + ++   TC 
Sbjct  414  QVDETSLQAALDYACGAG-ADCSLIEPGEPCYLPNTLVSHASYAFNSYWQKTKAADATCD  472

Query  262  FNGLAVKTINDPSYGACKY  206
            F+G AV T +DPS G C +
Sbjct  473  FHGAAVLTSSDPSVGDCVF  491



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GVL+ NGT +YP+ LSG +         + T N      V+CV     +   + D 
Sbjct  329  EKNWGVLFLNGTAVYPLSLSGSS---------QITGNST---TVFCVAKDDTSEDKLQDG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C+ IQ G  CY PN++  HASYA++ Y+ +  SLGGTC F+G A  T N
Sbjct  377  LNWACGQGQANCSAIQSGQPCYLPNNIKNHASYAYNDYYQKMHSLGGTCDFDGTATTTTN  436

Query  232  DPSYGACKY  206
            +PSYG+C +
Sbjct  437  NPSYGSCIF  445



>gb|KFK29190.1| hypothetical protein AALP_AA7G101400 [Arabis alpina]
Length=461

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 9/138 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPID-LSGKTPESEFP------PLPKPTTNQPYKGKVWCVVAPAAN  434
            ER++G+ YPN   +Y +  ++GK  +S         P+P P      +G+ WCV    A 
Sbjct  324  ERNYGLFYPNEAKVYDVPFVAGKKRKSPLKGNRGHAPVPVPAVAD--EGEKWCVSNGEAG  381

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
            +  +  AL YACG+G   C+PIQPG  C+NP SL  HASYAF+SY+ +     GTC+F G
Sbjct  382  MEKLQAALDYACGEGGADCSPIQPGATCFNPESLEAHASYAFNSYYQKNARRVGTCFFGG  441

Query  253  LAVKTINDPSYGACKYPS  200
             A      P YG C +P+
Sbjct  442  AAHVVTQPPRYGKCDFPT  459



>ref|XP_004161885.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13-like [Cucumis sativus]
Length=458

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 1/132 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVAD  416
            ER++G+ YPN   +Y I L+    E      P    ++  K G+ WCV         +  
Sbjct  325  ERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQA  384

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C+ IQPG  CYNPNSL  HASYAF+SY+ + +   GTC F G A    
Sbjct  385  GLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVT  444

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  445  QPPQYGQCEFPT  456



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 1/132 (1%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTAVAD  416
            ER++G+ YPN   +Y I L+    E      P    ++  K G+ WCV         +  
Sbjct  325  ERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEKLQA  384

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C+ IQPG  CYNPNSL  HASYAF+SY+ + +   GTC F G A    
Sbjct  385  GLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAYVVT  444

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  445  QPPQYGQCEFPT  456



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 75/128 (59%), Gaps = 12/128 (9%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  410
            R++GVL+ NGT +Y I LS  T ES                 V+C+    A+ T++ D L
Sbjct  329  RNWGVLFTNGTAVYDIKLS--TSESL----------DANSSAVFCIARSGADETSLQDGL  376

Query  409  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  230
            ++ACG G   C PIQ G  CY PN+L  HASYA++ Y+ + RS GGTC F G A  T  D
Sbjct  377  NWACGPGQANCGPIQQGQPCYIPNTLQNHASYAYNDYYQKMRSSGGTCDFGGTATTTTVD  436

Query  229  PSYGACKY  206
            PSYG+C++
Sbjct  437  PSYGSCRF  444



>ref|XP_010443128.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Camelina 
sativa]
Length=461

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLS-GKT-----PESEFPPLPKPTTNQPYKGKVWCVVAPAANL  431
            ER++G+ YPN   +Y + LS GK+      + +  P+ KP++   + G+ WCV       
Sbjct  326  ERNYGLFYPNENKVYDVSLSSGKSTPVEDDKEKATPVVKPSS---HVGQTWCVANGKTTK  382

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              + + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G 
Sbjct  383  EKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGVGTCDFKGA  442

Query  250  AVKTINDPSYGACKYPS  200
            A      P YG C++P+
Sbjct  443  AYVVSQPPKYGKCEFPT  459



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 ref|XP_004156096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 76/148 (51%), Gaps = 17/148 (11%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTT----------------NQPYKGK  464
            ER++G+ YPN   +Y I  + +   + E  P PKP +                ++   G 
Sbjct  327  ERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVSGGNAPTAPPASGDGGVSKSQTGN  386

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV +  A    +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ +  
Sbjct  387  TWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGATCYNPNTLEAHASYAFNSYYQKNS  446

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
               GTCYF G A      P YG+C++P+
Sbjct  447  RKVGTCYFGGAAYVVTQPPKYGSCEFPT  474



>gb|AAM66024.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=460

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 2/132 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER++G+ YPN + +Y + L+GK TP ++      P       G+ WCV         + +
Sbjct  328  ERNYGLFYPNESKVYDVSLNGKSTPVNDNKEKVVPV-KPSLVGQTWCVANGKTTKEKLQE  386

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A    
Sbjct  387  GLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCNFGGAAYVVS  446

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  447  QPPKYGKCEFPT  458



>ref|XP_010449211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=460

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLS--GK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            ER++G+ YPN   +Y + LS  GK TP  +      P       G+ WCV         +
Sbjct  325  ERNYGLFYPNENKVYDVSLSSGGKSTPVEDNKEKATPVVPSSQVGQTWCVANGKTTKEKL  384

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
             + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G A  
Sbjct  385  QEGLDYACGEGRADCGPIQPGATCYDPESLEAHASYAFNSYYQKNARGVGTCDFKGAAYV  444

Query  241  TINDPSYGACKYPS  200
                P YG C++P+
Sbjct  445  VSQPPKYGKCEFPT  458



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTA  425
            ERH+G+LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+ ++
Sbjct  332  ERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSS  391

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            +   L   C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+  A 
Sbjct  392  LQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAA  447

Query  244  KTINDPSYGACKYPS  200
             T  +PSYG+C +PS
Sbjct  448  LTKINPSYGSCIFPS  462



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAANLTA  425
            ERH+G+LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+ ++
Sbjct  332  ERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDADTSS  391

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            +   L   C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+  A 
Sbjct  392  LQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSSTAA  447

Query  244  KTINDPSYGACKYPS  200
             T  +PSYG+C +PS
Sbjct  448  LTKINPSYGSCIFPS  462



>ref|XP_006849034.1| hypothetical protein AMTR_s00028p00159770 [Amborella trichopoda]
 gb|ERN10615.1| hypothetical protein AMTR_s00028p00159770 [Amborella trichopoda]
Length=122

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -1

Query  466  KVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF  287
            K WC+  P      +  A+++ACG G   C  IQPGG CY+PN ++ HASY F+ YW +F
Sbjct  32   KQWCIADPQTTDEQLQGAMNWACGTGGVNCTKIQPGGECYDPNIVVDHASYVFNDYWQRF  91

Query  286  RSLGGTCYFNGLAVKTINDPSYGACKYPSI  197
            ++ G  CYFN +A+ T  DPS+G+CK+  +
Sbjct  92   KNQGAYCYFNAVALNTGEDPSHGSCKFECL  121



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 80/129 (62%), Gaps = 12/129 (9%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            E+++GVL+ NG+ +YP++L             + T N      V+CV    A+   + + 
Sbjct  329  EKNWGVLFTNGSTVYPLNLGTSG---------RATGN---SSAVFCVAKSDADPDKLQEG  376

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L++ACGQG   C+ IQPG  CY P+SL+ HASYA+++Y+ + RS+GGTC F+G A +T  
Sbjct  377  LNWACGQGQANCSAIQPGQPCYLPDSLVNHASYAYNNYYQRMRSVGGTCDFDGTATQTDT  436

Query  232  DPSYGACKY  206
            DPS G+C +
Sbjct  437  DPSSGSCVF  445



>ref|XP_002961242.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
 gb|EFJ38781.1| hypothetical protein SELMODRAFT_402967 [Selaginella moellendorffii]
Length=489

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 6/130 (5%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  410
            R +G+ + N T +Y +D+SG T       L   +T      K+WCV    A+   +  AL
Sbjct  321  RLWGLFHANQTPVYKLDVSGVTM------LRDSSTGNGSIAKMWCVARSGASDKDLESAL  374

Query  409  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  230
            ++ACG GN  C+ IQ GGACY+P+S+  HASYAF+SY+ +     GTC FNG A  T  D
Sbjct  375  NWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQGNGTCDFNGCATLTSTD  434

Query  229  PSYGACKYPS  200
            PSY +C Y S
Sbjct  435  PSYNSCIYSS  444



>ref|NP_568822.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|ABH04632.1| At5g55180 [Arabidopsis thaliana]
 gb|AED96596.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 72/132 (55%), Gaps = 2/132 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER++G+ YPN   +Y + L+GK TP ++      P       G+ WCV         + +
Sbjct  328  ERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPV-KPSLVGQTWCVANGKTTKEKLQE  386

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A    
Sbjct  387  GLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCNFGGAAYVVS  446

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  447  QPPKYGKCEFPT  458



>gb|AAL77689.1| AT5g55180/MCO15_13 [Arabidopsis thaliana]
Length=460

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 72/132 (55%), Gaps = 2/132 (2%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVAD  416
            ER++G+ YPN   +Y + L+GK TP ++      P       G+ WCV         + +
Sbjct  328  ERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPV-KPSLVGQTWCVANGKTTKEKLQE  386

Query  415  ALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTI  236
             L YACG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A    
Sbjct  387  GLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCNFGGAAYVVS  446

Query  235  NDPSYGACKYPS  200
              P YG C++P+
Sbjct  447  QPPKYGKCEFPT  458



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 77/140 (55%), Gaps = 9/140 (6%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVVAPA  440
            ER++G+ YPN   +Y I L+ +  ES +  P+   T+  P  G+V        WCV    
Sbjct  334  ERNYGLFYPNEQKVYNIPLTKEELESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVANKN  393

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A    +  AL YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTC F
Sbjct  394  AGEKTLQAALDYACGEGGADCKPIQPGATCYSPNTLDAHASYAFNSYYQKKTRGTGTCDF  453

Query  259  NGLAVKTINDPSYGACKYPS  200
             G A      P YG C++P+
Sbjct  454  GGAAYVVSQPPRYGNCEFPT  473



>ref|XP_011009861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Populus euphratica]
Length=499

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADA  413
            ER++G+ YP+ T++Y +D SGK        +P   +   + G  WC+ +  A+   + +A
Sbjct  327  ERNWGLFYPDQTSVYSLDFSGKG----VLDVPANKSLTSFNGTTWCIASNNASQLDLQNA  382

Query  412  LSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIN  233
            L +ACG GN  C+ IQP   C+ P++L+ HASYAF+SY+ Q  +    C F G  VK   
Sbjct  383  LDWACGSGNVDCSAIQPSQPCFEPDTLVSHASYAFNSYYQQNGASDVACSFGGTGVKVNK  442

Query  232  DPSYGACKY  206
            DPSY  C Y
Sbjct  443  DPSYDNCMY  451



>gb|KHG21189.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=489

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 74/136 (54%), Gaps = 13/136 (10%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVWCVV  449
            ER++G+ YPN   +Y I LS K       P P    NQ               G+ WC+ 
Sbjct  327  ERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTWCMA  385

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
            +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   + G+
Sbjct  386  SPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGS  445

Query  268  CYFNGLAVKTINDPSY  221
            C+F+G A  +   P +
Sbjct  446  CFFSGTAYVSTQRPFF  461



>ref|XP_002969476.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
 gb|EFJ29564.1| hypothetical protein SELMODRAFT_231287 [Selaginella moellendorffii]
Length=478

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = -1

Query  589  RHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADAL  410
            R +G+ + N T +Y +D+SG T       L   +T      K WCV    A+   +  AL
Sbjct  311  RLWGLFHANQTPVYKLDVSGVTM------LRDSSTGNGSIAKTWCVARSGASDADLESAL  364

Query  409  SYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTIND  230
            ++ACG GN  C+ IQ GGACY+P+S+  HASYAF+SY+ +     GTC FNG A  T  D
Sbjct  365  NWACGIGNADCSAIQQGGACYSPDSVASHASYAFNSYFQRNVQGNGTCDFNGCATLTSTD  424

Query  229  PSYGACKYPS  200
            PSY +C Y S
Sbjct  425  PSYNSCIYSS  434



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT-------------NQPYKGKVWCV  452
            ER+FG+ YP+   +Y + L+ +  ++ +   P P +             ++   G  WCV
Sbjct  326  ERNFGLFYPDEKKVYNVPLTVEALKN-YHDDPSPASPVSGGGGSGGGGVSKSTTGNTWCV  384

Query  451  VAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGG  272
              P A+   + DAL +ACG+G   C PIQ    C++PN+L+ HAS+AF+SY+ +    GG
Sbjct  385  ANPYADKNKLQDALDFACGEGGADCRPIQNNATCFDPNTLVAHASFAFNSYYQKQARAGG  444

Query  271  TCYFNGLAVKTINDPSYGACKYPS  200
            +CYF G +     +P YG C++P+
Sbjct  445  SCYFGGTSYVVTQEPKYGKCEFPT  468



>ref|XP_006661539.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Oryza brachyantha]
Length=105

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 2/102 (2%)
 Frame = -1

Query  511  FPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSL  332
            FPP P  +   P +  VWCV  P+     +  A+ YACG G   C+ IQP G C+ PNS+
Sbjct  3    FPP-PFASRTPPRRRAVWCVAKPSVPGPIIQQAMDYACGSGA-DCDSIQPSGPCFRPNSM  60

Query  331  IRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKY  206
            I HASYAF+SYW + +S G TC F G A+    DPSYG+C Y
Sbjct  61   IAHASYAFNSYWQRAKSNGATCDFGGTAMLITKDPSYGSCHY  102



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 75/135 (56%), Gaps = 5/135 (4%)
 Frame = -1

Query  592  ERHFGVLYPNGTNIYPIDL----SGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTA  425
            ER++G+ YP+   +Y + L    +G TP +E      PTT +  + + WCV         
Sbjct  327  ERNYGLFYPSEEKVYDVPLGMAGAGSTPVNE-SKAQVPTTERGVQSRTWCVANGKLGEEK  385

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            +  AL YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTC F G A 
Sbjct  386  LQKALDYACGEGGADCRPIQPGATCYDPNTLEAHASYAFNSYYQKNARGVGTCDFGGSAY  445

Query  244  KTINDPSYGACKYPS  200
                 P +G C++P+
Sbjct  446  VVTQPPRFGKCEFPT  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160