BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041J13

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    189   2e-54   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   189   3e-54   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    189   3e-54   Citrus sinensis [apfelsine]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   189   3e-54   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   189   3e-54   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   189   3e-54   Citrus sinensis [apfelsine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             188   6e-54   
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             188   6e-54   Citrus clementina [clementine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             188   6e-54   Citrus clementina [clementine]
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   188   1e-53   Citrus sinensis [apfelsine]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    186   3e-53   
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   186   5e-53   Citrus sinensis [apfelsine]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    186   6e-53   Vitis vinifera
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    186   6e-53   Vitis vinifera
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          184   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                185   2e-52   Morus notabilis
ref|XP_002529115.1|  uv excision repair protein rad23, putative         183   7e-52   Ricinus communis
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               177   9e-52   Gossypium arboreum [tree cotton]
ref|NP_001242098.1|  uncharacterized protein LOC100813881               182   1e-51   
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    182   1e-51   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    182   2e-51   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             180   2e-51   
ref|NP_001240201.1|  uncharacterized protein LOC100809066               182   2e-51   Glycine max [soybeans]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    181   2e-51   
gb|KJB80005.1|  hypothetical protein B456_013G076900                    182   2e-51   Gossypium raimondii
gb|ACU18529.1|  unknown                                                 181   2e-51   Glycine max [soybeans]
gb|KJB80004.1|  hypothetical protein B456_013G076900                    181   2e-51   Gossypium raimondii
gb|KJB79994.1|  hypothetical protein B456_013G076500                    181   2e-51   Gossypium raimondii
gb|KJB80000.1|  hypothetical protein B456_013G076800                    181   3e-51   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    181   3e-51   Gossypium raimondii
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         181   4e-51   Jatropha curcas
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    181   5e-51   Glycine max [soybeans]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    179   6e-51   Gossypium raimondii
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     181   6e-51   Glycine soja [wild soybean]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    180   7e-51   Populus euphratica
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    182   7e-51   Glycine max [soybeans]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    182   7e-51   
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    180   8e-51   Nicotiana tomentosiformis
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    179   1e-50   
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          171   1e-50   
gb|KJB79995.1|  hypothetical protein B456_013G076600                    179   1e-50   Gossypium raimondii
emb|CDP19777.1|  unnamed protein product                                179   2e-50   Coffea canephora [robusta coffee]
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               179   3e-50   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     179   3e-50   Glycine soja [wild soybean]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    177   7e-50   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    177   7e-50   Fragaria vesca subsp. vesca
gb|AFK43607.1|  unknown                                                 172   9e-50   Lotus japonicus
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               177   1e-49   Prunus mume [ume]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    176   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          176   2e-49   Sesamum indicum [beniseed]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             176   2e-49   Prunus persica
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             176   2e-49   Phaseolus vulgaris [French bean]
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    176   2e-49   Populus euphratica
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          177   2e-49   
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    176   2e-49   Populus euphratica
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    175   2e-49   Populus euphratica
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             176   2e-49   Phaseolus vulgaris [French bean]
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          176   2e-49   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           176   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               176   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_002516727.1|  uv excision repair protein rad23, putative         176   3e-49   Ricinus communis
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             175   3e-49   
emb|CDP02781.1|  unnamed protein product                                176   3e-49   Coffea canephora [robusta coffee]
gb|EPS71284.1|  hypothetical protein M569_03474                         176   3e-49   Genlisea aurea
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    175   4e-49   Populus euphratica
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          176   4e-49   
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          176   4e-49   Citrus sinensis [apfelsine]
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    176   4e-49   Populus euphratica
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    175   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    175   4e-49   Populus euphratica
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    175   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    176   5e-49   Cicer arietinum [garbanzo]
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             175   5e-49   
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               166   6e-49   Gossypium arboreum [tree cotton]
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  174   6e-49   Citrus sinensis [apfelsine]
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          175   6e-49   
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          175   8e-49   Tarenaya hassleriana [spider flower]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             174   9e-49   Citrus clementina [clementine]
gb|ABD96960.1|  hypothetical protein                                    175   1e-48   Tarenaya spinosa
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    176   1e-48   
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          173   2e-48   Sesamum indicum [beniseed]
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    174   2e-48   Nicotiana sylvestris
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               174   2e-48   Solanum lycopersicum
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          168   2e-48   Nicotiana tomentosiformis
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                177   2e-48   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 174   2e-48   Medicago truncatula
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                173   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    173   3e-48   Nicotiana sylvestris
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          173   3e-48   Phoenix dactylifera
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             172   4e-48   Prunus persica
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          173   4e-48   Solanum tuberosum [potatoes]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               172   4e-48   Nicotiana sylvestris
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    173   4e-48   Elaeis guineensis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    173   4e-48   Elaeis guineensis
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             173   5e-48   
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             172   5e-48   Prunus persica
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          173   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          173   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          172   7e-48   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             172   7e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    172   7e-48   Populus euphratica
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    173   8e-48   Elaeis guineensis
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   8e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006383464.1|  ubiquitin family protein                           172   8e-48   
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   8e-48   Elaeis guineensis
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          172   9e-48   Amborella trichopoda
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               172   9e-48   
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    172   9e-48   Populus euphratica
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   9e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               171   1e-47   Vitis vinifera
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    173   1e-47   Phoenix dactylifera
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    173   1e-47   
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    173   1e-47   
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    171   1e-47   Populus euphratica
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    171   1e-47   Populus euphratica
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    173   1e-47   Phoenix dactylifera
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               172   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    171   2e-47   Populus euphratica
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          171   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    170   3e-47   Nicotiana tomentosiformis
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          170   4e-47   Elaeis guineensis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    170   4e-47   Nicotiana sylvestris
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    169   5e-47   Nicotiana sylvestris
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    169   6e-47   Nicotiana tomentosiformis
gb|ABB02636.1|  RAD23-like                                              169   1e-46   Solanum tuberosum [potatoes]
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             169   2e-46   Capsella rubella
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             168   2e-46   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   2e-46   
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    168   2e-46   Phoenix dactylifera
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             168   2e-46   
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             168   2e-46   Eutrema salsugineum [saltwater cress]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   3e-46   
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             169   3e-46   Capsella rubella
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    168   3e-46   Phoenix dactylifera
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    167   3e-46   Solanum lycopersicum
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    167   3e-46   Solanum lycopersicum
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             168   4e-46   Eutrema salsugineum [saltwater cress]
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    167   5e-46   Solanum lycopersicum
ref|NP_198663.1|  ubiquitin receptor RAD23d                             167   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          167   6e-46   Elaeis guineensis
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   6e-46   Tarenaya hassleriana [spider flower]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   6e-46   Camelina sativa [gold-of-pleasure]
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        167   6e-46   Nicotiana tabacum [American tobacco]
gb|AAK59766.1|  unknown protein                                         167   6e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                168   7e-46   Erythranthe guttata [common monkey flower]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    167   8e-46   Tarenaya hassleriana [spider flower]
dbj|BAC76393.1|  RAD23-like protein                                     165   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    166   1e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               166   1e-45   Solanum tuberosum [potatoes]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    166   1e-45   Camelina sativa [gold-of-pleasure]
ref|NP_186903.1|  UV excision repair protein RAD23C                     167   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  167   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          166   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               165   2e-45   Brassica rapa
emb|CDX67404.1|  BnaA07g14440D                                          165   3e-45   
emb|CDY58121.1|  BnaCnng32650D                                          165   3e-45   Brassica napus [oilseed rape]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    166   5e-45   Arabis alpina [alpine rockcress]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    166   5e-45   Arabis alpina [alpine rockcress]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          164   8e-45   
emb|CDY01661.1|  BnaC04g30910D                                          163   2e-44   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               163   2e-44   Brassica rapa
emb|CDX74522.1|  BnaA04g08670D                                          163   2e-44   
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    162   7e-44   Arabis alpina [alpine rockcress]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          162   1e-43   Cucumis melo [Oriental melon]
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          161   1e-43   Pyrus x bretschneideri [bai li]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       161   1e-43   Cucumis sativus [cucumbers]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                160   2e-43   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                160   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          159   3e-43   
emb|CDX74251.1|  BnaA03g27960D                                          157   3e-42   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               157   3e-42   Brassica rapa
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          157   3e-42   
emb|CDX91998.1|  BnaC03g33000D                                          157   3e-42   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          157   4e-42   Pyrus x bretschneideri [bai li]
emb|CAA72741.1|  RAD23, isoform I                                       157   4e-42   Daucus carota [carrots]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    157   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    157   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               157   7e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN40029.1|  unknown                                                 156   9e-42   Picea sitchensis
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    155   3e-41   Setaria italica
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          154   4e-41   Oryza brachyantha
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   5e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   5e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    154   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          144   2e-40   
gb|EAZ07072.1|  hypothetical protein OsI_29318                          152   2e-40   Oryza sativa Indica Group [Indian rice]
gb|EAZ00429.1|  hypothetical protein OsI_22453                          152   3e-40   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98767.1|  predicted protein                                      152   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001057334.1|  Os06g0264300                                       152   3e-40   
gb|ACG32894.1|  DNA repair protein RAD23                                152   4e-40   Zea mays [maize]
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    144   4e-40   
gb|EMS61794.1|  putative DNA repair protein RAD23                       151   9e-40   Triticum urartu
gb|EMT27109.1|  Putative DNA repair protein RAD23                       151   9e-40   
ref|NP_001061854.1|  Os08g0430200                                       150   1e-39   
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          150   2e-39   Brachypodium distachyon [annual false brome]
ref|NP_001149140.1|  LOC100282762                                       149   5e-39   Zea mays [maize]
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          149   7e-39   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               148   1e-38   Zea mays [maize]
ref|NP_001266655.1|  DNA repair protein RAD23                           148   1e-38   
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    147   1e-38   Cicer arietinum [garbanzo]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          147   2e-38   Fragaria vesca subsp. vesca
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    146   6e-38   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    146   7e-38   Brachypodium distachyon [annual false brome]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 145   1e-37   Medicago truncatula
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          142   1e-36   Amborella trichopoda
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                142   3e-36   
gb|ABK24371.1|  unknown                                                 141   3e-36   Picea sitchensis
gb|ACH72675.1|  RAD23                                                   140   5e-36   Pinus sylvestris var. mongolica
ref|NP_001063134.1|  Os09g0407200                                       139   1e-35   
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       139   3e-35   Brachypodium distachyon [annual false brome]
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    137   7e-35   
gb|KJB69954.1|  hypothetical protein B456_011G053200                    136   7e-35   Gossypium raimondii
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    137   8e-35   Eucalyptus grandis [rose gum]
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    137   8e-35   Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    137   8e-35   Eucalyptus grandis [rose gum]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               137   9e-35   Gossypium arboreum [tree cotton]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    137   9e-35   Eucalyptus grandis [rose gum]
ref|XP_001763027.1|  predicted protein                                  137   1e-34   
gb|KJB69952.1|  hypothetical protein B456_011G053200                    136   1e-34   Gossypium raimondii
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         136   1e-34   Jatropha curcas
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            135   1e-34   
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          136   1e-34   Citrus sinensis [apfelsine]
gb|AAB65841.1|  osRAD23                                                 136   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               135   3e-34   Gossypium arboreum [tree cotton]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    135   3e-34   Gossypium raimondii
gb|EMT30328.1|  Putative DNA repair protein RAD23                       135   6e-34   
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    133   7e-34   Nicotiana sylvestris
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    134   7e-34   Nicotiana tomentosiformis
gb|KJB34921.1|  hypothetical protein B456_006G091100                    133   7e-34   Gossypium raimondii
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    134   8e-34   Nicotiana tomentosiformis
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    134   1e-33   Setaria italica
gb|EMS50196.1|  putative DNA repair protein RAD23                       136   1e-33   Triticum urartu
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               134   1e-33   Fragaria vesca subsp. vesca
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               134   1e-33   Vitis vinifera
emb|CBI25247.3|  unnamed protein product                                134   1e-33   Vitis vinifera
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          134   1e-33   Nelumbo nucifera [Indian lotus]
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    127   2e-33   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              130   2e-33   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    133   2e-33   Nicotiana sylvestris
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    133   2e-33   Nicotiana sylvestris
ref|XP_002303970.1|  DNA repair protein RAD23                           133   2e-33   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          133   3e-33   Populus euphratica
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             133   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    133   3e-33   Nelumbo nucifera [Indian lotus]
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              129   4e-33   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    132   5e-33   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              132   5e-33   
gb|AFK37577.1|  unknown                                                 132   6e-33   Lotus japonicus
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             132   6e-33   Arabidopsis lyrata subsp. lyrata
gb|ACF79443.1|  unknown                                                 132   7e-33   Zea mays [maize]
ref|NP_001149553.1|  LOC100283179                                       132   1e-32   Zea mays [maize]
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          131   1e-32   Cucumis melo [Oriental melon]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      130   2e-32   Brassica rapa
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    131   2e-32   Cucumis sativus [cucumbers]
ref|NP_974181.1|  ubiquitin receptor RAD23b                             130   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             130   2e-32   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          130   2e-32   Populus euphratica
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 131   2e-32   
ref|XP_002299163.1|  DNA repair protein RAD23                           130   2e-32   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          130   2e-32   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    130   2e-32   
emb|CDX81753.1|  BnaC08g38480D                                          130   2e-32   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              130   3e-32   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             130   3e-32   Capsella rubella
ref|NP_850982.1|  ubiquitin receptor RAD23b                             130   3e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76389.1|  RAD23-like protein                                     130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          130   3e-32   Pyrus x bretschneideri [bai li]
dbj|BAC76390.1|  RAD23-like protein                                     130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          130   4e-32   Sesamum indicum [beniseed]
gb|ABG89119.1|  Rad23-3Ai                                               130   4e-32   synthetic construct
ref|NP_565216.2|  ubiquitin receptor RAD23b                             130   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             130   4e-32   Prunus persica
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               130   4e-32   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          130   4e-32   
dbj|BAC76391.1|  RAD23-like protein                                     129   4e-32   
ref|NP_173070.1|  DNA repair protein RAD23A                             129   5e-32   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          130   6e-32   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          129   6e-32   
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          129   7e-32   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              129   8e-32   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      129   8e-32   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    129   1e-31   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    129   1e-31   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             129   1e-31   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               129   1e-31   
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    127   1e-31   
gb|AAF68123.1|AC010793_18  F20B17.8                                     129   1e-31   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      129   1e-31   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    128   1e-31   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    128   1e-31   
gb|ACG24239.1|  hypothetical protein                                    122   1e-31   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             128   2e-31   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      127   3e-31   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             127   3e-31   
gb|ACU20959.1|  unknown                                                 127   3e-31   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             127   4e-31   
ref|NP_001240038.1|  uncharacterized protein LOC100819019               127   4e-31   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             127   5e-31   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               126   6e-31   
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    126   7e-31   
emb|CAB65692.1|  Rad23 Protein                                          119   7e-31   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     127   8e-31   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    125   1e-30   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               125   1e-30   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    126   1e-30   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    126   1e-30   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       126   1e-30   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    125   2e-30   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                125   2e-30   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               125   2e-30   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         125   2e-30   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      125   3e-30   
emb|CDY33351.1|  BnaC05g12320D                                          124   3e-30   
emb|CDY35071.1|  BnaA06g10810D                                          124   3e-30   
gb|AEA86336.1|  putative DNA repair protein                             120   4e-30   
emb|CDO98260.1|  unnamed protein product                                124   5e-30   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     124   5e-30   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    124   5e-30   
ref|XP_001752264.1|  predicted protein                                  118   5e-30   
gb|ACJ83410.1|  unknown                                                 119   5e-30   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    123   9e-30   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    123   9e-30   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             123   9e-30   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    123   1e-29   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          122   2e-29   
ref|XP_003637292.1|  RAD23 protein                                      119   2e-29   
gb|AEA86337.1|  putative DNA repair protein                             118   2e-29   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    121   5e-29   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    121   5e-29   
ref|XP_003637291.1|  RAD23 protein                                      121   5e-29   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    120   1e-28   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    120   1e-28   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    120   2e-28   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          120   2e-28   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          119   4e-28   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    119   4e-28   
dbj|BAC76395.1|  RAD23-like protein                                     118   4e-28   
emb|CAA72742.1|  RAD23 protein, isoform II                              118   7e-28   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 117   1e-27   
ref|NP_001148810.1|  LOC100282427                                       117   2e-27   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    117   2e-27   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    117   2e-27   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          117   2e-27   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    116   3e-27   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          116   3e-27   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    116   3e-27   
gb|KHF98435.1|  Putative DNA repair RAD23-4 -like protein               108   4e-27   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               115   6e-27   
dbj|BAK04690.1|  predicted protein                                      115   7e-27   
emb|CDX79333.1|  BnaC06g19700D                                          115   1e-26   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   1e-26   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    114   1e-26   
gb|EEC72612.1|  hypothetical protein OsI_06092                          114   1e-26   
ref|NP_001046083.1|  Os02g0179300                                       114   1e-26   
emb|CDX67983.1|  BnaA07g20230D                                          114   2e-26   
ref|XP_001780766.1|  predicted protein                                  114   2e-26   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          112   6e-26   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     112   1e-25   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     109   2e-25   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    110   4e-25   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    110   4e-25   
gb|KDO46128.1|  hypothetical protein CISIN_1g0198172mg                  103   5e-25   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          110   5e-25   
ref|XP_002444377.1|  hypothetical protein SORBIDRAFT_07g020960          103   4e-24   
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   107   7e-24   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     105   3e-23   
ref|XP_004570397.1|  PREDICTED: UV excision repair protein RAD23 ...  93.2    5e-19   
ref|XP_005802841.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    6e-19   
ref|XP_003446521.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    6e-19   
ref|XP_008297295.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    6e-19   
ref|XP_007573182.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  92.8    7e-19   
ref|XP_004339463.1|  Rad23, putative                                  92.0    1e-18   
ref|XP_006677785.1|  hypothetical protein BATDEDRAFT_16317            92.0    1e-18   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...  92.0    2e-18   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...  92.0    2e-18   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...  90.9    2e-18   
gb|KGL75456.1|  UV excision repair protein RAD23 B                    90.9    3e-18   
gb|EXX69202.1|  Rad23p                                                89.7    5e-18   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  90.5    7e-18   
gb|EXX69203.1|  Rad23p                                                90.1    7e-18   
gb|EXX69201.1|  Rad23p                                                90.1    7e-18   
ref|XP_010741704.1|  PREDICTED: UV excision repair protein RAD23 ...  89.4    1e-17   
gb|ESA07268.1|  hypothetical protein GLOINDRAFT_82043                 85.9    1e-17   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...  89.0    1e-17   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...  88.6    2e-17   
ref|XP_003643857.2|  PREDICTED: UV excision repair protein RAD23 ...  87.4    2e-17   
gb|KFU98476.1|  UV excision repair protein RAD23 B                    88.6    2e-17   
gb|ACN58624.1|  UV excision repair protein RAD23 homolog A            84.3    2e-17   
ref|XP_010869793.1|  PREDICTED: UV excision repair protein RAD23 ...  89.4    3e-17   
ref|XP_002432231.1|  uv excision repair protein rad23, putative       87.8    3e-17   
ref|XP_010869792.1|  PREDICTED: UV excision repair protein RAD23 ...  89.4    3e-17   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...  87.8    3e-17   
ref|XP_006023487.1|  PREDICTED: UV excision repair protein RAD23 ...  87.8    4e-17   
ref|XP_006023486.1|  PREDICTED: UV excision repair protein RAD23 ...  87.8    4e-17   
ref|XP_005708114.1|  nucleotide excision repair protein               88.6    4e-17   
ref|XP_006262376.1|  PREDICTED: UV excision repair protein RAD23 ...  87.4    5e-17   
ref|XP_003981972.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    7e-17   
ref|XP_004635605.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    7e-17   
ref|XP_004635604.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    7e-17   
dbj|BAM18172.1|  UV excision repair protein rad23                     86.3    7e-17   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    7e-17   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    8e-17   
ref|XP_005381100.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    8e-17   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like  87.0    8e-17   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5     87.0    9e-17   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    9e-17   
ref|XP_007432166.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    9e-17   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...  87.0    9e-17   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein         86.7    1e-16   
emb|CAF91196.1|  unnamed protein product                              86.3    1e-16   
ref|XP_007098249.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    1e-16   
ref|XP_010611684.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    1e-16   
ref|XP_004442606.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    1e-16   
ref|XP_008275545.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    1e-16   
emb|CDQ90828.1|  unnamed protein product                              86.3    1e-16   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    1e-16   
ref|XP_005281430.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_009251134.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    1e-16   
dbj|BAJ97496.1|  predicted protein                                    87.0    1e-16   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  87.8    1e-16   
ref|XP_003216859.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_006874327.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_007172026.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_007172025.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_005682329.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_005208732.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_007432165.1|  PREDICTED: UV excision repair protein RAD23 ...  86.7    1e-16   
ref|XP_005962894.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_006175452.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    1e-16   
ref|XP_004715561.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_010992120.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_007058292.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    1e-16   
ref|NP_001076083.1|  UV excision repair protein RAD23 homolog A       86.3    1e-16   
ref|XP_005682330.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_004715560.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_006900851.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_005962893.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
emb|CDQ83149.1|  unnamed protein product                              86.3    1e-16   
ref|XP_006041614.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_007103675.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    1e-16   
ref|XP_005367029.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    1e-16   
ref|XP_010952482.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004672516.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006041613.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004008534.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    2e-16   
ref|XP_007532494.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003123386.2|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006730619.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_005652934.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004277501.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004595636.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    2e-16   
ref|XP_004595637.1|  PREDICTED: UV excision repair protein RAD23 ...  86.3    2e-16   
ref|XP_010992121.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004672515.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006918804.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006730620.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006255339.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003468400.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_007532493.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004476079.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_001513724.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004311441.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003915049.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003413111.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006255338.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|NP_005044.1|  UV excision repair protein RAD23 homolog A isof...  85.9    2e-16   
ref|XP_010591581.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_008853680.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_006206295.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
gb|ERE79542.1|  putative UV excision repair protein RAD23-like pr...  85.9    2e-16   
ref|XP_008275543.1|  PREDICTED: UV excision repair protein RAD23 ...  87.0    2e-16   
ref|XP_004688762.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_008853679.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_008046219.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004903008.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_005632874.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004389796.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004476077.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_008046218.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_008965929.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003797962.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
gb|EHH62732.1|  UV excision repair protein RAD23-like protein A       85.5    2e-16   
gb|EFB28622.1|  hypothetical protein PANDA_009870                     85.5    2e-16   
ref|XP_542038.2|  PREDICTED: UV excision repair protein RAD23 hom...  85.9    2e-16   
ref|XP_005336276.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004903007.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004060165.1|  PREDICTED: UV excision repair protein RAD23 ...  84.3    2e-16   
ref|XP_006206294.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004688761.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_003814882.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004476078.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|NP_001257291.1|  UV excision repair protein RAD23 homolog A i...  85.9    2e-16   
ref|XP_005588233.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   
ref|XP_004399004.1|  PREDICTED: UV excision repair protein RAD23 ...  85.9    2e-16   



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  305  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  364

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  365  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  311  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  370

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  371  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  304  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  363

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  364  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  306  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  365

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  366  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  310  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  369

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  370  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  402



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  311  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  370

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  371  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  309  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  309  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  308  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  367

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  368  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  400



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  338  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  397

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  398  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  430



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  293  QNPHLMRLIQEHQADFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  353  FDRATVLQVFFACNKNEELAANYLLDHMHEFED  385



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  305  QNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  364

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  365  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMG
Sbjct  305  QNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMG  364

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  365  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMG
Sbjct  306  QNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMG  365

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  366  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEP+EGGEGNILGQLA+SMPQAV VTPEEREAIERLEAMG
Sbjct  309  QNPHLMRLIQEHQADFLRLINEPLEGGEGNILGQLASSMPQAVTVTPEEREAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDH+HE+ED
Sbjct  369  FDRAIVLEVYFACNKNEELAANYLLDHIHEYED  401



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEGGEGN+LGQL+A+MPQAV VTPEEREAIERLEAMG
Sbjct  327  QNPQLMRLIQEHQADFLRLINEPVEGGEGNLLGQLSAAMPQAVTVTPEEREAIERLEAMG  386

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  387  FDRALVLEVYFACNKNEELAANYLLDHMHEFDD  419



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ DFLRLINEPVEGGEGNI+GQLAA+MPQAV VTPEEREAIERLEAMG
Sbjct  317  QNPNLVRLIQEHQTDFLRLINEPVEGGEGNIMGQLAAAMPQAVTVTPEEREAIERLEAMG  376

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  377  FDRGLVLEVFFACNKNEELAANYLLDHMHEFED  409



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   177 bits (450),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  130  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  189

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  190  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  222



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  308  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGTMPQAVTVTPEERQAIERLEAMG  367

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  368  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  400



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  309  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  369  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  401



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  291  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  351  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMG
Sbjct  243  QNPHLMRLIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMG  302

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            FDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  303  FDRALVLEVFFACNKNEELAANYLLDHMHEF  333



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA++MPQAV VTPEER+AIERLEAMG
Sbjct  300  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLASAMPQAVTVTPEERQAIERLEAMG  359

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  360  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  392



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  290  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  350  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  293  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  353  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  385



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  290  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  350  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  292  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  352  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  292  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  352  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  290  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  350  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  382



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  292  QNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  352  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  291  QNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  350  FDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  382



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEP EGGEGNILGQ+A+ MPQAV VTPEER+AIERLEAMG
Sbjct  309  QNPHLMRLIRDHQADFLRLINEPAEGGEGNILGQMASGMPQAVTVTPEERQAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  369  FDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  401



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  248  QNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  307

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  308  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  340



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  324  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  383

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  384  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  416



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMR IQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMG
Sbjct  288  QNPHLMRFIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMG  347

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            FDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  348  FDRALVLEVFFACNKNEELAANYLLDHMHEF  378



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  376  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  435

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  436  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  468



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMG
Sbjct  377  QNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMG  436

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  437  FDRATVLEVYFACNKNEELAANYLLDHMHEFDE  469



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MG
Sbjct  303  QNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMG  362

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  363  FDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  395



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MG
Sbjct  285  QNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  345  FDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  377



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  19   QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  78

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  79   FDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMG
Sbjct  292  QNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  352  FDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEP+EGGEGNILGQLA +MPQ +QVT EEREAI RLE MG
Sbjct  298  QNPHLMRLIQEHQADFLRLINEPIEGGEGNILGQLAGAMPQTIQVTAEEREAIRRLEEMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  358  FDRATVLEVFFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMG
Sbjct  315  QNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMG  374

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  375  FDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  407



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMG
Sbjct  317  QNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMG  376

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  377  FDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  409



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMG
Sbjct  309  QNPQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  369  FDRALVLEVFVACNRNEELAANYLLDHMHEFED  401



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMG
Sbjct  308  QNPQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMG  367

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  368  FDRALVLEVFVACNRNEELAANYLLDHMHEFED  400



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   172 bits (437),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLIQ+HQ DFLRLINEPVEGGEGNILGQ A A+MPQAV VTPEEREAIERLEAM
Sbjct  134  QNPHLMRLIQDHQVDFLRLINEPVEGGEGNILGQPAGAAMPQAVSVTPEEREAIERLEAM  193

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  194  GFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  227



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  293  QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  353  FDRALVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQ +FLRLINEP EG EGN+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  299  QNPQIMRLIQEHQGEFLRLINEPAEGTEGNVLGQLAAGMPQALTVTPEEREAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  359  FDRALVLQVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMG
Sbjct  289  QNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMG  347

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  348  FDRALVLEVFFACNKNEELAANYLLDHMHEFDD  380



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  293  QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  353  FDRALVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+AIERLEAMG
Sbjct  309  QNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVSVTAEERQAIERLEAMG  368

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  369  FDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  401



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  295  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  353

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  354  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  386



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEGG GNIL QLA +MPQA+QVTPEEREAIERLEAMG
Sbjct  341  QNPQLVRLIQEHQADFLRLINEPVEGGAGNILEQLAGAMPQAIQVTPEEREAIERLEAMG  400

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  401  FDRALVLEVFFACNKNEELAANYLLDHIHEFEE  433



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  294  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  353  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  246  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  304

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  305  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  337



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+AIERLEAMG
Sbjct  307  QNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVTVTAEERQAIERLEAMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  367  FDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGNI G LAA+MPQ+V VTPEEREAIERL AMG
Sbjct  296  QNPHLMRLIQEHQDDFLRLINEPVEGGEGNISGPLAAAMPQSVTVTPEEREAIERLGAMG  355

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  356  FDPALVLEVYFACNKNEELAANYLLDHIHEFED  388



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  294  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  353  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  299  QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  359  FDRALVLEVYFACNKNEELAANYLLDHMHEFEE  391



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG +GN+LGQLA+++PQ+V VTPEEREAIERLEAMG
Sbjct  290  QNPHLMRLIQEHQADFLRLINEPVEG-DGNLLGQLASAVPQSVSVTPEEREAIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMH+FE+
Sbjct  349  FDRAIVLEVFFACNKNEELAANYLLDHMHDFEE  381



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMG
Sbjct  260  QNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMG  319

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  320  FDPALVLEVYFACNKNEELAANYLLDHIHEFED  352



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMG
Sbjct  296  QNPHLMRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD ALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  355  FDPALVLEVFFACNKNEELAANYLLDHMHEFDE  387



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQLA  MPQAV VTPEEREAIERLEAMG
Sbjct  297  QNPQLVRLIQDHQADFLRLINEPVEGGEGDLLGQLAGGMPQAVTVTPEEREAIERLEAMG  356

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDH HEFED
Sbjct  357  FDRALVLEVYFACNKNEELAANYLLDHGHEFED  389



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  282  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  341  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  373



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  295  QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  355  FDRALVLEVYFACNKNEELAANYLLDHMHEFEE  387



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMG
Sbjct  298  QNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  358  FDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  300  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  359  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  391



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 3/93 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMG
Sbjct  298  QNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  355  FDRALVLEVFFACNKNEELAANYLLDHIHEFED  387



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 91/93 (98%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  299  QNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  358  FDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 3/93 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMG
Sbjct  297  QNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMG  353

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  354  FDRALVLEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLI++HQADFLRLINEP+EGGEGN+LGQ+A  MPQAV VTPEER+AIERLEAMG
Sbjct  307  QNPHLMRLIRDHQADFLRLINEPMEGGEGNLLGQMAGGMPQAVTVTPEERQAIERLEAMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  367  FDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMG
Sbjct  304  QNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMG  363

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  364  FDPALVLEVYFACNKNEELAANYLLDHIHEFED  396



>gb|KHF97937.1| Putative DNA repair RAD23-4 -like protein [Gossypium arboreum]
Length=88

 Score =   166 bits (420),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -3

Query  601  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  422
            MRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA 
Sbjct  1    MRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRAT  60

Query  421  VLEVFFACNKNEELAANYLLDHMHEFED  338
            VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  61   VLQVFFACNKNEELAANYLLDHMHDFQD  88



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMG
Sbjct  275  QNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMG  334

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  335  FDRAIVLEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLIQEHQADFLRLINEPVEGGEGN +LGQLAA+MPQA+ VTPEEREAIERLE M
Sbjct  305  QNPHLMRLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQM  364

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  365  GFDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  398



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLIQEHQADFLRLINEPVEGGEG NI+ QLA  +PQA+QVTPEEREAIERLEAM
Sbjct  314  QNPHLMRLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAM  373

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  374  GFDRALVLEVFFACNKNEELAANYLLDHIHEFDE  407



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMG
Sbjct  298  QNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  358  FDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLIQEHQADFLRLINEPVEGGEG NI+ QLA  +PQA+QVTPEEREAIERLEAM
Sbjct  342  QNPHLMRLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAM  401

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  402  GFDRALVLEVFFACNKNEELAANYLLDHIHEFDE  435



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLAA+MPQAV VTPEEREAIERLEAMG
Sbjct  396  QNPHLMRLIQEHQADFLRLINEPVEG-EGNLLGQLAAAMPQAVTVTPEEREAIERLEAMG  454

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  455  FDRNIVLEVFFACNKNEELAANYLLDHMHEFEE  487



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMG
Sbjct  289  QNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMG  347

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  348  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  380



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP LMRLIQEHQADFLRLINEPVEGG EGNILGQLAA+MPQA+QVTPEEREAIERLE M
Sbjct  302  QNPQLMRLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQM  361

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  362  GFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  395



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLIQEHQADFLRLINEPVEGGEGN +LGQLAA+MPQA+ VTPEEREAIERLE M
Sbjct  316  QNPHLMRLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQM  375

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  376  GFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  409



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMG
Sbjct  103  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMG  161

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  162  FDRALVLEVYFACNKNEELAANYLLDHMHEFDE  194



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+LGQL+A+MPQAV VTPEEREAIERLEAMG
Sbjct  457  QNPQLMRLIQEHQADFLRLINEPVEG-EGNLLGQLSAAMPQAVTVTPEEREAIERLEAMG  515

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  516  FDRALVLEVYFACNKNEELAANYLLDHMHEFDD  548



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 91/94 (97%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNPHLMRLI++HQADFLRLINEP+EGGEGN +LGQ+AA MPQ+V VTPEER+AIERLEAM
Sbjct  303  QNPHLMRLIRDHQADFLRLINEPMEGGEGNNLLGQMAAGMPQSVTVTPEERQAIERLEAM  362

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRA+VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  363  GFDRAIVLEVFFACNKNEELAANYLLDHMHEFDE  396



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQADFLRLINEPVEG EGNILGQLA +MPQ V VTPEEREAIERLEAMG
Sbjct  290  QNPQLVRLIQDHQADFLRLINEPVEG-EGNILGQLAEAMPQTVNVTPEEREAIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  349  FDRALVLEVFFACNKNEELAANYLLDHMHEFDD  381



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP LMRLIQEHQADFLRLINEPVEGG EGNILGQLAA+MPQA+QVTPEEREAIERLE M
Sbjct  284  QNPQLMRLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQM  343

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  344  GFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  377



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E ++LGQLA++MPQA+ VTPEEREAIERLEAMG
Sbjct  292  QNPQVMRLIQEHQAEFLRLLNEPTEGAESDLLGQLASAMPQALTVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMG
Sbjct  295  QNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  353  FDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  299  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  358  FDRALVLEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMG
Sbjct  296  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  355  FDRALVLEVYFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMG
Sbjct  304  QNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMG  363

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  364  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMG
Sbjct  303  QNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMG  362

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  363  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  395



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVTPEEREAIERL
Sbjct  321  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTPEEREAIERL  380

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  381  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE  417



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMG
Sbjct  295  QNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  353  FDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTPEEREAIERL
Sbjct  324  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERL  383

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  384  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  420



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTPEEREAIERL
Sbjct  323  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERL  382

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  383  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMG
Sbjct  294  QNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  352  FDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  384



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  308  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  367  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  308  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  367  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMG
Sbjct  329  QNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMG  388

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  389  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  421



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +MRLIQEHQ +FLRLINEP EG EG N+LGQLAA MPQA+ VTPEEREAIERLEAM
Sbjct  299  QNPQIMRLIQEHQGEFLRLINEPAEGTEGSNVLGQLAAGMPQALTVTPEEREAIERLEAM  358

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  359  GFDRALVLQVFFACNKNEELAANYLLDHMHEFED  392



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  293  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  384



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMG
Sbjct  330  QNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMG  389

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  390  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  422



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP LMRLIQEHQADFLRLINE P EG EGN+LGQLA++MPQAV VTPEEREAIERLEA+
Sbjct  296  QNPQLMRLIQEHQADFLRLINEQPAEGAEGNLLGQLASAMPQAVTVTPEEREAIERLEAL  355

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEVFFACNKNEELAANYLLDHM+EFE+
Sbjct  356  GFDRALVLEVFFACNKNEELAANYLLDHMNEFEE  389



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  298  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMG  356

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  357  FDRALVLEVYFACNKNEELAANYLLDHLHEFDE  389



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  307  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  365

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  366  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  398



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEEREAIERLEAMG
Sbjct  317  QNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMG  376

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  377  FDRALVLQVFFACNKNEELAANYLLDHMHEFED  409



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEEREAIERLEAMG
Sbjct  316  QNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMG  375

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  376  FDRALVLQVFFACNKNEELAANYLLDHMHEFED  408



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQL  ++PQAV +TPEERE+IERLEAMG
Sbjct  291  QNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLG-TVPQAVTITPEERESIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  349  FDRALVLEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMG
Sbjct  359  QNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMG  418

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  419  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMG
Sbjct  360  QNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMG  419

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  420  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  452



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMG
Sbjct  359  QNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMG  418

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  419  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  291  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  350  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  290  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  349  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  381



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMG
Sbjct  358  QNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMG  417

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  418  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  450



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTPEEREAIERL
Sbjct  326  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERL  385

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  386  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  422



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMG
Sbjct  273  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMG  331

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  332  FDRALVLEVFFACNKNEELAANYLLDHMHEFDE  364



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP LMRLIQEHQADFLRLINEPVEGGEG NI  QL  +MPQA+QVTPEEREAIERLEAM
Sbjct  290  QNPQLMRLIQEHQADFLRLINEPVEGGEGGNISSQLGGAMPQAIQVTPEEREAIERLEAM  349

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  350  GFERGLVLEVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  292  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  351  FDRALVLQVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQA+FLRL+NEP EG E ++LGQ A+ MPQA+ VTPEEREAIERLEAMG
Sbjct  292  QNPQVMRLIQEHQAEFLRLLNEPAEGAESDLLGQFASPMPQALTVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  296  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  355  FDRALVLQVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  278  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  336

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  337  FDRALVLQVFFACNKNEELAANYLLDHMHEFDE  369



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  274  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  332

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  333  FDRALVLQVFFACNKNEELAANYLLDHMHEFDE  365



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  293  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEE+AANYLLDHMHEF++
Sbjct  352  FDRALVLQVFFACNKNEEMAANYLLDHMHEFDE  384



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  293  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  352  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ GQL A MPQ  A+QVTPEEREAIERL
Sbjct  276  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERL  335

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  336  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  372



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  276  QNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMG  334

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  335  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  300  QNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  359  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  285  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  343

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  344  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  297  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVIEQLEAAMPQAVTVTPEEREAIERLEAMG  355

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  356  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  279  QNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMG  337

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  338  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  370



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG +AA +PQ  A+QVTPEEREAIERL
Sbjct  331  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGHMAAGIPQPQAIQVTPEEREAIERL  390

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            E MGFDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  391  EGMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE  427



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  297  QNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMG  355

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  356  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  290  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  349  FDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  381



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  292  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  351  FDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  383



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  285  QNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  343

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  344  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ GQL A MPQ  A+QVTPEEREAIERL
Sbjct  320  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERL  379

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  380  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  416



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  274  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  332

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  333  FDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  365



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLE MG
Sbjct  286  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  345  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +MRLIQEHQ +FL LINEP EGGE N+LGQLAA+MPQA+ VTPEE EAIERLEAMG
Sbjct  299  QNPLVMRLIQEHQDEFLCLINEPAEGGESNLLGQLAAAMPQALTVTPEECEAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  359  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  282  QNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  341  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  373



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEEREAIERLEAMG
Sbjct  295  QNPQLMRLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMG  353

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  354  FDRALVLEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  284  QNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  342

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  343  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  375



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVE  EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  296  QNPQLMRLIQEHQADFLRLINEPVES-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  355  FDRALVLQVFFACNKNEELAANYLLDHMHEFDE  387



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLE MG
Sbjct  286  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  345  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQADFLRLINEPVEG +GN+LGQLA +MPQ+V VT EEREAIERLEAMG
Sbjct  353  QNPQLVRLIQDHQADFLRLINEPVEG-DGNVLGQLAEAMPQSVAVTAEEREAIERLEAMG  411

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  412  FDRALVLEVFFACNKNEELAANYLLDHMHEFDD  444



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEEREAIERLEAMG
Sbjct  292  QNPQLMRLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  351  FDRALVLEVFFACNKNEELAANYLLDHIHEFED  383



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT EEREAIERL
Sbjct  241  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERL  300

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  301  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  337



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  289  QNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  347

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  348  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  380



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  291  QNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMG  349

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVL+VFFAC KNEE+AANYLLDHMHEF++
Sbjct  350  FDRALVLQVFFACXKNEEMAANYLLDHMHEFDE  382



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  287  QNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  345

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  346  FDRAMVLEVFFACNKNEELAANYLLDHMHEFED  378



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT EEREAIERL
Sbjct  323  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERL  382

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  383  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT EEREAIERL
Sbjct  322  QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERL  381

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            EAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  382  EAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  418



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 4/93 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFLRLINEPVEG EGN+ GQ+A   P  VQVTPEEREAIERLEAMG
Sbjct  295  QNPHLMRLIQEHQADFLRLINEPVEG-EGNLFGQMA---PATVQVTPEEREAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  351  FDRALVLEVFFACNKNEELAANYLLDHIHEFEE  383



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  290  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  349  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  381



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  290  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  348

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  349  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  381



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  292  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  351  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  383



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTPEER+AIERL
Sbjct  329  QNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERL  388

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            E MGF+RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  389  EGMGFERALVLEVFFACNKDEELAANYLLDHIHEFEE  425



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 4/97 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERL  449
            QNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTPEER+AIERL
Sbjct  339  QNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERL  398

Query  448  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            E MGF+RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  399  EGMGFERALVLEVFFACNKDEELAANYLLDHIHEFEE  435



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQEHQ +FLRLINEP EG EG NILGQL   MPQA+ VTPEE EAIERLEAM
Sbjct  298  QNPQILRLIQEHQGEFLRLINEPAEGTEGGNILGQLPTGMPQALSVTPEEHEAIERLEAM  357

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  358  GFDRALVLQVFFACNKNEELAANYLLDHMHEFED  391



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  286  QNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  345  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  377



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  286  QNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  345  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  377



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  288  QNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMG  346

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  347  FDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  379



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMG
Sbjct  300  QNPQLVRLIQEHQADFLRLINEPVEGEE-NVIEQLEAAMPQAVTVTPEEREAIERLEAMG  358

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F+RA+VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  359  FERAMVLEVFFACNKNEELAANYLLDHMHEFDE  391



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 1/92 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MG
Sbjct  328  QNPQLIRLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMG  386

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFE  341
            FDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  387  FDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  418



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLI EHQADFLRLINEP EGGEGN+LG   A++PQA+ ++PEEREAIERLEAMG
Sbjct  295  QNPNLVRLIGEHQADFLRLINEPAEGGEGNVLGD--AAVPQAIAISPEEREAIERLEAMG  352

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  353  FARAIVLQVFFACNKNEELTANYLLDHMHEFED  385



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 1/92 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MG
Sbjct  326  QNPQLIRLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMG  384

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFE  341
            FDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  385  FDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  416



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAM  440
            QNP L+RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEERE+IERLEAM
Sbjct  282  QNPQLVRLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAM  341

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD+ALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  342  GFDQALVLEVFFACNKNEELAANYLLDHMHEFEE  375



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAM  440
            QNP L+RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEERE+IERLEAM
Sbjct  283  QNPQLVRLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAM  342

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFD+ALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  343  GFDQALVLEVFFACNKNEELAANYLLDHMHEFEE  376



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLI EHQADFLRLINEP EGGEGN LG   A++PQA+ +TPEEREAIERLEAMG
Sbjct  269  QNPNLVRLIGEHQADFLRLINEPAEGGEGNALGD--AAVPQAIAITPEEREAIERLEAMG  326

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  327  FARAIVLQVFFACNKNEELTANYLLDHMHEFED  359



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 3/95 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEA
Sbjct  308  QNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEA  366

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  367  MGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 3/95 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEA
Sbjct  308  QNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEA  366

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  367  MGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMG
Sbjct  288  QNPNLVRLIGTHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMG  345

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F RA+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  346  FARAIVLQVFFACNKNEELAANYLLDHMHEFED  378



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 3/95 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEA
Sbjct  310  QNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEA  368

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  369  MGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  403



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMG
Sbjct  294  QNPNLVRLIGAHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMG  351

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F RA+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  352  FARAIVLQVFFACNKNEELAANYLLDHMHEFED  384



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 5/92 (5%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLMRLIQEHQADFL+LINEP+EGGE N+LG      PQA+ VTPEER+AIERLEAMG
Sbjct  296  QNPHLMRLIQEHQADFLQLINEPMEGGE-NLLGH----GPQAISVTPEERDAIERLEAMG  350

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFE  341
            FDR LVLEVFFACNKNEELAANYLLDHMHEFE
Sbjct  351  FDRELVLEVFFACNKNEELAANYLLDHMHEFE  382



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  286  QNPQLMRLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F+R + LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  345  FNRDIALEVFIACNKNEELAANYLLDHIHEFED  377



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEEREAIERLEAMG
Sbjct  287  QNPQLMRLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMG  345

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F+R + LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  346  FNRDIALEVFIACNKNEELAANYLLDHIHEFED  378



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFLRLINEPVEG EGN+L QL ++MP +V VTPEEREAIERLE MG
Sbjct  311  QNPQLMRLIQDHQADFLRLINEPVEG-EGNLLSQLTSAMPASVSVTPEEREAIERLEGMG  369

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            F RA VL+V+FACNKNEELAANYLLDHM EFE+
Sbjct  370  FRRATVLQVYFACNKNEELAANYLLDHMDEFEN  402



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQADFLRL+NEPVEG EG+   QLA +MPQA+ VTPEEREAIERLEAMG
Sbjct  311  QNPQLMRLIQDHQADFLRLVNEPVEGAEGDFFNQLAGAMPQAINVTPEEREAIERLEAMG  370

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  371  FDRALVIEAFLACDKNEQLAANYLLEHAGDYED  403



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA+MPQAVQVTPEEREAI+RLE M
Sbjct  314  QNPQILRLIQENQAEFLRLVNESPEGGAGGNILGQLAAAMPQAVQVTPEEREAIQRLEGM  373

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  374  GFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  407



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  264  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  323

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  324  FERSTVLELYFACNKNEELTANYLLDHMHEF  354



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  267  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  326

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  327  FERSTVLELYFACNKNEELTANYLLDHMHEF  357



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  283  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  342

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  343  FERSTVLELYFACNKNEELTANYLLDHMHEF  373



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQA+ VTPEEREAI+RLEAM
Sbjct  314  QNPQILRLIQENQAEFLRLVNESPDSGTGGNILGQLAAAMPQALTVTPEEREAIQRLEAM  373

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  374  GFNRELVLEVFFACNKDEELAANYLLDHGHEFED  407



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  286  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  345

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  346  FERSTVLELYFACNKNEELTANYLLDHMHEF  376



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  302  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  361

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  362  FERSTVLELYFACNKNEELTANYLLDHMHEF  392



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMG
Sbjct  305  QNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMG  364

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEF  344
            F+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  365  FERSTVLELYFACNKNEELTANYLLDHMHEF  395



>ref|XP_008649304.1| PREDICTED: ubiquitin receptor RAD23d-like [Zea mays]
Length=104

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE M
Sbjct  8    QNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGM  67

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  68   GFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  101



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +++LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MG
Sbjct  307  QNPQILQLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  367  FDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  399



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 2/95 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEA
Sbjct  317  QNPQILRLIQENQAEFLRLVNESPDSGTAGGNILGQLAAAMPQALTVTPEEREAIQRLEA  376

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  377  MGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEEREAI+RLE+M
Sbjct  319  QNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEEREAIQRLESM  378

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  379  GFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  412



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 2/95 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEA
Sbjct  317  QNPQILRLIQENQAEFLRLVNESPDSGAAGGNILGQLAAAMPQALTVTPEEREAIQRLEA  376

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  377  MGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE M
Sbjct  306  QNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGM  365

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  366  GFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>gb|AFW87603.1| hypothetical protein ZEAMMB73_681598 [Zea mays]
Length=104

 Score =   144 bits (362),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE M
Sbjct  8    QNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGM  67

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  68   GFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  101



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEEREAI+RLE M
Sbjct  329  QNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEEREAIQRLEGM  388

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  389  GFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  422



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEEREAI+RLE M
Sbjct  328  QNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEEREAIQRLEGM  387

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  388  GFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  421



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +++LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MG
Sbjct  307  QNPQILQLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNK+E LAANYLLDHM+EF+D
Sbjct  367  FDRDLVLEVFFACNKDELLAANYLLDHMNEFDD  399



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 85/95 (89%), Gaps = 2/95 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQA-VQVTPEEREAIERLEA  443
            QNP ++RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQA V VTPEERE+I+RLEA
Sbjct  317  QNPQILRLIQENQAEFLRLVNETPESGAAGNILGQLAAAMPQAAVTVTPEERESIQRLEA  376

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+R LVLEVFFACN++EELAANYLLDH HE+ED
Sbjct  377  MGFNRELVLEVFFACNRDEELAANYLLDHGHEYED  411



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE M
Sbjct  306  QNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGM  365

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  366  GFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMG
Sbjct  297  QNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMG  356

Query  436  FDRALVLEVFFACNKNEELAA-NYLLDHMHEFE  341
            FDRALV EV+FACNKNEELA+  +L    H+F 
Sbjct  357  FDRALVPEVYFACNKNEELASIPFLCLGWHKFS  389



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE M
Sbjct  309  QNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGM  368

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  369  GFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE M
Sbjct  309  QNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGM  368

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  369  GFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHLM LIQEHQADFLRLINEP  GGE N+  QL A++PQ + +TPEE EAI+RLE MG
Sbjct  287  QNPHLMELIQEHQADFLRLINEP--GGEENLESQLGAAVPQTITITPEEHEAIQRLEDMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  345  FDRDLVLEVFFACNKNEDLAANYLLDHQNEFDD  377



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL--AASMPQAVQVTPEEREAIERLEA  443
            QNPHLM+LIQ HQADFLRLINEPVEGG    L     +A+MPQAV VTPEEREAIERLEA
Sbjct  296  QNPHLMQLIQAHQADFLRLINEPVEGGGEGNLLGQLGSAAMPQAVTVTPEEREAIERLEA  355

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGF+RALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  356  MGFERALVLEVYFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +++LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E EAI+RLE MG
Sbjct  295  QNPQILQLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  355  FDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  387



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP +++LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E EAI+RLE MG
Sbjct  296  QNPQILQLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMG  355

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  356  FDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  388



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 79/93 (85%), Gaps = 2/93 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP+LM LIQEHQADFLRLINEP  GGE N+ GQL A  PQ + +TPEE EAI+RLE MG
Sbjct  280  QNPNLMELIQEHQADFLRLINEP--GGEENLEGQLGALAPQTITITPEENEAIQRLEDMG  337

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDR LVLEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  338  FDRDLVLEVFFACNKNEDLAANYLLDHQNEFDD  370



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQA+FL+LINEP EG EG++ GQ    MPQ++ VTPEEREAIERLEAMG
Sbjct  278  QNPQLLRLIQEHQAEFLQLINEPAEGAEGDLFGQAEQDMPQSITVTPEEREAIERLEAMG  337

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  338  FDRALVIEAFLACDRNEELAINYLLENPGDYED  370



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQA+FL+LINEP+EG EG+I  Q    MP A+ VTPEE+EAIERLEAMG
Sbjct  329  QNPQLLRLIQEHQAEFLQLINEPLEGSEGDIFDQPEQDMPHAINVTPEEQEAIERLEAMG  388

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E + AC++NEELAANYLL+H  +FED
Sbjct  389  FDRALVIEAYLACDRNEELAANYLLEHAGDFED  421



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQA+FL LINE  EG   ++LGQ AA MPQ++ VTPEEREAIERLEAMG
Sbjct  301  QNPQLMRLIQDHQAEFLHLINEETEG---DLLGQFAAEMPQSINVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  358  FDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP LMRLIQ+HQA+FL LINE  +G   ++LGQ AA MPQ++ VTPEEREAIERLEAMG
Sbjct  301  QNPQLMRLIQDHQAEFLHLINEETDG---DLLGQFAAEMPQSINVTPEEREAIERLEAMG  357

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  358  FDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLEAM
Sbjct  295  QNPQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAM  354

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVL+VFFACNK+E+LAANYLLDHM+EF+D
Sbjct  355  GFDRALVLDVFFACNKDEQLAANYLLDHMNEFDD  388



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE M
Sbjct  298  QNPQILQLIQDNQAEFLRLINEPAEGDEDENLLDQFAEGVPQTIAVTPEENEAILRLEGM  357

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  358  GFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  391



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  281  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQDMPHAINVTPAEQEAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  341  FDRALVIEAFLACDRNEELAANYLLENAGDFED  373



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  225  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMG  284

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  285  FDRALVIEAFLACDRNEELAANYLLENGGDFED  317



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  295  QNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  355  FDRALVIEAFLACDRNEELAANYLLEHAGDFED  387



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  296  QNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  355

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  356  FDRALVIEAFLACDRNEELAANYLLEHAGDFED  388



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  282  QNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  341

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  342  FDRALVIEAFLACDRNEELAANYLLEHAGDFED  374



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP AV VTP E+EAIERLEAMG
Sbjct  270  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAVNVTPAEQEAIERLEAMG  329

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  330  FDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  281  QNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  341  FDRALVIEAFLACDRNEELAANYLLEHAGDFED  373



>ref|XP_001763027.1| predicted protein [Physcomitrella patens]
 gb|EDQ72232.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEP-VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP L+RLI ++QA+FLRLINE   EG EG+ILGQLA +MPQ++ VTPEEREAI+RLE M
Sbjct  276  QNPALLRLINDNQAEFLRLINEAGAEGAEGDILGQLAGAMPQSINVTPEEREAIDRLEGM  335

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GF+R LV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  336  GFERTLVIEAFLACDKNEQLAANYLLEHAGDYED  369



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  270  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMG  329

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  330  FDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas]
Length=352

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH A+FL+LINEP+EG EG+I  Q+   MP A+ VTP E+EAIERLEAMG
Sbjct  260  QNPQLLRMIQEHNAEFLQLINEPLEGSEGDIFDQVDQDMPHAINVTPAEQEAIERLEAMG  319

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  320  FDRALVIEAFLACDRNEELAANYLLENAGDFED  352



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQ +FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEAMG
Sbjct  209  QNPQLLRLIQEHQTEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMG  268

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  269  FDRALVIEAFLACDRNEELAANYLLENAGDFED  301



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEHQA+FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEAMG
Sbjct  285  QNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMG  344

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  345  FDRALVIEAFLACDRNEELAANYLLENAGDFED  377



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLE M
Sbjct  295  QNPQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEEDEAILRLEPM  354

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVL+VFFACNK+E+LAANYLLDHM+EF D
Sbjct  355  GFDRALVLDVFFACNKDEQLAANYLLDHMNEFAD  388



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  281  QNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  341  FDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  281  QNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMG  340

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  341  FDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>gb|EMT30328.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=456

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE M
Sbjct  340  QNPQILQLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEENEAILRLEGM  399

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  400  GFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  433



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+EAIERLEAMG
Sbjct  204  QNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMG  263

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  264  FDRALVIEAFLACDRNEELAANYLLEHAGDYED  296



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+EAIERLEAMG
Sbjct  275  QNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMG  334

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  335  FDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  213  QNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMG  272

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  273  FDRALVIEAFLACDRNEELAANYLLENSGDFED  305



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+EAIERLEAMG
Sbjct  274  QNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMG  333

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  334  FDRALVIEAFLACDRNEELAANYLLEHAGDYED  366



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 4/96 (4%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEG---GEGNILGQLAASMPQAVQVTPEEREAIERLE  446
            QNP +M+LIQE+QA+F+RLINEP+EG    E N+L Q+A +  + + VTPEE EAI RLE
Sbjct  290  QNPQVMQLIQENQAEFMRLINEPLEGDEENEMNMLDQIADAA-ETIAVTPEENEAILRLE  348

Query  445  AMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
             MGFDRALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  349  GMGFDRALVLEVFFACNKNEQLAANYLLDHMHEFDN  384



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  440
            QNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE M
Sbjct  298  QNPQILQLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEENEAILRLEGM  357

Query  439  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            GFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  358  GFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  391



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  279  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEAMG  338

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  339  FDRALVIEAFLACDRNEELAANYLLENAGDFED  371



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q    +P A+ VTP E+EAIERLEAMG
Sbjct  319  QNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQPEQELPHAINVTPAEQEAIERLEAMG  378

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  379  FDRALVIEAFLACDRNEELAVNYLLENAGDYED  411



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q    +P A+ VTP E+EAIERLEAMG
Sbjct  307  QNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQPEQELPHAINVTPAEQEAIERLEAMG  366

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  367  FDRALVIEAFLACDRNEELAVNYLLENAGDYED  399



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  286  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMG  345

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELA NYLL++  +FED
Sbjct  346  FDRALVIEAFLACDRNEELAVNYLLENAGDFED  378



>gb|AAD34676.1|AC006341_4 Similar to gb|Y12014 RAD23 protein isoform II from Daucus carota. 
This gene is probably cut off. EST gb|AA651284 comes from 
this gene [Arabidopsis thaliana]
Length=113

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP L+RLIQE+QA+FL+L+NEP EG +G+  I  Q    MP +V VTPEE+E+IERLEA
Sbjct  19   QNPQLLRLIQENQAEFLQLLNEPYEGSDGDVDIFDQPDQEMPHSVNVTPEEQESIERLEA  78

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGFDRA+V+E F +C++NEELAANYLL+H  +FED
Sbjct  79   MGFDRAIVIEAFLSCDRNEELAANYLLEHSADFED  113



>tpg|DAA61380.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=221

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEA  443
            QNP +M+LIQE+QA+F+RLI+EP+EG E N  +L Q+A +  + + VTPEE EAI RLE 
Sbjct  119  QNPRVMQLIQENQAEFMRLISEPLEGDEENEMMLDQMADAT-ETIAVTPEENEAILRLEG  177

Query  442  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            MGFDRALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  178  MGFDRALVLEVFFACNKNEQLAANYLLDHMHEFDN  212



>ref|XP_009797065.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+EAIERLEAMG
Sbjct  275  QNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMG  334

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  335  FDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_009797063.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797064.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+EAIERLEAMG
Sbjct  276  QNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMG  335

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  336  FDRALVIEAFLACDRNEELAANYLLEHAGDYED  368



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  266  QNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  325

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  326  FDRALVIEAFLACDRNEQLAANYLLENAGDFED  358



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  280  QNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  339

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  340  FDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  280  QNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMG  339

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  340  FDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  616  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  437
            QNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMG
Sbjct  295  QNPQLLRLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMG  354

Query  436  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  338
            FDRALV+E F AC++NEELA NYLL++  +FED
Sbjct  355  FDRALVIEAFLACDRNEELAVNYLLENAGDFED  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520