BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041H17

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           295   8e-92   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       287   6e-89   Ipomoea batatas [batate]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             263   1e-79   Nicotiana tomentosiformis
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           260   2e-78   Nicotiana attenuata
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            247   3e-78   Glehnia littoralis
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            247   4e-78   Glehnia littoralis
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       258   6e-78   Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   258   9e-78   Ipomoea nil [qian niu]
gb|AAC33966.1|  phenylalanine ammonia-lyase                             252   4e-77   Capsicum chinense [bonnet pepper]
gb|AIB08913.1|  phenylalanine ammonia-lyase                             243   6e-77   Angelica sinensis [Chinese angelica]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             256   8e-77   Nicotiana sylvestris
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      248   3e-76   
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            242   4e-76   Glehnia littoralis
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        254   4e-76   
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            243   4e-76   Lotus japonicus
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    254   4e-76   Capsicum annuum
gb|AGT63063.1|  phenylalanine ammonia-lyase                             253   6e-76   Solanum tuberosum [potatoes]
emb|CDP06747.1|  unnamed protein product                                250   6e-76   Coffea canephora [robusta coffee]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    253   8e-76   
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             253   9e-76   Solanum lycopersicum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    253   9e-76   Solanum lycopersicum
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    253   9e-76   Solanum tuberosum [potatoes]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       239   9e-76   Malus domestica [apple tree]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           252   1e-75   Nicotiana attenuata
gb|AET41698.1|  phenylalanine ammonia-lyase                             242   1e-75   Prunus salicina [Japanese plum]
gb|ACF94717.1|  phenylalanine ammonia lyase                             242   1e-75   Robinia pseudoacacia [black locust]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             241   4e-75   Vitis vinifera
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       251   4e-75   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             251   4e-75   Nicotiana tomentosiformis
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 241   4e-75   Manihot esculenta [manioc]
ref|XP_002862326.1|  predicted protein                                  237   5e-75   
gb|AIA66448.1|  PAL1                                                    251   5e-75   Capsicum annuum
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             251   5e-75   
gb|ACR56688.1|  phenylalanine ammonia-lyase                             251   6e-75   Scutellaria viscidula [zhan mao huang qin]
gb|AFC37247.1|  phenylalanine ammonia-lyase                             240   7e-75   Camellia chekiangoleosa
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           250   8e-75   Coffea canephora [robusta coffee]
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        250   9e-75   Solanum tuberosum [potatoes]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        250   1e-74   Solanum tuberosum [potatoes]
gb|AEY94464.1|  phenylalanine ammonia-lyase                             240   1e-74   Prunella vulgaris
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            246   2e-74   Lotus japonicus
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    249   2e-74   Solanum lycopersicum
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            249   2e-74   Lotus japonicus
emb|CDP20698.1|  unnamed protein product                                248   2e-74   Coffea canephora [robusta coffee]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           249   2e-74   Coffea arabica [arabica coffee]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             249   2e-74   Nicotiana sylvestris
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            248   3e-74   Lotus japonicus
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        249   4e-74   Solanum tuberosum [potatoes]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       240   8e-74   Vitis vinifera
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       247   1e-73   Nicotiana tabacum [American tobacco]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            247   1e-73   Daucus carota [carrots]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            247   1e-73   Catharanthus roseus [chatas]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            247   1e-73   Daucus carota [carrots]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          246   2e-73   Populus euphratica
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            239   3e-73   Lotus japonicus
gb|AFN85669.1|  phenylalanine ammonia-lyase                             246   3e-73   Hibiscus cannabinus [bimli-jute]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    246   3e-73   Solanum lycopersicum
gb|AAA34179.2|  phenylalanine ammonia lyase                             246   3e-73   Solanum lycopersicum
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   246   4e-73   Populus tremuloides
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    246   4e-73   Solanum tuberosum [potatoes]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        246   4e-73   Cicer arietinum [garbanzo]
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        243   4e-73   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            246   4e-73   Lotus japonicus
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     246   4e-73   Petroselinum crispum
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        239   5e-73   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     245   6e-73   Solanum tuberosum [potatoes]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       245   6e-73   Camellia sinensis [black tea]
gb|AGF50184.1|  phenylalanine ammonia lyase                             234   6e-73   Salvia virgata
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             245   6e-73   Sesamum indicum [beniseed]
dbj|BAD94354.1|  phenylalanine ammonia lyase                            236   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           245   8e-73   
emb|CAA34715.1|  unnamed protein product                                242   8e-73   Petroselinum crispum
ref|XP_007027354.1|  PHE ammonia lyase 1                                245   9e-73   Theobroma cacao [chocolate]
gb|ACF94716.1|  phenylalanine ammonia lyase                             245   1e-72   Robinia pseudoacacia [black locust]
gb|AFG30054.1|  phenylalanine ammonialyase                              245   1e-72   Malus hybrid cultivar
gb|AAU08174.1|  phenylalanine ammonia-lyase                             244   1e-72   Camellia sinensis [black tea]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             244   1e-72   Angelica gigas
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            244   1e-72   Melissa officinalis [sweet balm]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             244   1e-72   Vitis vinifera
gb|AFP24940.1|  phenylalanine ammonia lyase                             244   1e-72   Prunus salicina [Japanese plum]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     244   2e-72   Prunus avium [gean]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        244   2e-72   Vitis vinifera
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   244   2e-72   Populus tremuloides
gb|ADI40166.1|  phenylalanine ammonia-lyase                             244   2e-72   Morus alba
gb|AFK47120.1|  unknown                                                 230   2e-72   Lotus japonicus
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        244   2e-72   Vitis vinifera
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         244   2e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        244   2e-72   Solanum tuberosum [potatoes]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             244   2e-72   Populus tomentosa [Chinese white poplar]
emb|CDX74991.1|  BnaA05g07370D                                          236   2e-72   
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             243   3e-72   Vitis vinifera
emb|CDX91331.1|  BnaC04g08190D                                          235   3e-72   
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            243   3e-72   Populus sieboldii x Populus grandidentata
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           234   3e-72   Eriobotrya japonica [loquat]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           243   3e-72   Scutellaria baicalensis [Baikal skullcap]
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    236   4e-72
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     243   4e-72   Daucus carota [carrots]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 243   4e-72   Pyrus x bretschneideri [bai li]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             243   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           243   4e-72   Prunus mume [ume]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     243   4e-72   Petroselinum crispum
gb|AEX32790.1|  phenylalanine ammonia-lyase                             243   4e-72   Vitis vinifera
gb|AHY94892.1|  phenylalanine ammonia lyase                             243   5e-72   Prunella vulgaris
gb|AGF50183.1|  phenylalanine ammonia lyase                             232   5e-72   Salvia hypoleuca
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      243   5e-72   
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    243   5e-72   Pyrus x bretschneideri [bai li]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     243   5e-72   Vitis vinifera
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        243   6e-72   Populus euphratica
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              243   6e-72   Ricinus communis
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            242   6e-72   Lotus japonicus
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    243   6e-72   Petroselinum crispum
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        243   6e-72   Vitis vinifera
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             243   7e-72   Populus tomentosa [Chinese white poplar]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              242   7e-72   Vitis vinifera
gb|AGL50914.1|  phenylalanine ammonia lyase                             243   7e-72   Pyrus communis
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             242   7e-72   Perilla frutescens [beefsteak-mint]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        242   7e-72   Vitis vinifera
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           243   8e-72   
gb|AGL81344.1|  phenylalanine ammonia lyase                             243   8e-72   Pyrus communis
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         242   8e-72   Populus trichocarpa [western balsam poplar]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             242   8e-72   Vitis vinifera
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            242   9e-72   Lotus japonicus
gb|ABB70117.2|  phenylalanine ammonia lyase                             242   9e-72   Pyrus communis
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 242   1e-71   Rubus idaeus [European raspberry]
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            229   1e-71   Phaseolus vulgaris [French bean]
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    242   1e-71   Populus euphratica
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       242   1e-71   Digitalis lanata [Grecian foxglove]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         242   1e-71   Populus euphratica
gb|ACE95170.1|  phenylalanine ammonia-lyase                             242   1e-71   Populus tomentosa [Chinese white poplar]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             242   1e-71   Vitis vinifera
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   238   1e-71   Citrus sinensis [apfelsine]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        242   1e-71   Citrus sinensis [apfelsine]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             242   1e-71   Vitis vinifera
emb|CAB42793.1|  phenylalanine-ammonia lyase                            242   1e-71   Citrus clementina x Citrus reticulata
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             242   1e-71   Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             242   1e-71   
gb|KJB46526.1|  hypothetical protein B456_007G373700                    241   1e-71   Gossypium raimondii
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 241   1e-71   Manihot esculenta [manioc]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       241   2e-71   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    241   2e-71   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      241   2e-71   
gb|KJB36583.1|  hypothetical protein B456_006G166000                    241   2e-71   Gossypium raimondii
gb|KJB46525.1|  hypothetical protein B456_007G373600                    241   2e-71   Gossypium raimondii
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     241   2e-71   Petroselinum crispum
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    242   2e-71   Populus euphratica
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        237   3e-71   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            241   3e-71   Lotus japonicus
gb|AID16077.1|  phenylalanine ammonium lyase                            241   3e-71   Morus alba
emb|CAN61378.1|  hypothetical protein VITISV_032212                     240   3e-71   Vitis vinifera
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             241   3e-71   Vitis vinifera
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           239   3e-71   Glycine soja [wild soybean]
gb|ABV71917.1|  PAL                                                     228   3e-71   Plectranthus scutellarioides
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             241   4e-71   
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                240   5e-71   Medicago truncatula
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                240   5e-71   Medicago truncatula
gb|AJR20994.1|  phenylalanine ammonia-lyase                             240   5e-71   Populus szechuanica
gb|ACC63889.1|  phenylalanine ammonia-lyase                             240   5e-71   Populus trichocarpa [western balsam poplar]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             240   6e-71   Gossypium arboreum [tree cotton]
gb|ACF94715.1|  phenylalanine ammonia lyase                             231   6e-71   Robinia pseudoacacia [black locust]
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      240   6e-71   Cicer arietinum [garbanzo]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   240   6e-71   Rehmannia glutinosa [Chinese foxglove]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             240   6e-71   Olea europaea
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             240   7e-71   Capsella rubella
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             239   7e-71   Gossypium arboreum [tree cotton]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       239   8e-71   Populus trichocarpa [western balsam poplar]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           239   9e-71   Manihot esculenta [manioc]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             239   9e-71   Prunus persica
gb|ADP09383.1|  phenylalanine ammonia lyase                             223   1e-70   Pyrus pyrifolia [sha li]
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       239   1e-70   Pisum sativum [garden pea]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         239   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      239   1e-70   Camelina sativa [gold-of-pleasure]
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           238   1e-70   Glycine soja [wild soybean]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           239   1e-70   Fragaria vesca subsp. vesca
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    239   1e-70   Populus sieboldii x Populus grandidentata
gb|AGA84059.1|  phenylalanine ammonia lyase                             239   1e-70   Picrorhiza kurrooa
gb|AAQ74878.1|  phenylalanine ammonia lyase                             239   1e-70   Populus trichocarpa x Populus deltoides
gb|AEW43005.1|  phenylalanine ammonia lyase                             231   1e-70   Leucaena leucocephala [cassie]
gb|ABD42947.1|  phenylalanine ammonia lyase                             239   1e-70   Acacia auriculiformis x Acacia mangium
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    239   2e-70   Glycine max [soybeans]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    239   2e-70   Gossypium raimondii
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             239   2e-70   Capsella rubella
emb|CDY18464.1|  BnaA04g21230D                                          232   2e-70   Brassica napus [oilseed rape]
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           238   2e-70   Camelina sativa [gold-of-pleasure]
gb|AAC18870.1|  phenylalanine ammonia lyase                             239   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         238   3e-70   Populus trichocarpa [western balsam poplar]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      238   3e-70   
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      234   3e-70   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         238   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             238   3e-70   Populus tomentosa [Chinese white poplar]
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     236   3e-70   Glycine soja [wild soybean]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             238   3e-70   Gossypium arboreum [tree cotton]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             238   3e-70   
gb|ACV30588.1|  phenylalanine ammonia-lyase                             226   4e-70   Carica papaya [mamon]
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             238   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             238   4e-70   Sesamum indicum [beniseed]
gb|AEE81750.1|  phenylalanine ammonia lyase                             238   4e-70   Morus alba var. multicaulis
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             238   5e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             238   5e-70   Gossypium arboreum [tree cotton]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                238   6e-70   Erythranthe guttata [common monkey flower]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             238   6e-70   Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             237   6e-70   Euphorbia pulcherrima
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             224   7e-70   Pyrus pyrifolia [sha li]
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           237   7e-70   Camelina sativa [gold-of-pleasure]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             237   8e-70   Brassica napus [oilseed rape]
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    237   9e-70   
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             227   9e-70   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           237   9e-70   Brassica rapa
gb|ADO64252.1|  PAL                                                     237   9e-70   Epimedium sagittatum
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    237   1e-69   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    237   1e-69   
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      237   1e-69   Cucumis melo [Oriental melon]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        237   1e-69   Morus notabilis
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    236   1e-69   Populus sieboldii x Populus grandidentata
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       237   1e-69   Citrus limon [lemon]
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             236   1e-69   
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    236   1e-69   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             237   1e-69   Isatis tinctoria [woad]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             236   1e-69   Citrus clementina [clementine]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   236   1e-69   Citrus sinensis [apfelsine]
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      236   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        236   1e-69   Medicago truncatula
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      236   1e-69   Glycine max [soybeans]
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       236   1e-69   Pisum sativum [garden pea]
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           236   2e-69   Populus tomentosa [Chinese white poplar]
prf||2001451A  Phe ammonia lyase                                        236   2e-69
gb|AAX22055.1|  phenylalanine ammonia-lyase                             236   2e-69   Brassica napus [oilseed rape]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            236   2e-69   Brassica oleracea var. botrytis [cauliflower]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              236   2e-69   Ricinus communis
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        237   2e-69   
gb|ACZ36441.1|  phenylalanine ammonialyase                              236   2e-69   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      236   2e-69   Brassica rapa
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           236   2e-69   Brassica rapa
gb|ADR78835.1|  phenylalanine ammonia lyase                             233   3e-69   Ziziphus jujuba [Chinese jujube]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     236   3e-69   Nicotiana tomentosiformis
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          236   3e-69   Vitis vinifera
gb|ABI33979.1|  phenylalanine ammonia lyase                             236   3e-69   Jatropha curcas
gb|AIY26016.1|  PAL                                                     235   3e-69   Jasminum sambac [Arabian jasmine]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             235   3e-69   Phaseolus vulgaris [French bean]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    235   3e-69   Phaseolus vulgaris [French bean]
dbj|BAH20339.1|  AT3G53260                                              233   3e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          226   4e-69   Cynara cardunculus var. scolymus [artichoke]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    235   4e-69   Gossypium raimondii
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             235   4e-69   Populus euphratica
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       235   4e-69   Medicago sativa [alfalfa]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             235   4e-69   Plectranthus scutellarioides
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        235   5e-69   Medicago truncatula
gb|AFU90757.1|  phenylalanine ammonia-lyase                             235   6e-69   Epimedium sagittatum
gb|AGF50182.1|  phenylalanine ammonia lyase                             224   6e-69   Salvia officinalis
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   234   6e-69   Citrus sinensis [apfelsine]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             234   6e-69   Pogostemon cablin
gb|ADA81868.1|  phenylalanine ammonia-lyase                             234   7e-69   Brassica rapa subsp. chinensis [bok-choy]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             234   7e-69   Litchi chinensis [litchi]
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             234   7e-69   Citrus clementina [clementine]
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       223   8e-69   Cucumis sativus [cucumbers]
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      234   9e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             234   9e-69   Nelumbo nucifera [Indian lotus]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             234   1e-68   Arnebia euchroma
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    234   1e-68   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ADY02660.1|  phenylalanine ammonia lyase                             234   1e-68   Parrya nudicaulis
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    234   1e-68   Arabis alpina [alpine rockcress]
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   226   1e-68   Citrus sinensis [apfelsine]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         234   1e-68   Jatropha curcas
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      234   1e-68   Camelina sativa [gold-of-pleasure]
gb|AAM12956.1|  phenylalanine ammonia-lyase                             234   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             234   1e-68   Eutrema salsugineum [saltwater cress]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    233   1e-68   Lithospermum erythrorhizon
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        234   1e-68   Nicotiana sylvestris
gb|AAC18871.1|  phenylalanine ammonia lyase                             234   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         233   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AGE10589.1|  phenylalanine amononia-lyase                            233   2e-68   Lonicera japonica [Japanese honeysuckle]
gb|AGY49231.1|  phenylalanine ammonia lyase                             233   2e-68   Ricinus communis
emb|CAJ43711.1|  phenylalanine ammonia lyase                            217   2e-68   Plantago major [cart-track plant]
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    233   2e-68   Brassica rapa
gb|AAX22053.1|  phenylalanine ammonia-lyase                             233   2e-68   Brassica napus [oilseed rape]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             233   2e-68   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             233   2e-68   Nelumbo nucifera [Indian lotus]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             233   3e-68   Garcinia mangostana [mangosteen]
gb|ABC69917.1|  phenylalanine ammonia-lyase                             233   3e-68   Brassica napus [oilseed rape]
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 233   3e-68   Pyrus x bretschneideri [bai li]
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           233   3e-68   Prunus domestica
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     233   3e-68   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           233   3e-68   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      233   3e-68   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            233   4e-68   
gb|ADY02661.1|  phenylalanine ammonia lyase                             232   4e-68   
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    229   5e-68   
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       232   5e-68   
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    229   5e-68
prf||2006271A  Phe ammonia lyase                                        232   6e-68
emb|CAB42794.1|  phenylalanine-ammonia lyase                            232   6e-68   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    232   6e-68   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             232   6e-68   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        232   7e-68   
gb|AFU82540.1|  phenylalanine ammonia-lyase                             217   7e-68   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             232   8e-68   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             231   8e-68   
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     231   9e-68   
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           231   9e-68   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           231   9e-68   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                231   1e-67   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      231   1e-67   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            231   1e-67   
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             231   1e-67   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           229   1e-67   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             231   1e-67   
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    227   1e-67
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    227   1e-67   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       228   2e-67   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   231   2e-67   
gb|AAY82485.1|  phenylalanine ammonia-lyase                             226   2e-67   
gb|AIB06732.1|  phenylalanine ammonia lyase                             231   2e-67   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      231   2e-67   
gb|AAM28276.1|  phenylalanine ammonia-lyase                             220   2e-67   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           230   2e-67   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       229   2e-67   
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      230   2e-67   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        230   3e-67   
gb|AID69536.1|  phenylalanine ammonia-lyase                             227   3e-67   
gb|ADY02662.1|  phenylalanine ammonia lyase                             230   3e-67   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             230   3e-67   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             231   3e-67   
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    230   3e-67   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           231   3e-67   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      230   4e-67   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           230   4e-67   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 228   4e-67   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   229   5e-67   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             229   5e-67   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             227   6e-67   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        229   6e-67   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             229   6e-67   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             229   7e-67   
gb|AAR31107.1|  phenylalanine ammonia-lyase                             229   7e-67   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             229   8e-67   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    229   9e-67   
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     229   9e-67   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             229   9e-67   
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             229   9e-67   
gb|KJB16792.1|  hypothetical protein B456_002G248000                    229   1e-66   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           228   1e-66   
gb|AER12109.1|  PAL                                                     228   1e-66   
gb|AGH13333.1|  phenylalanine ammonia-lyase                             228   1e-66   
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      228   1e-66   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             228   2e-66   
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          228   2e-66   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             228   2e-66   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    228   2e-66   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             228   2e-66   
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       222   2e-66   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             228   2e-66   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           228   2e-66   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            228   2e-66   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             228   2e-66   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             226   3e-66   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             227   3e-66   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 228   3e-66   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    227   3e-66   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        227   3e-66   
gb|ABR14606.1|  phenylalanine ammonia-lyase                             227   3e-66   
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           227   4e-66   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             227   4e-66   
dbj|BAM28965.1|  phenylalanine ammonia lyase                            217   5e-66   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             227   5e-66   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             225   6e-66   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             225   6e-66   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             226   6e-66   
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            227   6e-66   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             226   7e-66   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             226   9e-66   
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           217   1e-65   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           226   1e-65   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             225   1e-65   
gb|ADD12041.1|  phenylalanine ammonia lyase                             225   2e-65   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        225   2e-65   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           225   2e-65   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             225   3e-65   
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   4e-65   
ref|XP_007016787.1|  PHE ammonia lyase 1                                224   4e-65   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       224   4e-65   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             224   4e-65   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   5e-65   
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         224   5e-65   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    223   6e-65   
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       224   7e-65   
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   7e-65   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             223   7e-65   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             224   8e-65   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             223   9e-65   
gb|AEH02821.1|  phenylalanine ammonia lyase                             223   9e-65   
gb|AIZ76770.1|  PAL2                                                    216   1e-64   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              223   1e-64   
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       216   1e-64   
emb|CAA68064.1|  phenylalanine ammonia-lyase                            214   1e-64   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             223   1e-64   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            223   1e-64   
gb|AIZ76768.1|  PAL2                                                    215   1e-64   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   223   1e-64   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   1e-64   
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             217   1e-64   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             223   1e-64   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   1e-64   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             223   2e-64   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             223   2e-64   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             222   2e-64   
gb|ACG56648.1|  phenylalanine ammonia lyase                             222   2e-64   
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   218   2e-64   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             222   3e-64   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      222   4e-64   
gb|AGE10591.1|  phenylalanine amononia-lyase                            221   4e-64   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             221   5e-64   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        221   5e-64   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             221   7e-64   
gb|ACG56647.1|  phenylalanine ammonia lyase                             221   8e-64   
gb|AEC11891.1|  PAL1                                                    221   8e-64   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            221   8e-64   
gb|EMS57330.1|  Phenylalanine ammonia-lyase                             213   9e-64   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             221   9e-64   
dbj|BAJ85028.1|  predicted protein                                      219   9e-64   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          220   1e-63   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            214   1e-63   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        220   1e-63   
gb|AIZ76769.1|  PAL2                                                    216   2e-63   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             220   2e-63   
gb|AGE10605.1|  phenylalanine amononia-lyase                            210   2e-63   
gb|ACG80829.1|  phenylalanine ammonia lyase                             217   2e-63   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             219   2e-63   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            219   3e-63   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          219   3e-63   
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   212   4e-63   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        219   4e-63   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             219   5e-63   
gb|AIZ76767.1|  PAL2                                                    216   5e-63   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   5e-63   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    218   7e-63   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   8e-63   
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             217   8e-63   
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             217   9e-63   
gb|AHA42443.1|  phenylalanine ammonia lyase                             218   9e-63   
dbj|BAJ88975.1|  predicted protein                                      218   9e-63   
ref|NP_001053326.1|  Os04g0518400                                       218   9e-63   
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             216   1e-62   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           218   1e-62   
emb|CAA89005.1|  phenylalanine ammonia-lyase                            213   1e-62   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            218   1e-62   
gb|ACG80828.1|  phenylalanine ammonia lyase                             215   1e-62   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            217   1e-62   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        217   2e-62   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        217   2e-62   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           217   2e-62   
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   2e-62   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            217   2e-62   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           217   2e-62   
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             217   2e-62   
gb|AIC66437.1|  phenylalanine ammonia lyase                             217   2e-62   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        217   2e-62   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             216   3e-62   
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        216   3e-62   
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        216   3e-62   
gb|ADB97626.1|  phenylalanine ammonia-lyase                             216   3e-62   
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       216   4e-62   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        216   7e-62   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   7e-62   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            214   8e-62   
ref|XP_002448194.1|  hypothetical protein SORBIDRAFT_06g022750          215   8e-62   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   9e-62   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   9e-62   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       215   1e-61   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             215   1e-61   
gb|EMT28133.1|  Phenylalanine ammonia-lyase                             214   1e-61   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            215   1e-61   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   1e-61   
emb|CDY08611.1|  BnaA05g28470D                                          214   1e-61   
gb|AFR41234.1|  phenylalanine ammonia-lyase                             199   2e-61   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             214   2e-61   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        214   2e-61   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             214   2e-61   
dbj|BAJ85603.1|  predicted protein                                      214   2e-61   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             214   2e-61   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             213   4e-61   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        213   4e-61   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             213   4e-61   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            213   4e-61   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           213   4e-61   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             213   5e-61   
gb|AGE10617.1|  phenylalanine amononia-lyase                            211   5e-61   
gb|AFR41211.1|  phenylalanine ammonia-lyase                             198   5e-61   
gb|ACT22906.1|  phenylalanine ammonia-lyase                             211   5e-61   
gb|EMS63273.1|  Phenylalanine ammonia-lyase                             213   5e-61   
gb|EMS57328.1|  Phenylalanine ammonia-lyase                             212   5e-61   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             213   6e-61   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           213   6e-61   
emb|CDY00922.1|  BnaC05g42780D                                          213   6e-61   
gb|EMT29666.1|  Phenylalanine ammonia-lyase                             211   6e-61   
ref|NP_001047482.1|  Os02g0626400                                       213   9e-61   
gb|ACN28673.1|  unknown                                                 207   9e-61   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        212   1e-60   
gb|EEC73636.1|  hypothetical protein OsI_08144                          213   1e-60   
gb|EMT29849.1|  Phenylalanine ammonia-lyase                             212   1e-60   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        212   1e-60   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            211   1e-60   
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            212   1e-60   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG
Sbjct  568  AYADDPCSENYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  627

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSALENGNPAIPNRITECRSYPLYKFIREELGTE+LTGEKVQSPGEVCDKVFTAVCDGG
Sbjct  628  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGG  687

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  688  IIDPLLECLKSWNGAPLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPL QKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKA+LPKEVEG
Sbjct  569  AYADDPCSANYPLFQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEG  628

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+ENGNPAIPNRITECRSYPLYKF+REELGTE+LTGEKV+SPGEVCDKVFTAVCDGG
Sbjct  629  ARSAIENGNPAIPNRITECRSYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGG  688

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSW+GAPLPIC
Sbjct  689  IIDPLLECLKSWDGAPLPIC  708



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  576  AYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRITECRSYPLY+F+R+ELGTE+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  636  ARAALESGNPAIPNRITECRSYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQ  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLKSWNGAPLPIC
Sbjct  696  IIDPMLECLKSWNGAPLPIC  715



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  578  AYADDPCSCNYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIGAFEDELKAVLPKEVEN  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAI NRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE CDKVFTA+C+G 
Sbjct  638  ARAALESGNPAIANRITECRSYPLYRFVRKELGTELLTGERVRSPGEECDKVFTAMCNGQ  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLKSWNGAPLPIC
Sbjct  698  IIDPMLECLKSWNGAPLPIC  717



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFEDELK LLPKEVE 
Sbjct  128  AYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFEDELKTLLPKEVES  187

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GNPA+PNRI ECRSYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+C G 
Sbjct  188  ARAVLESGNPAVPNRIKECRSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQ  247

Query  261  IIDPLLECLKSWNGAPLPI  205
            IIDPL+ECL+SWNGAPLPI
Sbjct  248  IIDPLMECLQSWNGAPLPI  266



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE 
Sbjct  128  AYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVES  187

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G 
Sbjct  188  ARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGE  247

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  248  IIDPLLECLESWNGAPLPIC  267



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPLMQKLRQ LVDHALQNGE+EKN  TSIF K+AAFEDELKA+LPKEVE 
Sbjct  568  AYADDPCSANYPLMQKLRQALVDHALQNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEA  627

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  628  ARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGS  687

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSW+GAPLPIC
Sbjct  688  IIDPLLECLKSWDGAPLPIC  707



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPLMQKLRQ LVDHALQNGE EKN  TSIF K+AAFEDELKA+LPKEVE 
Sbjct  572  AYADDPCSANYPLMQKLRQALVDHALQNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEA  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  632  ARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGS  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSW+GAPLPIC
Sbjct  692  IIDPLLECLKSWDGAPLPIC  711



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE 
Sbjct  393  AYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVES  452

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G 
Sbjct  453  ARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQ  512

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLKSWNGAPLPIC
Sbjct  513  VIDPLLECLKSWNGAPLPIC  532



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELK LLPKEVE 
Sbjct  95   AYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKTLLPKEVES  154

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G 
Sbjct  155  ARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGE  214

Query  261  IIDPLLECLKSWNGAPLPI  205
            IIDPLLECL+SWNGAPLPI
Sbjct  215  IIDPLLECLESWNGAPLPI  233



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   256 bits (653),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  578  AYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE GNPAI NRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE C+KVFTA+C+G 
Sbjct  638  ARAALECGNPAIANRITECRSYPLYRFVRKELGTELLTGERVRSPGEECEKVFTAMCNGQ  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLKSWNGAPLPIC
Sbjct  698  IIDPMLECLKSWNGAPLPIC  717



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE 
Sbjct  302  TYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVES  361

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G 
Sbjct  362  ARALLESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQ  421

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  422  IIDPLLECLKSWNGAPLPIC  441



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE 
Sbjct  128  AYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVES  187

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+REEL T+ LTGEKV+SPGE  DKVFTA+  G 
Sbjct  188  ARAALESGNPAIPNRIEECRSYPLYKFVREELATDYLTGEKVRSPGEEFDKVFTAMSKGE  247

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL CL+SWNGAPLPIC
Sbjct  248  IIDPLLACLESWNGAPLPIC  267



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  582  AYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVES  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ +E+GNPAIPNRITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  642  ARAVVESGNPAIPNRITECRSYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQ  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  702  IIDPLLECLKSWNGAPLPIC  721



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  172  AYIDDPCLATYPLMQKLRQVLVDHALVNGEYEKDSKTSIFQKIATFEDELKSLLPKEVES  231

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPA+PN+I ECRSYPLYKF+R+ELGTE+LTGEK +SPGE CDK+FTA+C G 
Sbjct  232  ARAAYESGNPAMPNKINECRSYPLYKFVRKELGTELLTGEKTRSPGEECDKLFTAICQGK  291

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  292  IIDPLLECLGEWNGAPLPIC  311



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE 
Sbjct  578  AYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G 
Sbjct  638  ARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQ  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  698  IIDPLLECLKSWNGAPLPIC  717



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  583  AYADDPCSSTYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKAMLPKEVES  642

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GNP+IPNRITECRSYPLYK +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  643  ARAVLESGNPSIPNRITECRSYPLYKLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQ  702

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  703  IIDPLLECLQSWNGAPLPIC  722



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE 
Sbjct  418  AYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVES  477

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G 
Sbjct  478  ARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQ  537

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNGAPLPIC
Sbjct  538  IVDPLLECLQEWNGAPLPIC  557



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE 
Sbjct  580  AYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVES  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNPAIPNRITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  640  ARVVVESGNPAIPNRITECRSYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQ  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  700  IIDPLLECLKSWNGAPLPIC  719



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   253 bits (645),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPLMQKLRQVLV+HALQNGE+EKN S+SIFQKI AFE+ELK++LP+EVE 
Sbjct  572  AYADDPCSANYPLMQKLRQVLVEHALQNGENEKNASSSIFQKIVAFEEELKSVLPREVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAI NRI ECRSYPLYKF+REELGTE+LTGE+V+SPGE CDKVFTA+C+G 
Sbjct  632  ARVALESGNPAIANRINECRSYPLYKFVREELGTELLTGERVRSPGEECDKVFTAMCNGQ  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LLECLK WNGAPLP+C
Sbjct  692  IIDSLLECLKEWNGAPLPVC  711



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA LPKEVE 
Sbjct  582  AYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAALPKEVES  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ +E+GNPAIPNRITECRSYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  642  ARAVVESGNPAIPNRITECRSYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQ  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  702  IIDPLLECLKSWNGAPLPIC  721



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC++NYPLMQKLRQVLVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE 
Sbjct  584  AYVDDPCNSNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNPAIPNRITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  644  ARVVVESGNPAIPNRITECRSYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQ  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  704  IIDPLLECLKSWNGAPLPIC  723



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   239 bits (611),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VL++HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  96   AYIDDPCSATYPLMQKLREVLIEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  155

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  156  ARSAIEGGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  215

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  216  IIDPILGCLEGWNGAPLPIC  235



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE 
Sbjct  573  AYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  633  ARIALESGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQ  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LLECLK WNGAPLPIC
Sbjct  693  IIDSLLECLKEWNGAPLPIC  712



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  178  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  237

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G 
Sbjct  238  ARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGK  297

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  298  IIDPILECLEGWNGAPLPIC  317



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FE+ELKALLPKEVE 
Sbjct  172  AYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFEEELKALLPKEVES  231

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G 
Sbjct  232  ARAAYESGNAAIPNKINECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGK  291

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  292  IIDPLLECLGEWNGAPLPIC  311



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  169  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  228

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  229  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  288

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  289  IIDPLLDCLSAWNGAPLPIC  308



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE 
Sbjct  573  AYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAI NRI ECRSYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  633  ARAALESGNPAIANRIKECRSYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQ  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LLECLK WNGAPLPIC
Sbjct  693  IIDSLLECLKEWNGAPLPIC  712



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADD CSANYPLMQKLRQVLVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE 
Sbjct  573  AYADDACSANYPLMQKLRQVLVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAI NRI ECRSYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  633  ARAALESGNPAIANRIKECRSYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQ  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LLECLK WNGAPLPIC
Sbjct  693  IIDSLLECLKEWNGAPLPIC  712



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  176  SYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVES  235

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGNPAI N+I ECRSYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  236  AREAYENGNPAIANKIKECRSYPLYKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGK  295

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CLK WNGAPLPIC
Sbjct  296  IIDPMLDCLKEWNGAPLPIC  315



>ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE 
Sbjct  81   TYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEA  140

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G 
Sbjct  141  ARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGK  200

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAP+PIC
Sbjct  201  IIDPMLECLNEWNGAPIPIC  220



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADD CS+ YPLMQKLRQVLVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE 
Sbjct  578  AYADDTCSSTYPLMQKLRQVLVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G 
Sbjct  638  ARITLESGNPSIPNRITECRSYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQ  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  698  IIDPLLECLKSWNGAPLPIC  717



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCS+ YPLMQKLRQVLVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE A
Sbjct  583  YADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESA  642

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+ +E+GNPAIPNRITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G I
Sbjct  643  RAVVESGNPAIPNRITECRSYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQI  702

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLLECLKSWNGAP+PIC
Sbjct  703  IDPLLECLKSWNGAPIPIC  721



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  572  AYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSIFQKIEAFEEELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE GNPA+PNRITECRSYPLYKFIREE GTE LTGEKV SPGE CDKVFTA+ +G 
Sbjct  632  ARMALEAGNPAVPNRITECRSYPLYKFIREEAGTEFLTGEKVTSPGEECDKVFTALTNGF  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LL CL++WNGAPLPIC
Sbjct  692  IIDSLLTCLEAWNGAPLPIC  711



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQVLV+HAL+NG+ EKNVSTSIFQKI AFE+EL ALLPKEVE A
Sbjct  170  YIDDPCSATYPLMQKLRQVLVEHALKNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESA  229

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A+E+GNP IPNRI ECRSYPLYKF+REELGT  LTGEK  SPGE  DKVFTA+C+G +
Sbjct  230  RRAVESGNPGIPNRIKECRSYPLYKFVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQV  289

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLL+CLKSWNGAPLPIC
Sbjct  290  IDPLLDCLKSWNGAPLPIC  308



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE 
Sbjct  572  AYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G 
Sbjct  632  ARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQ  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNGAPLPIC
Sbjct  692  IVDPLLECLQEWNGAPLPIC  711



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE 
Sbjct  570  AYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPNEVEN  629

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LE+GNP+IPNRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G 
Sbjct  630  ARVILESGNPSIPNRITECRSYPLYRFVRKELGTELLTGERVRSPGEDIDKVFTALCNGQ  689

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  690  IIDPLLECLKSWNGAPLPIC  709



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCS  YPLMQKLRQVLVDHA++NGE E NV++SIFQKI AFEDELKA+LPKEVE A
Sbjct  584  YADDPCSCTYPLMQKLRQVLVDHAMKNGESESNVNSSIFQKIVAFEDELKAVLPKEVESA  643

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R  LE+GNP IPNRITECRSYPLY+F+R+ELGTE+LTGEK++SPGE  DKVFTA C+G I
Sbjct  644  RVVLESGNPVIPNRITECRSYPLYRFVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQI  703

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLLECLKSWNGAPLPIC
Sbjct  704  IDPLLECLKSWNGAPLPIC  722



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE 
Sbjct  210  AYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVES  269

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G PA+ NRI ECRSYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG 
Sbjct  270  ARIALESGAPAVANRIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGL  329

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNG PLPIC
Sbjct  330  IVDPLLECLQGWNGEPLPIC  349



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL N E+EKN +TSIFQKI+ FEDELK+LLPKEVE 
Sbjct  430  AYIDDPCSATYPLMQKLRQVLVDHALVNAENEKNQNTSIFQKISTFEDELKSLLPKEVES  489

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G 
Sbjct  490  ARNAYESGNPVIPNKINECRSYPLYKFVREELGTELLTGEKVRSPGEECDKLFTAICQGK  549

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  550  IIDPLLECLGEWNGAPLPIC  569



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFEDELKA+LPKEVE A
Sbjct  583  YADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESA  642

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+ +E+GNPAIPNRITECRSYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G I
Sbjct  643  RAVVESGNPAIPNRITECRSYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQI  702

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLLECLKSWNGAP+PIC
Sbjct  703  IDPLLECLKSWNGAPIPIC  721



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  578  AYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNSKTSIFQKIATFEDELKSLLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G 
Sbjct  638  ARAAYESGNPTIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  698  IIDPLLECLGEWNGAPLPIC  717



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE 
Sbjct  535  AYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVES  594

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+ENGNPAIPNRI +CRSYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G 
Sbjct  595  ARSAVENGNPAIPNRIRKCRSYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQ  654

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNGAPLPIC
Sbjct  655  IVDPLLECLQEWNGAPLPIC  674



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE 
Sbjct  572  AYVDDPCSATYPLMQKLRQVLVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GNPAIPNRI ECRSYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G 
Sbjct  632  ARSAVESGNPAIPNRIRECRSYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQ  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNGAPLPIC
Sbjct  692  IVDPLLECLQEWNGAPLPIC  711



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE 
Sbjct  573  AYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR +LENGNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  633  ARISLENGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQ  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LLECLK WNGAPLPIC
Sbjct  693  IIDSLLECLKEWNGAPLPIC  712



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL N E+EKN++TSIFQKIA FEDELK+LLPKEVE 
Sbjct  549  AYIDDPCSATYPLMQKLRQVLVDHALVNEENEKNMNTSIFQKIATFEDELKSLLPKEVES  608

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I ECRSYPLYKF+RE LGTE+LTGEKV+SPGE CDK+FTA+C+G 
Sbjct  609  ARAAYESGNPAIPNKINECRSYPLYKFVREGLGTELLTGEKVRSPGEECDKLFTAICEGK  668

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  669  IIDPLLECLGEWNGAPLPIC  688



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE 
Sbjct  584  AYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+ +E+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  644  VRAVVESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQ  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  704  IIDPLLECLKSWNGAPLPIC  723



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  277  AYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVES  336

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  337  ARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  396

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  397  IIDPLLDCLSAWNGAPLPIC  416



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADD CSANYPLMQKLRQVLVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE A
Sbjct  574  YADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESA  633

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R +LENGNPAI NRI ECRSYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G I
Sbjct  634  RISLENGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQI  693

Query  258  IDPLLECLKSWNGAPLPIC  202
            ID LLECLK WNGAPLPIC
Sbjct  694  IDSLLECLKEWNGAPLPIC  712



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE 
Sbjct  576  AYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A+E+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G 
Sbjct  636  ARAAVESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGE  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  696  IIDPLLECLQSWNGAPLPIC  715



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLM+KLRQV+VDHALQNGE EKNV+TSIFQKIAAFEDELK +LPKEVE 
Sbjct  577  AYVDDPCSGTYPLMEKLRQVIVDHALQNGESEKNVNTSIFQKIAAFEDELKTVLPKEVES  636

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALENGNPAIPNRI ECRSYPLYKF+RE++G E LTGEK +SPGE  DKVFTA+C+  
Sbjct  637  ARTALENGNPAIPNRIKECRSYPLYKFVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEK  696

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLK WNGAPLPIC
Sbjct  697  IIDPLLECLKEWNGAPLPIC  716



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE 
Sbjct  576  AYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A+E+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G 
Sbjct  636  ARAAVESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGE  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  696  IIDPLLECLQSWNGAPLPIC  715



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+ELKALLPKEVE 
Sbjct  572  TYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G 
Sbjct  632  ARHELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLP+C
Sbjct  692  LIDPMLECLKEWNGAPLPLC  711



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKI +FEDELK+LLPKEVE 
Sbjct  298  AYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIGSFEDELKSLLPKEVES  357

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G 
Sbjct  358  ARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKSRSPGEEFDKLFTAICQGK  417

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  418  IIDPLLECLGEWNGAPLPIC  437



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELK +LPKEVE 
Sbjct  576  AYVDDPCSATYPLMQKLRQVLVEHALTNGENEKNTSTSIFQKIAAFEEELKVVLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR +LENGN AIPNRI +CRSYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  636  ARVSLENGNAAIPNRIKDCRSYPLYKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLK WNGAPLPIC
Sbjct  696  IIDPMLECLKEWNGAPLPIC  715



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE 
Sbjct  565  AYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVES  624

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+  E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  625  VRAVFESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQ  684

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  685  IIDPLLECLKSWNGAPLPIC  704



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE 
Sbjct  565  AYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVES  624

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+  E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  625  VRAVFESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQ  684

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  685  IIDPLLECLKSWNGAPLPIC  704



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI  FEDELKALLPKEVE 
Sbjct  572  TYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGVFEDELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G 
Sbjct  632  ARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLP+C
Sbjct  692  LIDPMLECLKEWNGAPLPLC  711



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCS+ YPLMQKLRQVLVDHA++NG  E NV++SIFQKI AFE+ELKA+LPKEVE A
Sbjct  581  YADDPCSSTYPLMQKLRQVLVDHAMKNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESA  640

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G I
Sbjct  641  RAMLESGNPSIPNRITECRSYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQI  700

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLLECLKSWNGAPLPIC
Sbjct  701  IDPLLECLKSWNGAPLPIC  719



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FEDELK LLPKEVE 
Sbjct  584  AYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNLNTSIFQKIATFEDELKTLLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I  CRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  644  ARAAYESGNPAIPNKINGCRSYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAMCQGK  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLP+C
Sbjct  704  IIDPLLECLGEWNGAPLPVC  723



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE 
Sbjct  443  AYADDPCSSNYPLMQKLRQVLVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPDEVEN  502

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LE G+P IPNRITECRSYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G 
Sbjct  503  ARVVLEGGSPLIPNRITECRSYPLYRFVRKELGTELLTGERVRSPGEDVDKVFTALCNGQ  562

Query  261  IIDPLLECLKSWNGAPLPI  205
            IIDPLLECLKSWNGAPLPI
Sbjct  563  IIDPLLECLKSWNGAPLPI  581



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  565  SYIDDPCSATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVES  624

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G 
Sbjct  625  ARAAYESGNPTIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGK  684

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  685  IIDPLLECLGEWNGAPLPIC  704



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+ LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE 
Sbjct  579  AYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVET  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEKV+SPGE  +KVFTA+  G 
Sbjct  639  ARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGE  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  699  IIDPLLECLESWNGAPLPIC  718



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE 
Sbjct  317  AYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVES  376

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G 
Sbjct  377  ARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGK  436

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  437  IIDPLLECLGEWNGAPLPIC  456



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCS+ YPLMQKLRQVLVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE A
Sbjct  582  YADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESA  641

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+ LE+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G I
Sbjct  642  RALLESGNPSIPNRITECRSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQI  701

Query  258  IDPLLECLKSWNGAPLPIC  202
             DPLLECLKSWNGAPLPIC
Sbjct  702  NDPLLECLKSWNGAPLPIC  720



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE 
Sbjct  575  AYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A+ENGN AIPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G 
Sbjct  635  TRAAIENGNSAIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGE  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPL++CLK WNGAPLPIC
Sbjct  695  MIDPLMDCLKEWNGAPLPIC  714



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI  FE+ELKALLPKEVE 
Sbjct  143  SYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEQFEEELKALLPKEVEA  202

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G+PA+PNRI ECRSYPLYKF+REELG   LTGEK  SPGE CDKVFTA+C+G 
Sbjct  203  ARLALESGSPAVPNRIAECRSYPLYKFVREELGAGFLTGEKAVSPGEECDKVFTALCNGL  262

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CLK WNG PLPIC
Sbjct  263  IVDPLLDCLKGWNGQPLPIC  282



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NG+ EK++STSIFQKI AFEDELKALLPKEVE 
Sbjct  572  AYIDDPCSATYPLMQKLRQVLVDHALKNGDGEKSLSTSIFQKIEAFEDELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G 
Sbjct  632  ARIALESGNPAIANRITECRSYPLYKFIREELGTNFLTGEKVTSPGEECDKVFTALSKGL  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL  WNGAPLPIC
Sbjct  692  IVDPLLKCLDGWNGAPLPIC  711



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE 
Sbjct  218  TYADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEA  277

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G 
Sbjct  278  ARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGK  337

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP++ECL  WNGAP+PIC
Sbjct  338  IIDPMMECLNEWNGAPIPIC  357



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE 
Sbjct  441  AYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVES  500

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G 
Sbjct  501  ARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGE  560

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  561  IIDPLLECLESWNGAPLPIC  580



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQK+AAFE+ELKA+LPKEVE 
Sbjct  583  AYIDDPCSATYPLMQKLRQVLVEHALANGENEKNASTSIFQKVAAFEEELKAILPKEVES  642

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR +LENGN  IPNRI ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G 
Sbjct  643  ARLSLENGNAGIPNRIQECRSYPLYKFVREELGTGLLTGENVKSPGEEFDKVFTAMCQGK  702

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLK WNGAPLPIC
Sbjct  703  IIDPMLECLKEWNGAPLPIC  722



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE+EKN++TSIFQKIA FEDELKALLPKEVE 
Sbjct  580  AYIDDPCSATYPLMQKLRQVLVDHALVNGEYEKNLNTSIFQKIATFEDELKALLPKEVES  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPG   DK+FTA+C G 
Sbjct  640  ARAAYESGNPAIPNKIKECRSYPLYKFVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  700  IIDPLLECLGEWNGAPLPIC  719



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE 
Sbjct  575  AYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A+ENGN AIPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G 
Sbjct  635  TRAAIENGNSAIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGE  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPL++CLK WNGAPLPIC
Sbjct  695  MIDPLMDCLKEWNGAPLPIC  714



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE 
Sbjct  560  AYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVES  619

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+REELGTE LTGEK +SPGE  DKVFTA+  G 
Sbjct  620  ARAALESGNPAIPNRIEECRSYPLYKFVREELGTEYLTGEKARSPGEEFDKVFTAMSRGE  679

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL CL+SWNGAPLPIC
Sbjct  680  IIDPLLACLESWNGAPLPIC  699



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  570  AYIDDPCSATYPLMQKLRQVLVEHALKNGEGEKNASTSIFQKIEAFEEELKTLLPKEVES  629

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAI NRI ECRSYPLYKFIREELG + LTGEKV SPGE CDKVFTA+ +G 
Sbjct  630  ARTALESGNPAIANRIAECRSYPLYKFIREELGADFLTGEKVVSPGEECDKVFTALSNGL  689

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+ WNGAPLPIC
Sbjct  690  IIDPLLECLQGWNGAPLPIC  709



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  578  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G 
Sbjct  638  ARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  698  IIDPILECLEGWNGAPLPIC  717



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  578  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  638  ARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL+ WNGAPLPIC
Sbjct  698  IIDPILDCLEGWNGAPLPIC  717



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE 
Sbjct  575  AYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G 
Sbjct  635  ARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCEGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  695  IIDPMLECLGEWNGAPLPIC  714



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  587  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  646

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G 
Sbjct  647  ARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGK  706

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL+ WNGAPLPIC
Sbjct  707  IIDPILDCLEGWNGAPLPIC  726



>gb|AFK47120.1| unknown [Lotus japonicus]
Length=206

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQ LVDHAL+N + EKNV+TSIFQKIA FEDELKA+LPKEVE 
Sbjct  67   AYIDDPCSGTYPLMQKLRQSLVDHALENADAEKNVNTSIFQKIAIFEDELKAILPKEVES  126

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A +NG  AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G 
Sbjct  127  ARVAYDNGESAIPNKIKECRSYPLYKFVREELGTGLLTGEKVKSPGEDFDKLFTAMCQGK  186

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  187  IIDPILECLGEWNGAPLPIC  206



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE 
Sbjct  572  TYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVEN  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G 
Sbjct  632  ARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLP+C
Sbjct  692  LIDPMLECLKEWNGAPLPLC  711



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+NYPLMQKLRQVLVD A++NGE EK+ ++SIFQKI AFEDEL A+LPKEVE 
Sbjct  584  AYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKHFNSSIFQKIGAFEDELIAVLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+ +E+GNP+IPNRITECRSYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G 
Sbjct  644  VRAVVESGNPSIPNRITECRSYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQ  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLKSWNGAPLPIC
Sbjct  704  IIDPLLECLKSWNGAPLPIC  723



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQKLRQVLVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE 
Sbjct  572  TYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVEN  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LENGNPAIPNRITECRSYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G 
Sbjct  632  ARLELENGNPAIPNRITECRSYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLP+C
Sbjct  692  LIDPMLECLKEWNGAPLPLC  711



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE A
Sbjct  242  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAA  301

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  302  RVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  361

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  362  IDPLMECLSEWNGAPIPIC  380



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A+E+GNP+ PNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGAVESGNPSTPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE A
Sbjct  242  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAA  301

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  302  RVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  361

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  362  IDPLMECLSEWNGAPIPIC  380



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE 
Sbjct  576  AYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G 
Sbjct  636  ARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  696  IIDPMLECLGEWNGAPLPIC  715



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQKLR VLV+HAL NG+ E++ STSIFQKIAAFE+ELKALLPKEVE 
Sbjct  191  TYIDDPCSATYPLMQKLRHVLVEHALSNGDKERSTSTSIFQKIAAFEEELKALLPKEVET  250

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+  ENG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV+SPGE CDKVF+A+C G 
Sbjct  251  TRAEYENGKTAIPNRIKECRSYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGK  310

Query  261  IIDPLLECLKSWNGAPLPI  205
            +IDPLL+CLK WNGAPLPI
Sbjct  311  LIDPLLDCLKEWNGAPLPI  329



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSANYPLMQKLRQVLVDHAL+NGE+EKN STSI Q+I AFE+ELKALLPKEVE 
Sbjct  572  AYIDDPCSANYPLMQKLRQVLVDHALKNGENEKNASTSILQEIEAFEEELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE GNPA+PNRITECRSYPLYKFIR E GTE LTGEKV SPGE CDKVFTA+ +G 
Sbjct  632  ARMALEAGNPAVPNRITECRSYPLYKFIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGF  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IID LL CL++WNGAPLPIC
Sbjct  692  IIDQLLTCLEAWNGAPLPIC  711



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA+FE+ELK LLPKEVEG
Sbjct  277  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIASFEEELKTLLPKEVEG  336

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G 
Sbjct  337  ARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGN  396

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  397  IIDPLLECLGEWNGAPLPIC  416



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EKN+STSIFQKIAAFEDELKALLPKEVE 
Sbjct  569  AYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVES  628

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ +E+GNPAIPNRI ECRSYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+  G 
Sbjct  629  ARAVVESGNPAIPNRIKECRSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGE  688

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL CL+SWNGAPLPI 
Sbjct  689  IIDPLLACLESWNGAPLPIA  708



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  580  AYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  640  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  700  IIDPILGCLEGWNGAPLPIC  719



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  580  AYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  640  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  700  IIDPILGCLEGWNGAPLPIC  719



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  578  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G+  +PNRITECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G 
Sbjct  638  ARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL+ WNGAPLPIC
Sbjct  698  IIDPILDCLEGWNGAPLPIC  717



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE 
Sbjct  577  AYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVES  636

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G 
Sbjct  637  ARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGE  696

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  697  IIDPLLECLESWNGAPLPIC  716



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAICEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE 
Sbjct  571  AYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G PA+ NRI ECRSYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG 
Sbjct  631  ARIALESGAPAVANRIAECRSYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGL  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNG PLPIC
Sbjct  691  IVDPLLECLQGWNGEPLPIC  710



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPC A YPLMQKLRQVLV+HAL+NGE EKN STSIF KI  FE+ELKALLPKEVE 
Sbjct  143  SYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNASTSIFHKIEQFEEELKALLPKEVEA  202

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G+PA+PNRI ECRSYPLYKF+RE+LG   LTGEK  SPGE CDKVFTA+C+G 
Sbjct  203  ARMALESGSPAVPNRIAECRSYPLYKFVREQLGAGFLTGEKAVSPGEECDKVFTALCNGL  262

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CLK WNG PLPIC
Sbjct  263  IVDPLLDCLKGWNGQPLPIC  282



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFE+ELK LLPKEVEG
Sbjct  574  AYVDDPCSATYPLMQKLRQVLVDHALMNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEG  633

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR   ENGN AIPNRI ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVF+A+C G 
Sbjct  634  ARIEFENGNAAIPNRIEECRSYPLYKFVREVLGTSLLTGEKVISPGEECDKVFSAMCAGK  693

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK WNGAPLPIC
Sbjct  694  LIDPLLECLKEWNGAPLPIC  713



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VLV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  580  AYIDDPCSATYPLMQKLREVLVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  640  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  700  IIDPILGCLEGWNGAPLPIC  719



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  568  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  627

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  628  ARGGVESGNPSIPNRIRECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  687

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  688  IIDPLLDCLSAWNGAPLPIC  707



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPLM+KLRQVLVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  575  AYADDPCSANYPLMKKLRQVLVDHALANGENEKNASTSVFQKIGAFEEELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  635  ARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  695  IIDPMLECLGEWNGAPLPIC  714



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  580  AYIDDPCSATYPLMQKLRQVLVDHALLNGEKEKNSSTSIFQKIGAFEEELKALLPKEVEN  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+  +NGNPAIPN+I ECRSYPLYKF+REELGT +LTGEK++SPGE  DKVF+A+C G 
Sbjct  640  ARTEYDNGNPAIPNKIKECRSYPLYKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  700  LIDPMLECLKEWNGAPLPIC  719



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  545  AYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVES  604

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G 
Sbjct  605  ARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGK  664

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPL+ECL  WNGAPLPIC
Sbjct  665  IIDPLMECLGEWNGAPLPIC  684



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE 
Sbjct  575  AYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G 
Sbjct  635  ARAALESGNPAIPNRIEECRSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGE  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  695  IIDPLLECLESWNGAPLPIC  714



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  575  AYADDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G 
Sbjct  635  ARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  695  IIDPMLECLGEWNGAPLPIC  714



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE 
Sbjct  572  AYIDDPCSATYPLMQKLRQVLVDHALKNGETEKNVSTSIFHKIEAFEEELKALLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE GNPAI NRI+ECRSYPLYKFIREELG   LTGEK  SPGE CD+VFTA+ +G 
Sbjct  632  ARIALEGGNPAIANRISECRSYPLYKFIREELGASFLTGEKTTSPGEECDRVFTALSNGL  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL CL+ WNGAPLPIC
Sbjct  692  IVDPLLNCLQGWNGAPLPIC  711



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  575  AYADDPCSATYPLMQKLRQVLVDHALANGENEKNTSTSVFQKITAFEEELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  635  ARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  695  IIDPMLECLGEWNGAPLPIC  714



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIRECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   242 bits (617),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  551  AYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVES  610

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G 
Sbjct  611  ARAAYESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGK  670

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPL+ECL  WNGAPLPIC
Sbjct  671  IIDPLMECLGEWNGAPLPIC  690



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK +LPKEVE 
Sbjct  591  AYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNASTSIFQKITAFEEELKTILPKEVES  650

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN AIPNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G 
Sbjct  651  ARAAYESGNAAIPNRIVECRSYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGN  710

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL  WNG PLPIC
Sbjct  711  IIDPILDCLSGWNGEPLPIC  730



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCS  YPLMQKLRQVLVDHAL N E+EK+V+TSIFQKIA FE+ELK +LPKEVE 
Sbjct  101  SYIDDPCSGTYPLMQKLRQVLVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVES  160

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A E+G  AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G 
Sbjct  161  TRAAYESGKAAIPNKIKECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGK  220

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  221  IIDPLLECLGEWNGAPLPIC  240



>ref|XP_011041027.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X2 [Populus 
euphratica]
Length=711

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVEN  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK WNGAPLPIC
Sbjct  692  LIDPLLECLKEWNGAPLPIC  711



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE+EKN STSIFQKI AFE ELKA+LPKEVE 
Sbjct  574  AYVDDPCSATYPLMQKLRQVLVEHALKNGENEKNASTSIFQKIEAFEAELKAVLPKEVES  633

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G PAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE CD+VFTA+  G 
Sbjct  634  ARVALEDGKPAIANRITECRSYPLYKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGL  693

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL+ WNGAPLPIC
Sbjct  694  IVDPLLKCLEGWNGAPLPIC  713



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVEN  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK WNGAPLPIC
Sbjct  692  LIDPLLECLKEWNGAPLPIC  711



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL NGE+EKN STS+FQKIA FE+ELKALLPKEVE 
Sbjct  575  AYADDPCSATYPLMQKLRQVLVDHALANGENEKNASTSVFQKIATFEEELKALLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  635  ARAAYDSGNSAIENKIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  695  IIDPMLECLGEWNGAPLPIC  714



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE 
Sbjct  416  AYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVEN  475

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G 
Sbjct  476  ARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEEFDKVFTAMCQGK  535

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNGAPLPIC
Sbjct  536  IIDPMLECLWEWNGAPLPIC  555



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE 
Sbjct  582  AYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVEN  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G 
Sbjct  642  ARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGK  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  702  IIDPMLECLREWNGAPLPIC  721



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQK+RQVLV+HAL NGE+EKNVSTSIFQKI AFE+ELKALLPKEVE 
Sbjct  571  AYIDDPCSETYPLMQKVRQVLVEHALNNGENEKNVSTSIFQKIVAFEEELKALLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+ LE+GNP IPNRI +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  TRAGLESGNPFIPNRIKDCRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL  WNGAPLPIC
Sbjct  691  IIDPLLDCLSGWNGAPLPIC  710



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE 
Sbjct  582  AYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVEN  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G 
Sbjct  642  ARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGK  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  702  IIDPMLECLREWNGAPLPIC  721



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  631  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS+NYPLMQKLRQVLVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE 
Sbjct  581  AYVDDPCSSNYPLMQKLRQVLVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+ +E+GNP I NRITECRSYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  641  VRAVVESGNPLIRNRITECRSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQ  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLK WNGAPLPIC
Sbjct  701  IIDPLLECLKRWNGAPLPIC  720



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE 
Sbjct  531  SYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVEN  590

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            +R ++ENGNPAIPN+IT+CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G 
Sbjct  591  SRVSIENGNPAIPNKITKCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGK  650

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  651  VIDPMLECLKEWNGAPLPIC  670



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DD CSA YPLMQKLRQVLVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  573  SYVDDACSATYPLMQKLRQVLVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGNPAI N+I ECRSYPLYKF+REE+GT +LTGEK++SPGE  DKVFTA+C G 
Sbjct  633  AREAYENGNPAIANKIKECRSYPLYKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGK  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CLK WNGAPLPIC
Sbjct  693  IIDPMLDCLKEWNGAPLPIC  712



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL N E+EKNV+TSIFQKI  FE+ELK LLPKEVEG
Sbjct  576  AYIDDPCSATYPLMQKLRQVLVEHALANAENEKNVNTSIFQKITTFEEELKTLLPKEVEG  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENG  AIPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G 
Sbjct  636  ARIAYENGQSAIPNKIKECRSYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLEC+  WNGAPLP+C
Sbjct  696  IIDPLLECIGEWNGAPLPLC  715



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR+VL +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLREVLXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+GN A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G 
Sbjct  641  ARSAIESGNAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L CL+ WNGAPLPIC
Sbjct  701  IIDPILGCLEGWNGAPLPIC  720



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE 
Sbjct  581  AYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+++ENGN AIPN+I ECRS+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G 
Sbjct  641  ARASVENGNAAIPNKIKECRSFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGR  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  701  IIDPMLECLEEWNGAPLPIC  720



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE 
Sbjct  579  SYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVEN  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            +R +++NGNPAIPN+ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G 
Sbjct  639  SRVSIQNGNPAIPNKITECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGK  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  699  VIDPMLECLKEWNGAPLPIC  718



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQ LV+HAL+NG++E+N++TSIFQKIA FEDELKALLPKEVE 
Sbjct  577  AYIDDPCSATYPLMQKLRQTLVEHALKNGDNERNMNTSIFQKIATFEDELKALLPKEVES  636

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ALE+GNPAIPNRI ECRSYPLYKF+R+ELG E LTGEKV SPGE  DKVF A+  G 
Sbjct  637  ARAALESGNPAIPNRIEECRSYPLYKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGE  696

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL+SWNGAPLPIC
Sbjct  697  IIDPLLECLESWNGAPLPIC  716



>ref|XP_011041026.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X1 [Populus 
euphratica]
Length=749

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  610  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVEN  669

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  670  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTRLLTGEKVKSPGEEFDKVFTAICAGK  729

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK WNGAPLPIC
Sbjct  730  LIDPLLECLKEWNGAPLPIC  749



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE 
Sbjct  396  AYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVES  455

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G 
Sbjct  456  ARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGK  515

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECL  WNG PLPIC
Sbjct  516  LIDPMLECLSGWNGEPLPIC  535



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC A YPLMQKLRQVLVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE 
Sbjct  591  AYIDDPCLATYPLMQKLRQVLVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVES  650

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP I N+I ECRSYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G 
Sbjct  651  ARAAYESGNPTISNKINECRSYPLYKFVREELGTELLTGEKSRSPGEECDKLFTAICQGK  710

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  711  IIDPLLECLGEWNGAPLPIC  730



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE 
Sbjct  587  AYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVES  646

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ENGN AI N+ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G 
Sbjct  647  ARTAYENGNAAISNKITECRSYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGK  706

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECL+ WNG PLPIC
Sbjct  707  LIDPMLECLRGWNGEPLPIC  726



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ +RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  547  AYIDDPCSATYPLMQNVRQVLVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVES  606

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  607  ARGGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGK  666

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  667  IIDPLLDCLSAWNGAPLPIC  686



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK+RQVLV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  571  AYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +E+GNP+IPNRI ECRSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G 
Sbjct  631  ARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGETVRSPGEDFDKVFTAMCEGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL +WNGAPLPIC
Sbjct  691  IIDPLLDCLSAWNGAPLPIC  710



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE 
Sbjct  480  AYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVES  539

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  540  ARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGK  599

Query  261  IIDPLLECLKSWNGAPLPIC  202
             IDPLL+CLK WNGAPLPIC
Sbjct  600  FIDPLLDCLKEWNGAPLPIC  619



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHALQNGE+EKNV TSIF KI +FE+ELKALLPKE E 
Sbjct  96   AYIDDPCSATYPLMQKLRQVLVDHALQNGENEKNVGTSIFHKIESFEEELKALLPKEDES  155

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR +LE+GNPAI NRI ECRSYPLYKFIR ELG   LTGEK  SPGE C+KVFTA+  G 
Sbjct  156  ARISLESGNPAIANRIAECRSYPLYKFIRGELGASFLTGEKATSPGEECEKVFTALSKGL  215

Query  261  IIDPLLECLKSWNGAPLP  208
            I+DPLLECL+ WNGAPLP
Sbjct  216  IVDPLLECLQGWNGAPLP  233



>ref|XP_006428758.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
 gb|ESR41998.1| hypothetical protein CICLE_v10011134mg [Citrus clementina]
Length=757

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE 
Sbjct  618  AYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVEN  677

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNP IPNRI ECRSYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G 
Sbjct  678  ARQTVENGNPTIPNRIKECRSYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGK  737

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  738  IIDPMLECLREWNGAPLPIC  757



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE 
Sbjct  585  AYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVES  644

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G 
Sbjct  645  ARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGK  704

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  705  IIDPLLECLGEWNGAPLPIC  724



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPL QKLRQVLVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE 
Sbjct  585  AYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVES  644

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G 
Sbjct  645  ARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGK  704

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  705  IIDPLLECLGEWNGAPLPIC  724



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  692  LIDPLLECLKEWDGAPLPIC  711



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  692  LIDPLLECLKEWDGAPLPIC  711



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA Y +MQKLRQVLV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE 
Sbjct  581  AYIDDPCSATYSMMQKLRQVLVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVES  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+++ENGN AIPN+I ECRS+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G 
Sbjct  641  ARASVENGNAAIPNKIKECRSFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLK WNGAPLPIC
Sbjct  701  IIDPMLECLKEWNGAPLPIC  720



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DD CSA YPLMQKLRQVLVDHAL N + EKN++TSIFQKI  FE+ELK LLPKEVE 
Sbjct  193  AYVDDACSATYPLMQKLRQVLVDHALANADGEKNLNTSIFQKITTFEEELKTLLPKEVES  252

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENG  AIPN+I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  253  ARVAYENGQCAIPNKIEECRSYPLYKFVREELGTGLLTGEKVISPGEECDKLFTAMCQGK  312

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  313  IIDPLLECLGEWNGAPLPIC  332



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLVDHAL+NG+ E N STSIFQKI AFE ELK LLPKEVE 
Sbjct  579  AYIDDPCSATYPLMQKLRHVLVDHALENGDREGNSSTSIFQKIGAFEQELKTLLPKEVES  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R  +ENGNPA+PNRI ECRSYPLYKF+RE LGT +LTGEK++SPGE CDKVF A+CDG 
Sbjct  639  VRVDVENGNPAVPNRIIECRSYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGR  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
             IDP+L+CLK WNGAPLPIC
Sbjct  699  FIDPMLDCLKEWNGAPLPIC  718



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVDHAL NGE EKNVSTSIFQKI AFE ELKA+LPKEVE 
Sbjct  569  AYIDDPCSGTYPLMQKLRQVLVDHALNNGESEKNVSTSIFQKIEAFEVELKAILPKEVES  628

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAI NRITECRSYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G 
Sbjct  629  ARIALESGNPAIGNRITECRSYPLYKFIREELGTNYLTGEKVVSPGEECDKVFTALSKGL  688

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL+ WNGAP PIC
Sbjct  689  IVDPLLKCLEGWNGAPPPIC  708



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL+NGE EK  +TSIFQKI AFEDEL A LPKEVE 
Sbjct  574  AYIDDPCSATYPLMQKLRQVLVEHALKNGETEKEANTSIFQKIGAFEDELIANLPKEVES  633

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAIPN+I ECRSYPLYKF+REELGTE+LTGEKV+SPGE CDKVFTA+  G 
Sbjct  634  ARIALESGNPAIPNKINECRSYPLYKFVREELGTELLTGEKVRSPGEECDKVFTAMSKGL  693

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNG PLPIC
Sbjct  694  IIDPLLECLNGWNGEPLPIC  713



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  
Sbjct  580  YADDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEAT  639

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  +GN AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G I
Sbjct  640  RAAYGSGNAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKI  699

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  700  IDPLMDCLKEWNGAPIPIC  718



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPL+QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE 
Sbjct  571  AYADDPCSANYPLIQKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEEELKTHLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+  ENGNPAIPN+I ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G 
Sbjct  631  ARTEFENGNPAIPNKIEECRSYPLYKFVREVLGTNLLTGEKVISPGEECDKVFTAMCAGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK WNGAPLPIC
Sbjct  691  LIDPLLDCLKDWNGAPLPIC  710



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  576  AYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G 
Sbjct  636  ARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNG+PLPIC
Sbjct  696  IIDPMLECLGEWNGSPLPIC  715



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHA+ NGE EKN STSIFQKI AFE+ELK LLPKEVE 
Sbjct  571  AYVDDPCSATYPLMQKLRQVLVDHAMMNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+  ENGNPAI N+I ECRSYPLYKF+REELG  +LTGEK++SPGE  DKVF+A+C G 
Sbjct  631  ARTEYENGNPAISNKIKECRSYPLYKFVREELGCSLLTGEKIRSPGEEFDKVFSAICAGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  691  LIDPMLECLKEWNGAPLPIC  710



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC+A YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ 
Sbjct  578  AYIDDPCNATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDS  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+AL++G   +PNRITECRSYPLYKF+REELG E LTGE+V+SPGE CDKVF+A+C+G 
Sbjct  638  ARAALDSGTAGVPNRITECRSYPLYKFVREELGAEYLTGEEVRSPGEECDKVFSAICEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL+ WNGAPLPIC
Sbjct  698  IIDPILDCLEGWNGAPLPIC  717



>gb|ADP09383.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=132

 Score =   223 bits (568),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  597  ANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENG  418
            A YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+G
Sbjct  1    ATYPLMQKLRQVLVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESG  60

Query  417  NPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLEC  238
            N A+PNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L+C
Sbjct  61   NAAVPNRIAECRSYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILDC  120

Query  237  LKSWNGAPLPIC  202
            L+ WNGAPLPIC
Sbjct  121  LEGWNGAPLPIC  132



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE 
Sbjct  585  SYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVES  644

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGN  I N+I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  645  ARGAYENGNTTISNKIKECRSYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGK  704

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPI 
Sbjct  705  IIDPLLECLGDWNGAPLPIS  724



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  576  AYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G 
Sbjct  636  ARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNG+PLPIC
Sbjct  696  IIDPMLECLGEWNGSPLPIC  715



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  
Sbjct  580  YVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEAT  639

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  NG  AIPNRITECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G +
Sbjct  640  RAAYGNGTAAIPNRITECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKM  699

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  700  IDPLMDCLKEWNGAPIPIC  718



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE 
Sbjct  480  AYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVES  539

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  540  ARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGK  599

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK W GAPLPIC
Sbjct  600  LIDPLLDCLKEWKGAPLPIC  619



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ+LRQVLV+HAL NGE+EKN +TSIFQKI+AFE+ELK +LPKEVE 
Sbjct  585  AYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNANTSIFQKISAFEEELKTILPKEVES  644

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN AIPNRI ECRSYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G 
Sbjct  645  ARAACESGNAAIPNRIIECRSYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGK  704

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+L+CL  WNG PLPIC
Sbjct  705  IIDPILDCLSGWNGEPLPIC  724



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  543  AYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVES  602

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNP +PNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  603  ARLEVENGNPVVPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGK  662

Query  261  IIDPLLECLKSWNGAPLPIC  202
            ++DPLLECLK WNGAPLPIC
Sbjct  663  LMDPLLECLKEWNGAPLPIC  682



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVD+AL+NGE EKN STSIF KI AFE+ELK+LLPKEVE 
Sbjct  574  AYVDDPCSATYPLMQKLRQVLVDNALKNGESEKNASTSIFHKIEAFEEELKSLLPKEVES  633

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE GNPAI NRI ECRSYPLYKFIREELGTE LTGEKV SPGE CDK+FTA+  G 
Sbjct  634  ARIALEAGNPAIGNRIKECRSYPLYKFIREELGTEYLTGEKVISPGEECDKIFTAISKGL  693

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL+ WNGAPLPIC
Sbjct  694  IVDPLLKCLEGWNGAPLPIC  713



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIGSFEEELKTLLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  692  LIDPLLECLKEWDGAPLPIC  711



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQVLVDHALQNG  E + +TSIF KIAAFE ELK LLPKEVE A
Sbjct  227  YIDDPCSATYPLMQKLRQVLVDHALQNGNRENDANTSIFLKIAAFEKELKTLLPKEVESA  286

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R  +ENG  AIPNRI ECRSYPLY+F+REELGT +LTGEKV+SPGE  DKVFTA+C+G +
Sbjct  287  RIEVENGKSAIPNRIKECRSYPLYRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKL  346

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLL+CLK WNGAPLP+C
Sbjct  347  IDPLLDCLKGWNGAPLPLC  365



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDP SA YPLMQKLRQVLVDHAL+NG++EKN STSIFQKIAAFE+ELK LLPKEVE A
Sbjct  576  YIDDPTSATYPLMQKLRQVLVDHALENGDNEKNSSTSIFQKIAAFEEELKTLLPKEVERA  635

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A ENGN ++PN+I ECRSYPLYKF+RE+LG  +LTGEK +SPGE CDKVFTA+C G I
Sbjct  636  RTAYENGNSSVPNKIKECRSYPLYKFVREDLGAGLLTGEKTRSPGEECDKVFTALCQGKI  695

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPLLECL  WNGAPLPIC
Sbjct  696  IDPLLECLGEWNGAPLPIC  714



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE 
Sbjct  578  AYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  638  ARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
             IDPLL+CLK WNGAPLPIC
Sbjct  698  FIDPLLDCLKEWNGAPLPIC  717



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKI  FE+EL+A+LPKEVE 
Sbjct  582  AYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNTSTSIFQKITDFEEELQAVLPKEVES  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LENGN AIPN I +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  642  ARVTLENGNAAIPNMIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGK  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECLK WNGAPLPIC
Sbjct  702  IIDPMLECLKEWNGAPLPIC  721



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  588  YADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAA  647

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  648  RAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  707

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP++ECL  WNGAPLPIC
Sbjct  708  IDPMMECLNEWNGAPLPIC  726



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE 
Sbjct  284  TYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEA  343

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G 
Sbjct  344  ARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGK  403

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPL+ECL  WNGAP+PIC
Sbjct  404  IIDPLMECLDEWNGAPIPIC  423



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  
Sbjct  580  YVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEAT  639

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  NG  AIPNRITECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +
Sbjct  640  RAAYGNGTAAIPNRITECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKL  699

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  700  IDPLMDCLKEWNGAPIPIC  718



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  587  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAA  646

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  647  RAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  706

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP++ECL  WNGAP+PIC
Sbjct  707  IDPMMECLNEWNGAPIPIC  725



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  692  LIDPLLECLKEWDGAPLPIC  711



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN STSIFQKIA FE+ELK LLPKEVEG
Sbjct  578  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTSTSIFQKIATFEEELKTLLPKEVEG  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G 
Sbjct  638  ARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  698  IIDPLLECLGEWNGAPLPIC  717



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+ LPKEVE 
Sbjct  395  TYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSFLPKEVES  454

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G 
Sbjct  455  ARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGK  514

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECL  WNG PLPIC
Sbjct  515  LIDPMLECLSGWNGEPLPIC  534



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  587  YADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAA  646

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  647  RAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  706

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP++ECL  WNGAP+PIC
Sbjct  707  IDPMMECLNEWNGAPIPIC  725



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQ LRQVLV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  572  SYIDDPCSATYPLMQNLRQVLVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVES  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  632  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  692  LIDPLLECLKEWDGAPLPIC  711



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEG
Sbjct  480  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEG  539

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G 
Sbjct  540  ARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGK  599

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  600  IIDPLLECLGEWNGAPLPIC  619



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQVLV+HAL NGE EKN STSIFQKIA FE+EL A+LPKEVE A
Sbjct  583  YIDDPCSATYPLMQKLRQVLVEHALTNGESEKNTSTSIFQKIADFEEELHAVLPKEVESA  642

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R  LENGN AIPN I +CRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G I
Sbjct  643  RVTLENGNAAIPNMIKDCRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKI  702

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP+LECLK WNGAPLPIC
Sbjct  703  IDPMLECLKEWNGAPLPIC  721



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  587  YADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAA  646

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  647  RAAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  706

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP++ECL  WNGAP+PIC
Sbjct  707  IDPMMECLNEWNGAPIPIC  725



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQVLVDHAL N + +KN  +SIF KI AFE+ELK LLPKEVEG
Sbjct  129  AYADDPCSATYPLMQKLRQVLVDHALINADRDKNSGSSIFHKIGAFEEELKTLLPKEVEG  188

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R  +E GN AIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF+A+C G 
Sbjct  189  TRLEVEAGNAAIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFSAMCAGK  248

Query  261  IIDPLLECLKSWNGAPLPI  205
            +IDPLL+CLK WNGAPLPI
Sbjct  249  MIDPLLDCLKEWNGAPLPI  267



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKNV+TSIFQKI AFE+ELKA LPKEVE  
Sbjct  587  YVDDPCSATYPLMQKLRQVIVDHALCNGETEKNVATSIFQKIGAFEEELKATLPKEVEAT  646

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G I
Sbjct  647  RAAFGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKI  706

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  707  IDPLMDCLKEWNGAPIPIC  725



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS NYPLMQKLRQVLV+HAL+NG++EKN+STSIFQKI AFEDELKALLPKEVE 
Sbjct  573  AYVDDPCSENYPLMQKLRQVLVEHALKNGDNEKNLSTSIFQKIGAFEDELKALLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+GNPAI NRI ECRSYPLY+FIREELGT  LTGEKV SPGE  DKVFTA+  G 
Sbjct  633  ARIALESGNPAIANRIKECRSYPLYRFIREELGTGFLTGEKVTSPGEEGDKVFTALSKGL  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL+ W+G+PLPIC
Sbjct  693  IVDPLLKCLEGWSGSPLPIC  712



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE 
Sbjct  587  AYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVES  646

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ENGN AI N+ITECRSYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G 
Sbjct  647  ARTAYENGNAAISNKITECRSYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGK  706

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+L CL  WNG PLPIC
Sbjct  707  LIDPMLACLSGWNGEPLPIC  726



>ref|XP_010684079.1| PREDICTED: phenylalanine ammonia-lyase [Beta vulgaris subsp. 
vulgaris]
 emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris]
Length=719

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS  YPLMQKLRQVLVD AL NG+ EKNVSTSIFQKI AFE+ELKA LPKEVE 
Sbjct  580  AYADDPCSVTYPLMQKLRQVLVDQALANGDSEKNVSTSIFQKIGAFEEELKARLPKEVEA  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN  IPNRI ECRSYP+YKFIREEL T +LTGEKV SPGE  DKVFTA+C G 
Sbjct  640  ARAAYESGNSVIPNRIKECRSYPVYKFIREELNTNLLTGEKVISPGEEIDKVFTAICQGK  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CLK WNGAPLPIC
Sbjct  700  IIDPLLDCLKEWNGAPLPIC  719



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE 
Sbjct  579  SYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVEN  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            +R ++ENGN AIPN+I ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G 
Sbjct  639  SRVSVENGNAAIPNKIMECRSYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAICQGK  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  699  VIDPMLECLKEWNGAPLPIC  718



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLR+VLVDHAL+NG+++KN +TSIFQKI AFE+ELKA+LPKEVE 
Sbjct  651  AYIDDPCSGTYPLMQKLREVLVDHALKNGDNQKNAATSIFQKIEAFEEELKAVLPKEVES  710

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+ENGN A+ NRI ECRSYPLYKF+REELGTE LTGEK+ SPGE CDKVFTA+  G 
Sbjct  711  ARSAVENGNAAVGNRIKECRSYPLYKFMREELGTEFLTGEKLTSPGEECDKVFTALSKGL  770

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLLECL+ WNGAPLPIC
Sbjct  771  IVDPLLECLEGWNGAPLPIC  790



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE 
Sbjct  582  AYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEA  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN  IPNRI ECRSYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G 
Sbjct  642  ARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGK  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPL++CLK WNGAPLPIC
Sbjct  702  IIDPLMDCLKEWNGAPLPIC  721



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS+ YPLMQKLRQV+VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE 
Sbjct  582  AYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEA  641

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GN  IPNRI ECRSYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G 
Sbjct  642  ARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGK  701

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPL++CLK WNGAPLPIC
Sbjct  702  IIDPLMDCLKEWNGAPLPIC  721



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   224 bits (572),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLV+HAL NGE E +  TSIFQKI AFE+ELK LLPKEV+ 
Sbjct  95   AYIDDPCSATYPLMQKLRHVLVEHALSNGEKEISTGTSIFQKITAFEEELKTLLPKEVDN  154

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            A +  ENG  AIPNRI ECRSYPLYKF+REELGT++LTG+KV+SPGE CDKVF A+C G 
Sbjct  155  AWAEYENGKTAIPNRIKECRSYPLYKFVREELGTDLLTGDKVRSPGEECDKVFNAMCAGK  214

Query  261  IIDPLLECLKSWNGAPLPI  205
            +IDPLL+CLK WNGAPLPI
Sbjct  215  LIDPLLDCLKEWNGAPLPI  233



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  589  YADDPCSATYPLIQKLRQVIVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAA  648

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  649  RAAYDNGTSAIPNRIKECRSYPLYRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKI  708

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP++ECL  WNGAP+PIC
Sbjct  709  IDPMMECLNEWNGAPIPIC  727



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  584  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAA  643

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G I
Sbjct  644  RAAYDNGTAAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKI  703

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  704  IDPLMECLDEWNGAPIPIC  722



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC++ YPL+QKLRQVLVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  582  AYVDDPCNSTYPLIQKLRQVLVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVEN  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ +E+GNPAIPNRITECRSYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G 
Sbjct  639  ARAVVESGNPAIPNRITECRSYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGE  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLK+WNGAP+PIC
Sbjct  699  IIDPLLECLKNWNGAPIPIC  718



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +YADDPCSA YPLM+KLRQVLVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE 
Sbjct  169  SYADDPCSATYPLMRKLRQVLVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVES  228

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA E+GN  IPNRI ECRSYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G 
Sbjct  229  ARSAFESGNLEIPNRIKECRSYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGK  288

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLK W+G+PLPIC
Sbjct  289  IIDPLLECLKEWDGSPLPIC  308



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  584  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAA  643

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G I
Sbjct  644  RAAYDNGTAAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKI  703

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  704  IDPLMECLDEWNGAPIPIC  722



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NG++EK+++TSIFQKI+ FE+ELKALLPKEVE 
Sbjct  569  AYIDDPCSATYPLMQKLRQVLVDHALLNGQNEKDLNTSIFQKISTFEEELKALLPKEVES  628

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A+E+GNP IPNRI ECRSYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G 
Sbjct  629  MRTAIESGNPLIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEEIDKVFTAICQGK  688

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL C+  W G+PLPIC
Sbjct  689  LIDPLLACVSEWYGSPLPIC  708



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  584  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAA  643

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G I
Sbjct  644  RAAYDNGTAAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKI  703

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  704  IDPLMECLDEWNGAPIPIC  722



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEG
Sbjct  577  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEG  636

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I ECRSYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G 
Sbjct  637  ARVAYENDQCAIPNKIKECRSYPLYKFVREELGTALLTGERVVSPGEECDKVFTAMCQGK  696

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  697  IIDPLLECLGEWNGAPLPIC  716



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQK RQVLV+HAL NGE EKN ++SIFQKI  FE+ELK +LPKEVE 
Sbjct  575  AYIDDPCSATYPLMQKFRQVLVEHALANGEDEKNTNSSIFQKIHVFEEELKVVLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA ENGNP + N+I +CRSYPLYKFIR+ELGTE+LTGEK +SPGEVC+KVFTA+C G 
Sbjct  635  ARSAYENGNPTVQNQIKKCRSYPLYKFIRKELGTELLTGEKAKSPGEVCEKVFTALCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAP+PIC
Sbjct  695  MIDPILECLKEWNGAPIPIC  714



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE A
Sbjct  587  YIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESA  646

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +
Sbjct  647  RIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKL  706

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP+LECL  WNG PLPIC
Sbjct  707  IDPMLECLSGWNGEPLPIC  725



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE  +N +TSIFQKI +FE+ELK LLPKEVE 
Sbjct  571  SYIDDPCSATYPLMQKLRQVLVEHALVNGEKVRNSTTSIFQKIGSFEEELKTLLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  631  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  691  LIDPLLECLKEWDGAPLPIC  710



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA+ PLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE 
Sbjct  581  AYIDDPCSASSPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEI  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GN AIPNRI ECRSYPLYK +RE++GT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  641  ARTELESGNAAIPNRIKECRSYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  701  LIDPMLECLKEWNGAPLPIC  720



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPCSA YPLMQKLRQVLV+HAL NGE E+N +T+I QKI +FE+ELK LLPKEVE 
Sbjct  568  SYIDDPCSATYPLMQKLRQVLVEHALVNGERERNSTTTILQKIGSFEEELKTLLPKEVES  627

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENGNPAIPNRI ECRSYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G 
Sbjct  628  ARLEVENGNPAIPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGK  687

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK W+GAPLPIC
Sbjct  688  LIDPLLECLKEWDGAPLPIC  707



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPC++ YPL+QKLRQVLVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE 
Sbjct  583  AYVDDPCNSTYPLIQKLRQVLVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVEN  639

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ +E+GNPAIPNRITECRSYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G 
Sbjct  640  ARAVVESGNPAIPNRITECRSYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGE  699

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECLK+WNGAP+PIC
Sbjct  700  IIDPLLECLKNWNGAPIPIC  719



>gb|ABF50788.1| phenylalanine ammonia-lyase [Isatis tinctoria]
Length=725

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEV+ 
Sbjct  586  AYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVDA  645

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ENG  AIPNRI ECRSYPLY+F+REELGT++LTG++V SPGE  DKVFTA+C+G 
Sbjct  646  ARAAYENGTSAIPNRIKECRSYPLYRFVREELGTQLLTGDRVTSPGEEFDKVFTAICEGK  705

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP++ECL  WNGAP+PIC
Sbjct  706  IIDPMMECLNEWNGAPIPIC  725



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE 
Sbjct  581  AYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEI  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GN AI NRI ECRSYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G 
Sbjct  641  ARTELESGNAAIANRIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  701  LIDPMLECLKEWNGAPLPIC  720



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA+YPLMQKLRQVLVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE 
Sbjct  581  AYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEI  640

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+ LE+GN AI NRI ECRSYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G 
Sbjct  641  ARTELESGNAAIANRIKECRSYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGK  700

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  701  LIDPMLECLKEWNGAPLPIC  720



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  
Sbjct  580  YVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEAT  639

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  NG  AIPNRI ECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +
Sbjct  640  RAAYGNGTAAIPNRIAECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKL  699

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  700  IDPLMDCLKEWNGAPIPIC  718



>ref|XP_003591877.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES62128.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=722

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCS  YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+ELKALLPKEVE A
Sbjct  584  YIDDPCSPIYPLMQKLRYVLVDHALQNGDKEANSSTSIFQKIGAFEEELKALLPKEVENA  643

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R  +ENGNPA+PN I ECRSYPLYKF+RE LGT +LTGEK++SPGE CDKVFTA+CDG  
Sbjct  644  RVEIENGNPAVPNMIKECRSYPLYKFMRETLGTSLLTGEKIRSPGEDCDKVFTAMCDGRF  703

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDP+L+CLK WNG PLPIC
Sbjct  704  IDPMLDCLKEWNGVPLPIC  722



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLR VLVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE 
Sbjct  578  AYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            +R  +ENGNPAIPNRI ECRSYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  638  SRIEVENGNPAIPNRIKECRSYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK W GAPLPIC
Sbjct  698  LIDPLLDCLKEWKGAPLPIC  717



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE 
Sbjct  584  AYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A E+GNP +PN+I  CRSYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  644  TRAAYESGNPTVPNKINGCRSYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGK  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL  WNGAPLPI 
Sbjct  704  IIDPLLQCLGDWNGAPLPIS  723



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQV VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE 
Sbjct  576  AYVDDPCSATYPLMQKLRQVFVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G 
Sbjct  636  ARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPI  205
            IIDP+LECL  WNG+PLPI
Sbjct  696  IIDPMLECLGEWNGSPLPI  714



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE 
Sbjct  584  AYIDDPCSATYPLMQKLRQVLVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A E+GNP +PN+I  CRSYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  644  TRAAYESGNPTVPNKINGCRSYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGK  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLL+CL  WNGAPLPI 
Sbjct  704  IIDPLLQCLGDWNGAPLPIS  723



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ A
Sbjct  585  YVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAA  644

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G I
Sbjct  645  REAYGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKI  704

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECLK WNGAP+PIC
Sbjct  705  IDPLMECLKEWNGAPIPIC  723



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQKLRQV+VDHAL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ A
Sbjct  585  YVDDPCSATYPLMQKLRQVIVDHALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAA  644

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A  NG  AIPNRI ECRSYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G I
Sbjct  645  REAYGNGTAAIPNRIKECRSYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKI  704

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECLK WNGAP+PIC
Sbjct  705  IDPLMECLKEWNGAPIPIC  723



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSA YPLMQKLRQ+LV+HAL NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE 
Sbjct  575  AYADDPCSATYPLMQKLRQILVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVES  634

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R A E+GNPA  NRI ECRSYPLYKF+REELGT +LTG+KV SPGE  DKVFTA+C G 
Sbjct  635  VRIAYESGNPATANRIKECRSYPLYKFVREELGTGLLTGDKVMSPGEEFDKVFTAMCQGK  694

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+++CLK WNGAPLPIC
Sbjct  695  IIDPMMDCLKEWNGAPLPIC  714



>ref|XP_010107518.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16200.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=769

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
             Y DDPCSA YPLMQ LRQVLV+HAL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE 
Sbjct  630  TYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVES  689

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A ENGN AI N+ITECRSYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G 
Sbjct  690  ARIAYENGNAAISNKITECRSYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGK  749

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECL  WNG PLPIC
Sbjct  750  LIDPMLECLSGWNGEPLPIC  769



>gb|ACZ36441.1| phenylalanine ammonialyase [Brassica oleracea var. alboglabra]
Length=714

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  576  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPKEVEAA  635

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGT++LTGEK  SPGE  DKVFTA+C+G I
Sbjct  636  RAAYDNGTAAIPNRIKECRSYPLYRFVREELGTKLLTGEKATSPGEEFDKVFTAICEGKI  695

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  696  IDPLMECLDEWNGAPIPIC  714



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA+YPLMQKLRQV+VDHAL NGE EKNV TSIFQKI AFE+ELK +LPKEV+ A
Sbjct  580  YVDDPCSASYPLMQKLRQVIVDHALANGETEKNVETSIFQKIGAFEEELKTVLPKEVDAA  639

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A  NGN AIPNRI ECRSYPLYKF+R ELGT++LTGEKV SPGE  DKVFTA+C+G I
Sbjct  640  REAYGNGNAAIPNRIKECRSYPLYKFVRGELGTKLLTGEKVVSPGEEFDKVFTAMCEGKI  699

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+P+C
Sbjct  700  IDPLMDCLKEWNGAPIPLC  718



>ref|XP_009143533.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=719

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE A
Sbjct  581  YADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAA  640

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G I
Sbjct  641  RVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKI  700

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  701  IDPLMECLSEWNGAPIPIC  719



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQV+V+HAL+NGE+E+N STSIFQKIAAFE+ELK LLPKEVE 
Sbjct  420  AYIDDPCSATYPLMQKLRQVIVEHALKNGENERNASTSIFQKIAAFEEELKTLLPKEVES  479

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+  ENGNPAIPN+I E RSYPLYKF+REELG  +LTGEK +SPGE CDKVF+A+  G 
Sbjct  480  ARAEYENGNPAIPNKIKERRSYPLYKFVREELGAGLLTGEKARSPGEECDKVFSAIYAGK  539

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPI 
Sbjct  540  LIDPMLECLKEWNGAPLPIS  559



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPL+QKLRQVLVDHAL NGE E N STSIFQKI AFE+ELKA+LPKEVE 
Sbjct  578  AYADDPCSCNYPLIQKLRQVLVDHALLNGEGEMNSSTSIFQKIGAFEEELKAILPKEVES  637

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  LEN  P IPNRI ECRSYPLYKF+R+ELGT +LTGE VQSPGEV DKVFTA+ +G 
Sbjct  638  ARCDLENSKPTIPNRIQECRSYPLYKFVRKELGTNLLTGENVQSPGEVFDKVFTAINEGK  697

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK WNGAPLP+C
Sbjct  698  LIDPLLDCLKEWNGAPLPLC  717



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS+ YPLMQKLRQVLV+HAL NGE EKN STSIFQKI AFEDELKALLPKEVE 
Sbjct  584  AYIDDPCSSTYPLMQKLRQVLVEHALINGEREKNSSTSIFQKIVAFEDELKALLPKEVES  643

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R   ENGN AI NRI +CRSYPLYKF+REELG   LTGEK  SPGE CDKVFTA+C G 
Sbjct  644  TRIDYENGNSAISNRIKDCRSYPLYKFVREELGASFLTGEKTTSPGEECDKVFTAMCAGK  703

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK WNGAPLPIC
Sbjct  704  LIDPLLDCLKEWNGAPLPIC  723



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STS+FQKI AFE+ELK LLPKEVE 
Sbjct  574  AYIDDPCSATYPLMQKLRQVLVEHALANGENEKNASTSVFQKIGAFEEELKTLLPKEVES  633

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A E+G+ AI N+I ECRSYPLYKF+REELG+ +LTGEKV+SPGE  DKVFTA+C+G 
Sbjct  634  AREAYESGSAAIGNKIKECRSYPLYKFVREELGSGLLTGEKVRSPGEEFDKVFTAMCEGK  693

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP++ECLK WNGAPLPIC
Sbjct  694  IIDPMMECLKEWNGAPLPIC  713



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLV+HAL N E+EK+ STSIFQKI AFEDELKA+LPKEVE 
Sbjct  573  AYIDDPCSTTYPLMQKLRQVLVEHALNNTENEKSGSTSIFQKIEAFEDELKAVLPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            +R ALE+GNPAIPNRI +CRSYPLYKF+R+EL TE LTGE+V SPGEV DKVFTA+  G 
Sbjct  633  SRVALESGNPAIPNRIKDCRSYPLYKFVRDELKTEFLTGERVTSPGEVLDKVFTAMSKGL  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDP+LECLK WNGAPLPIC
Sbjct  693  MIDPMLECLKGWNGAPLPIC  712



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEG
Sbjct  573  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEG  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I +CRSYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G 
Sbjct  633  ARLAYENDQCAIPNKIKDCRSYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGK  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  693  IIDPLLECLGEWNGAPLPIC  712



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCS  YPLMQKLRQVLVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEG
Sbjct  573  AYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEG  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A EN   AIPN+I +CRSYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G 
Sbjct  633  ARLAYENDQCAIPNKIKDCRSYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGK  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  693  IIDPLLECLGEWNGAPLPIC  712



>dbj|BAH20339.1| AT3G53260 [Arabidopsis thaliana]
Length=579

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            Y DDPCSA YPLMQ+LRQV+VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE A
Sbjct  441  YVDDPCSATYPLMQRLRQVIVDHALSNGETEKNAVTSIFQKIGAFEEELKAVLPKEVEAA  500

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A  NG   IPNRI ECRSYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +
Sbjct  501  RAAYGNGTAPIPNRIKECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKL  560

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL++CLK WNGAP+PIC
Sbjct  561  IDPLMDCLKEWNGAPIPIC  579



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQ+LRQVLVDHAL NGE EKN +TSIFQKIA FEDELKA+LPKEVE 
Sbjct  200  AYIDDPCSATYPLMQRLRQVLVDHALNNGETEKNTNTSIFQKIATFEDELKAILPKEVES  259

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
             R+A E  + +IPNRI  CRSYPLY+F+REELG   LTGEKV SPGE  DKVFTA+C G 
Sbjct  260  VRTAYETDSLSIPNRIKACRSYPLYRFVREELGGGFLTGEKVTSPGEEFDKVFTAMCKGE  319

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLEC++ WNGAPLPIC
Sbjct  320  LIDPLLECVEGWNGAPLPIC  339



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCSANYPL+QKLRQVLVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE 
Sbjct  571  AYADDPCSANYPLIQKLRQVLVDHALMNGDREKDSTTSIFQKIGVFEEELKTQLPKEVES  630

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+  ENG+PAI N+I ECRSYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G 
Sbjct  631  ARTEFENGSPAIANKIEECRSYPLYKFVREVLGTHLLTGEKVISPGEECDKVFTAMCAGK  690

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLL+CLK WNGAPLPIC
Sbjct  691  LIDPLLDCLKDWNGAPLPIC  710



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLVDHAL+NGE+EKN+STS+FQKI AFE+ELKALLPKEVE 
Sbjct  576  AYVDDPCSATYPLMQKLRQVLVDHALENGENEKNLSTSVFQKIGAFEEELKALLPKEVES  635

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ++GN AI N+I ECRSYPLYKF+REELG  +LTGEKVQSPGE  DKVF A+C G 
Sbjct  636  ARAAYDSGNSAIDNKIKECRSYPLYKFVREELGAVLLTGEKVQSPGEEFDKVFAAMCQGK  695

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL  WNG+PLPI 
Sbjct  696  IIDPMLECLGEWNGSPLPIS  715



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPL QKLRQVLVDHAL NGE EKN +TSIFQKIA FE+ELK LLPKEVE 
Sbjct  586  AYIDDPCSATYPLSQKLRQVLVDHALVNGESEKNFNTSIFQKIATFEEELKTLLPKEVES  645

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A E+GNP IPN+I  CRSYPLYKF+REELGT +LTGE V SPGE CDK+F+A+C G 
Sbjct  646  ARTAYESGNPTIPNKINGCRSYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGK  705

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDPLLECL  WNGAPLPIC
Sbjct  706  IIDPLLECLGEWNGAPLPIC  725



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSANYPLMQKLRQVLVDHAL+NG+ EKNV TSIFQKI  FE+EL A+LPKEVE 
Sbjct  572  AYIDDPCSANYPLMQKLRQVLVDHALKNGDSEKNVGTSIFQKIQVFEEELTAVLPKEVEA  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE GNPAIPNRI ECRSYPLY FIREELGTE LTGEK  SPGE  +KVFTA+ +G 
Sbjct  632  ARIALEAGNPAIPNRIKECRSYPLYSFIREELGTEFLTGEKTVSPGEEGEKVFTALSNGL  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CL++WNG PLPIC
Sbjct  692  IVDPLLKCLEAWNGEPLPIC  711



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPC A YPLMQKLRQVLVDHAL N E EKN +TSIFQKIA FEDELKA+LPKEVE 
Sbjct  573  AYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNSNTSIFQKIATFEDELKAILPKEVES  632

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR+A ENG   I N+I ECRSYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G 
Sbjct  633  ARTAYENGQSGISNKIKECRSYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGK  692

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPL+ECL  WNGAPLPIC
Sbjct  693  IVDPLMECLGEWNGAPLPIC  712



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EKN STSIFQKI+ FE+ELK LLPKEVE 
Sbjct  577  AYIDDPCSAVYPLMQKLRQVLVEHALSNGENEKNSSTSIFQKISLFEEELKVLLPKEVES  636

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            ARSA+E+ N AIPN+I +CRSYPLY+FIR ELGT +LTGEKV SPGE  DKVFTA+C+G 
Sbjct  637  ARSAVESDNAAIPNQIKDCRSYPLYRFIRGELGTALLTGEKVVSPGEEIDKVFTAMCEGK  696

Query  261  IIDPLLECLKSWNGAPLPIC  202
            +IDPLLECLK WNGAPLPIC
Sbjct  697  LIDPLLECLKEWNGAPLPIC  716



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            +Y DDPC A YPLMQKLRQVLV+HAL+NGE EK+VSTSIF KI  FE+EL ALLPKEVE 
Sbjct  143  SYIDDPCLATYPLMQKLRQVLVEHALKNGEGEKSVSTSIFHKIEQFEEELMALLPKEVES  202

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR ALE+G+PA+PNRI ECRSYPLYKFIRE+LG   LTGEK  SPGE CD VFTA+ +G 
Sbjct  203  ARIALESGSPAVPNRIAECRSYPLYKFIREDLGAGFLTGEKAVSPGEECDMVFTALSNGL  262

Query  261  IIDPLLECLKSWNGAPLPIC  202
            I+DPLL+CLK+WNG PLPIC
Sbjct  263  IVDPLLDCLKAWNGQPLPIC  282



>gb|KDO50673.1| hypothetical protein CISIN_1g005031mg [Citrus sinensis]
Length=718

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AY DDPCSA YPLMQKLRQVLV+HAL NGE+EK  ++SIFQKIAAFE+ELK +LPKEVE 
Sbjct  579  AYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVEN  638

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR  +ENG+P IPNRI ECRSYPLY+ +REELG+  LTGEKV SPGE  DKVFTA+C G 
Sbjct  639  ARQTVENGSPTIPNRIKECRSYPLYRLVREELGSNFLTGEKVTSPGEEFDKVFTAMCQGK  698

Query  261  IIDPLLECLKSWNGAPLPIC  202
            IIDP+LECL+ WNGAPLPIC
Sbjct  699  IIDPMLECLREWNGAPLPIC  718



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  621  AYADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEG  442
            AYADDPCS NYPLMQKLRQVLVDHAL NG+ EKN STSIFQKI AFE+ELKA+LPKEVEG
Sbjct  572  AYADDPCSENYPLMQKLRQVLVDHALNNGDKEKNASTSIFQKIQAFEEELKAVLPKEVEG  631

Query  441  ARSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGG  262
            AR A+E G   I NRI ECRSYPLYKFIREE+GTE LTGEKV SPGE CDKVF A+ +G 
Sbjct  632  ARLAVEGGKEVIGNRIKECRSYPLYKFIREEVGTEFLTGEKVTSPGEECDKVFKALTNGL  691

Query  261  IIDPLLECLKSWNGAPLPIC  202
            ++DPL +CL++WNGAPLPIC
Sbjct  692  MVDPLFKCLEAWNGAPLPIC  711



>gb|ADA81868.1| phenylalanine ammonia-lyase [Brassica rapa subsp. chinensis]
Length=721

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  618  YADDPCSANYPLMQKLRQVLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGA  439
            YADDPCSA YPL+QKLRQV+VDHAL NGE EK+  TSIF KI AFE+ELKA+LPKEVE A
Sbjct  583  YADDPCSATYPLIQKLRQVIVDHALVNGESEKDAMTSIFHKIGAFEEELKAVLPKEVEAA  642

Query  438  RSALENGNPAIPNRITECRSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGI  259
            R+A +NG  AIPNRI ECRSYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G I
Sbjct  643  RAAYDNGTAAIPNRIKECRSYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKI  702

Query  258  IDPLLECLKSWNGAPLPIC  202
            IDPL+ECL  WNGAP+PIC
Sbjct  703  IDPLMECLDEWNGAPIPIC  721



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950