BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041H09

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        120   6e-28   Nicotiana tomentosiformis
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        120   6e-28   Nicotiana sylvestris
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             120   9e-28   Citrus clementina [clementine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   120   1e-27   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        120   1e-27   Citrus sinensis [apfelsine]
emb|CBI22461.3|  unnamed protein product                                120   1e-27   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             120   1e-27   Vitis vinifera
ref|XP_002527509.1|  zinc finger protein, putative                      119   3e-27   Ricinus communis
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             119   4e-27   
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   117   2e-26   Citrus sinensis [apfelsine]
emb|CDO97275.1|  unnamed protein product                                116   2e-26   Coffea canephora [robusta coffee]
gb|AAF22842.1|AF209910_1  vacuolar sorting receptor protein             110   2e-26   Prunus dulcis [sweet almond]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    116   3e-26   Gossypium raimondii
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               116   3e-26   Gossypium arboreum [tree cotton]
gb|KJB32252.1|  hypothetical protein B456_005G231800                    115   4e-26   Gossypium raimondii
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         115   8e-26   Jatropha curcas
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        114   1e-25   Nelumbo nucifera [Indian lotus]
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                114   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        114   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             114   1e-25   Theobroma cacao [chocolate]
emb|CDY65441.1|  BnaCnng47180D                                          114   2e-25   Brassica napus [oilseed rape]
gb|KHG15071.1|  Vacuolar-sorting receptor 3 -like protein               112   2e-25   Gossypium arboreum [tree cotton]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             113   3e-25   Brassica rapa
dbj|BAD94353.1|  putative vacuolar sorting receptor                     103   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             111   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        111   1e-24   Eucalyptus grandis [rose gum]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             111   2e-24   
emb|CDX93144.1|  BnaA03g38660D                                          110   2e-24   
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            110   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             110   2e-24   Populus euphratica
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             110   2e-24   Prunus mume [ume]
emb|CDX81459.1|  BnaC09g08700D                                          110   2e-24   
emb|CDY37219.1|  BnaA09g08400D                                          110   2e-24   Brassica napus [oilseed rape]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        110   2e-24   Brassica rapa
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             110   2e-24   Prunus persica
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    110   3e-24   Arabis alpina [alpine rockcress]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          110   3e-24   
ref|NP_179079.1|  vacuolar-sorting receptor 4                           110   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        110   4e-24   Solanum tuberosum [potatoes]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             109   5e-24   Eutrema salsugineum [saltwater cress]
gb|AAB72112.1|  vacuolar sorting receptor homolog                       109   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002489188.1|  hypothetical protein SORBIDRAFT_0013s004010        103   9e-24   
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             108   2e-23   Tarenaya hassleriana [spider flower]
gb|EAY78120.1|  hypothetical protein OsI_33166                          103   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             107   3e-23   Capsella rubella
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             107   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        107   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        107   3e-23   Camelina sativa [gold-of-pleasure]
gb|KJB12292.1|  hypothetical protein B456_002G010300                    107   3e-23   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    107   3e-23   Gossypium raimondii
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    107   4e-23   Glycine max [soybeans]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             107   4e-23   Glycine soja [wild soybean]
gb|ABR17683.1|  unknown                                                 107   4e-23   Picea sitchensis
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   4e-23   Sesamum indicum [beniseed]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             107   5e-23   Solanum lycopersicum
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   5e-23   Populus euphratica
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        106   7e-23   Pyrus x bretschneideri [bai li]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        106   7e-23   
ref|XP_002885935.1|  VSR-2                                              106   8e-23   
ref|NP_001064400.1|  Os10g0346600                                       106   9e-23   
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    106   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        106   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             105   1e-22   Populus trichocarpa [western balsam poplar]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             105   2e-22   Glycine soja [wild soybean]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    105   2e-22   Glycine max [soybeans]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        105   2e-22   Morus notabilis
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        105   2e-22   
ref|XP_004172174.1|  PREDICTED: vacuolar-sorting receptor 4-like      98.2    2e-22   
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  105   2e-22   Medicago truncatula
ref|XP_003610620.1|  Vacuolar-sorting receptor                          104   3e-22   
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    104   4e-22   
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        104   4e-22   Cucumis sativus [cucumbers]
gb|AGV54776.1|  vacuolar-sorting receptor                               104   4e-22   Phaseolus vulgaris [French bean]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             104   4e-22   Phaseolus vulgaris [French bean]
gb|AEZ00905.1|  putative BP-80 vacuolar sorting receptor protein        100   4e-22   Elaeis guineensis
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             104   4e-22   Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        104   4e-22   Glycine max [soybeans]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        103   1e-21   Sesamum indicum [beniseed]
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        102   1e-21   Elaeis guineensis
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    103   1e-21   
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             102   1e-21   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    102   1e-21   Glycine max [soybeans]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          102   3e-21   
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        101   5e-21   Cucumis sativus [cucumbers]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             100   6e-21   Phaseolus vulgaris [French bean]
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        100   6e-21   Cucumis melo [Oriental melon]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        100   8e-21   Cicer arietinum [garbanzo]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    100   1e-20   Arabis alpina [alpine rockcress]
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        100   1e-20   Elaeis guineensis
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  99.8    2e-20   Cicer arietinum [garbanzo]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...  99.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...  99.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like      99.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68621.1|  Vacuolar-sorting receptor 4                           95.9    3e-20   Triticum urartu
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...  98.2    5e-20   Pisum sativum [garden pea]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3           97.8    8e-20   Fragaria vesca subsp. vesca
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like      97.4    9e-20   Phoenix dactylifera
gb|AAN05373.1|  Putative vacuolar sorting receptor protein            97.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779827.1|  PREDICTED: vacuolar-sorting receptor 4-like      90.1    9e-19   
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like      94.4    1e-18   
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like      94.0    1e-18   Fragaria vesca subsp. vesca
dbj|BAJ85815.1|  predicted protein                                    92.0    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like      92.4    6e-18   
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg           91.7    1e-17   Prunus persica
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1           90.9    2e-17   Brachypodium distachyon [annual false brome]
gb|ACS91931.1|  vacuolar sorting receptor protein                     90.1    2e-17   Lilium longiflorum [Easter lily]
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230        90.1    4e-17   Amborella trichopoda
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like      89.7    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like      89.0    7e-17   Eucalyptus grandis [rose gum]
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like      89.0    7e-17   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK03786.1|  predicted protein                                    89.0    9e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like      88.6    1e-16   Phoenix dactylifera
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like      88.2    1e-16   Oryza brachyantha
gb|EMT19677.1|  Vacuolar-sorting receptor 1                           87.4    3e-16   
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like      87.4    3e-16   Oryza brachyantha
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  86.7    5e-16   Nicotiana tomentosiformis
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  86.7    5e-16   Nicotiana sylvestris
gb|AAB72113.1|  vacuolar sorting receptor homolog                     82.0    5e-16   
gb|KDP21863.1|  hypothetical protein JCGZ_00650                       86.3    6e-16   Jatropha curcas
ref|NP_001065992.1|  Os12g0116000                                     86.3    7e-16   
emb|CAN66483.1|  hypothetical protein VITISV_015390                   85.9    8e-16   Vitis vinifera
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1           85.9    8e-16   Vitis vinifera
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like      85.9    9e-16   Sesamum indicum [beniseed]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative  85.5    1e-15   Ricinus communis
gb|ACR34782.1|  unknown                                               82.8    1e-15   Zea mays [maize]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like      85.1    1e-15   Sesamum indicum [beniseed]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  85.1    2e-15   Nelumbo nucifera [Indian lotus]
gb|EEE52644.1|  hypothetical protein OsJ_35003                        85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                        84.7    2e-15   Oryza sativa Indica Group [Indian rice]
gb|EEE51529.1|  hypothetical protein OsJ_32728                        84.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg              84.7    2e-15   Erythranthe guttata [common monkey flower]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor   84.7    2e-15   Zea mays [maize]
gb|EEC68730.1|  hypothetical protein OsI_37233                        84.7    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like      84.3    3e-15   Elaeis guineensis
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.3    3e-15   Nicotiana tomentosiformis
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.3    3e-15   Nicotiana sylvestris
gb|EMS62484.1|  Vacuolar-sorting receptor 1                           84.7    3e-15   Triticum urartu
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218           84.0    4e-15   
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like      84.0    4e-15   Phoenix dactylifera
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462           84.0    4e-15   Selaginella moellendorffii
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.0    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like      84.0    4e-15   Solanum tuberosum [potatoes]
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.0    4e-15   
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.0    5e-15   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  84.0    5e-15   
ref|XP_001777810.1|  predicted protein                                83.6    5e-15   
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  83.6    5e-15   Solanum lycopersicum
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                 82.8    8e-15   Zea mays [maize]
gb|KGN58685.1|  hypothetical protein Csa_3G728020                     79.0    8e-15   Cucumis sativus [cucumbers]
gb|EPS72755.1|  hypothetical protein M569_02000                       82.8    8e-15   Genlisea aurea
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like      83.2    8e-15   Setaria italica
gb|ACN30885.1|  unknown                                               82.8    8e-15   Zea mays [maize]
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170        82.4    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  82.4    1e-14   Solanum lycopersicum
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like      82.4    1e-14   Populus euphratica
gb|EPS57970.1|  hypothetical protein M569_16845                       82.0    1e-14   Genlisea aurea
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1           82.0    2e-14   
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like      81.6    2e-14   Populus euphratica
gb|EMS63262.1|  Vacuolar-sorting receptor 1                           82.0    2e-14   Triticum urartu
gb|KDO64104.1|  hypothetical protein CISIN_1g0100102mg                76.3    3e-14   Citrus sinensis [apfelsine]
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160        81.6    3e-14   Sorghum bicolor [broomcorn]
ref|XP_002309184.1|  vacuolar sorting receptor family protein         81.3    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like      81.3    3e-14   
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g           80.5    4e-14   
gb|ACN25155.1|  unknown                                               78.6    5e-14   Zea mays [maize]
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  80.5    5e-14   Setaria italica
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg              80.5    6e-14   Erythranthe guttata [common monkey flower]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                           80.5    6e-14   
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  80.5    6e-14   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like      80.5    6e-14   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like      80.1    7e-14   Zea mays [maize]
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  80.1    7e-14   
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222            80.1    7e-14   
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like      79.7    9e-14   Oryza brachyantha
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.3    1e-13   Oryza brachyantha
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.3    1e-13   Prunus mume [ume]
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.3    1e-13   Populus euphratica
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1           79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like      79.0    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like      78.6    2e-13   Cucumis sativus [cucumbers]
emb|CDP06387.1|  unnamed protein product                              78.6    3e-13   Coffea canephora [robusta coffee]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  78.2    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...  78.2    3e-13   
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1              78.2    4e-13   
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010        78.2    4e-13   Sorghum bicolor [broomcorn]
ref|NP_001050034.1|  Os03g0335300                                     78.2    4e-13   
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein             77.8    4e-13   Gossypium arboreum [tree cotton]
gb|KJB71519.1|  hypothetical protein B456_011G126800                  77.8    5e-13   Gossypium raimondii
dbj|BAK00302.1|  predicted protein                                    77.4    6e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05589.1|  predicted protein                                    77.4    7e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001060643.1|  Os07g0680000                                     77.0    7e-13   
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926           77.0    7e-13   
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577           77.0    7e-13   Selaginella moellendorffii
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                      77.0    7e-13   Morus notabilis
gb|EEC82690.1|  hypothetical protein OsI_27347                        77.0    8e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_001785165.1|  predicted protein                                77.0    8e-13   
gb|AFW64624.1|  hypothetical protein ZEAMMB73_291086                  71.2    8e-13   
gb|EMS51356.1|  Vacuolar-sorting receptor 1                           77.0    8e-13   Triticum urartu
ref|NP_001169232.1|  hypothetical protein precursor                   76.6    9e-13   Zea mays [maize]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg           76.6    1e-12   Citrus clementina [clementine]
emb|CDY62642.1|  BnaCnng40690D                                        72.4    1e-12   Brassica napus [oilseed rape]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  76.3    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like      76.3    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  76.3    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_001759820.1|  predicted protein                                75.9    2e-12   
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...  75.9    2e-12
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  75.9    2e-12   
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like      75.5    3e-12   Eucalyptus grandis [rose gum]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like      75.5    3e-12   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                           75.1    3e-12   
emb|CDY04821.1|  BnaAnng00030D                                        74.7    5e-12   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  74.7    5e-12   Brassica rapa
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like      74.3    6e-12   Nicotiana tomentosiformis
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like      73.9    8e-12   Nicotiana sylvestris
emb|CDY38158.1|  BnaA07g02250D                                        72.0    9e-12   Brassica napus [oilseed rape]
ref|XP_001751750.1|  predicted protein                                73.6    1e-11   
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like      73.6    1e-11   Oryza brachyantha
ref|XP_001759928.1|  predicted protein                                73.2    1e-11   
ref|XP_001765481.1|  predicted protein                                72.8    2e-11   
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                  72.4    3e-11   Arabis alpina [alpine rockcress]
gb|AAG60258.1|  EGF receptor-like protein                             71.2    3e-11   Physcomitrella patens
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg           72.0    4e-11   
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg           71.6    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1           71.6    5e-11   Cucumis melo [Oriental melon]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663           71.6    5e-11   Arabidopsis lyrata subsp. lyrata
ref|NP_001189637.1|  vacuolar-sorting receptor 2                      71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg           71.2    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg           71.2    5e-11   Capsella rubella
gb|AAK82551.1|  AT3g52850/F8J2_20                                     71.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190853.1|  vacuolar-sorting receptor 1                         71.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                     71.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like      71.2    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2           70.9    7e-11   Tarenaya hassleriana [spider flower]
emb|CDX78128.1|  BnaA09g33230D                                        70.9    7e-11   
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1           70.9    7e-11   Camelina sativa [gold-of-pleasure]
gb|EPS73119.1|  hypothetical protein M569_01632                       70.9    7e-11   Genlisea aurea
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like      70.9    8e-11   
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like      70.9    8e-11   Cicer arietinum [garbanzo]
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1           70.9    8e-11   Brassica rapa
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like      70.9    8e-11   Brachypodium distachyon [annual false brome]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg           70.9    8e-11   
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2           70.9    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like      70.9    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like      70.5    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like      70.5    1e-10   Brachypodium distachyon [annual false brome]
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80           70.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|KJB29888.1|  hypothetical protein B456_005G122400                  70.1    1e-10   Gossypium raimondii
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein             70.1    2e-10   Gossypium arboreum [tree cotton]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  70.1    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  69.7    2e-10   
emb|CDX73599.1|  BnaC08g24040D                                        69.7    2e-10   
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940           69.7    2e-10   Arabidopsis lyrata subsp. lyrata
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                  69.7    2e-10   Arabis alpina [alpine rockcress]
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g           68.9    3e-10   Phaseolus vulgaris [French bean]
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like      68.9    3e-10   Brassica rapa
emb|CDY13344.1|  BnaC06g14130D                                        68.9    3e-10   Brassica napus [oilseed rape]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g           68.9    3e-10   Phaseolus vulgaris [French bean]
emb|CDX67539.1|  BnaA07g15790D                                        68.9    3e-10   
ref|NP_180588.1|  vacuolar-sorting receptor 2                         68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623631.1|  Vacuolar sorting receptor                        68.9    3e-10   Medicago truncatula
ref|XP_003626680.1|  Vacuolar sorting receptor                        68.9    4e-10   Medicago truncatula
ref|XP_001776090.1|  predicted protein                                68.6    4e-10   
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...  68.2    6e-10   Solanum tuberosum [potatoes]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like      67.8    8e-10   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                           67.8    8e-10   Glycine soja [wild soybean]
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  67.8    8e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like      67.8    8e-10   Pyrus x bretschneideri [bai li]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                           67.0    1e-09   Glycine soja [wild soybean]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like      67.0    1e-09   Glycine max [soybeans]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like      67.0    1e-09   Glycine max [soybeans]
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                      66.6    2e-09   
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like      65.9    3e-09   Solanum lycopersicum
ref|XP_002528135.1|  hypothetical protein RCOM_1195900                63.2    3e-09   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like      65.5    5e-09   
gb|KJB29886.1|  hypothetical protein B456_005G122400                  65.1    6e-09   
gb|KJB29887.1|  hypothetical protein B456_005G122400                  65.1    6e-09   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like      65.1    6e-09   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like      65.1    6e-09   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like      65.1    6e-09   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7           64.7    8e-09   
dbj|BAB64531.1|  vacuolar sorting receptor                            64.7    9e-09   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like      63.9    1e-08   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like      63.5    2e-08   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg           63.5    2e-08   
emb|CDY60753.1|  BnaA05g34780D                                        63.2    3e-08   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7           63.2    3e-08   
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like      63.2    3e-08   
emb|CDX91478.1|  BnaC04g06720D                                        63.2    3e-08   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg           62.8    4e-08   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg           62.8    4e-08   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like      62.4    4e-08   
emb|CDP18160.1|  unnamed protein product                              62.4    5e-08   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like      62.0    6e-08   
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  62.0    6e-08   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6           62.0    6e-08   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like      62.0    7e-08   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like      62.0    7e-08   
emb|CBI27239.3|  unnamed protein product                              62.0    7e-08   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7           61.6    8e-08   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.6    8e-08   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg           61.6    8e-08   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6           61.6    8e-08   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7           61.6    8e-08   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6           61.2    9e-08   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.6    9e-08   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6           61.2    1e-07   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.2    1e-07   
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like      61.2    1e-07   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein             60.8    1e-07   
gb|KJB48040.1|  hypothetical protein B456_008G051500                  60.8    1e-07   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like      60.8    1e-07   
gb|KDP43132.1|  hypothetical protein JCGZ_26665                       60.5    2e-07   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7           60.1    2e-07   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like      60.1    3e-07   
ref|NP_174375.1|  vacuolar sorting receptor 6                         59.7    3e-07   
gb|AAF98196.1|AC000107_19  F17F8.23                                   59.7    3e-07   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like      59.7    3e-07   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6           59.3    4e-07   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like      59.3    4e-07   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733           59.3    4e-07   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6           59.3    5e-07   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg           59.3    5e-07   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like      59.3    5e-07   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  59.3    5e-07   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180        58.9    6e-07   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440        58.9    7e-07   
gb|ABR17707.1|  unknown                                               58.5    7e-07   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg           58.5    7e-07   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  58.5    8e-07   
emb|CDY02347.1|  BnaA09g25550D                                        58.5    8e-07   
emb|CDY43178.1|  BnaCnng11060D                                        58.5    9e-07   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6           58.5    9e-07   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                  58.2    1e-06   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg           57.8    1e-06   
emb|CDX78975.1|  BnaA01g10420D                                        57.8    1e-06   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like      57.8    1e-06   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like      57.8    1e-06   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g           57.8    1e-06   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like      57.8    1e-06   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                57.8    1e-06   
ref|XP_002304606.1|  vacuolar sorting receptor family protein         57.8    2e-06   
ref|NP_193744.1|  vacuolar-sorting receptor 7                         57.4    2e-06   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                      57.4    2e-06   
emb|CAA16619.1|  vacuolar sorting receptor-like protein               57.4    2e-06   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857           57.0    3e-06   
ref|NP_001058298.1|  Os06g0664300                                     57.0    3e-06   
gb|KEH37345.1|  vacuolar-sorting receptor                             57.0    3e-06   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg              56.6    4e-06   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7           56.6    4e-06   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                  56.2    4e-06   
emb|CDY50060.1|  BnaCnng18670D                                        56.2    5e-06   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  56.2    5e-06   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  56.2    5e-06   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like      56.2    5e-06   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g           55.8    6e-06   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like      55.5    8e-06   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like      55.5    1e-05   
gb|EEC81131.1|  hypothetical protein OsI_24020                        55.1    1e-05   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544        55.1    1e-05   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg           55.1    1e-05   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                           55.1    1e-05   
gb|EMT15960.1|  hypothetical protein F775_17906                       54.7    1e-05   
gb|EMT18407.1|  Vacuolar-sorting receptor 1                           54.7    2e-05   
dbj|BAJ97179.1|  predicted protein                                    54.7    2e-05   
dbj|BAJ91429.1|  predicted protein                                    52.8    2e-05   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  54.3    2e-05   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  54.3    2e-05   
ref|NP_001053838.1|  Os04g0611400                                     54.3    2e-05   
gb|EYU23259.1|  hypothetical protein MIMGU_mgv1a0227551mg             52.4    2e-05   
dbj|BAJ91572.1|  predicted protein                                    54.3    2e-05   
emb|CAE03573.2|  OSJNBa0085I10.18                                     54.3    2e-05   
gb|KJB32254.1|  hypothetical protein B456_005G231800                  53.9    2e-05   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  53.9    3e-05   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor            53.9    3e-05   
gb|AFW87686.1|  vacuolar sorting receptor 7                           53.9    3e-05   
gb|ACN28195.1|  unknown                                               53.9    3e-05   
gb|EMT30552.1|  hypothetical protein F775_21497                       53.9    3e-05   
gb|EEE61664.1|  hypothetical protein OsJ_16123                        53.9    3e-05   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                      53.5    4e-05   
gb|EMS55782.1|  Vacuolar-sorting receptor 7                           53.1    5e-05   
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like      53.1    5e-05   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like      52.8    6e-05   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6           52.4    1e-04   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6           52.4    1e-04   
dbj|BAJ88964.1|  predicted protein                                    52.0    1e-04   
emb|CAN79862.1|  hypothetical protein VITISV_021998                   50.1    1e-04   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg           51.6    2e-04   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                  51.6    2e-04   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  51.2    2e-04   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  51.2    2e-04   
gb|AFW87687.1|  hypothetical protein ZEAMMB73_666808                  47.8    3e-04   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5           50.8    3e-04   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like      50.1    6e-04   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210           50.1    6e-04   
gb|KJB12294.1|  hypothetical protein B456_002G010300                  49.3    0.001   



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   120 bits (302),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVSD RA
Sbjct  612  QYMPLDSQNEVPNHVSDERA  631



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   120 bits (302),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVSD RA
Sbjct  612  QYMPLDSQNEVPNHVSDERA  631



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHV+D RA
Sbjct  612  QYMPLDSQSEVPNHVNDERA  631



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHV+D RA
Sbjct  612  QYMPLDSQSEVPNHVNDERA  631



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHV+D RA
Sbjct  612  QYMPLDSQSEVPNHVNDERA  631



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKYR+RSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVS+  A
Sbjct  612  QYMPLDSQTEVPNHVSEDHA  631



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKYR+RSYMD+EIRAIMA
Sbjct  557  LLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEIRAIMA  616

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVS+  A
Sbjct  617  QYMPLDSQTEVPNHVSEDHA  636



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   119 bits (297),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKR T+V+SAWAA WVILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  554  LLYIRDHDTCISKRGTEVRSAWAAFWVILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  613

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  614  QYMPLDSQAEVPNHVNDERA  633



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 66/81 (81%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLYIRDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIM
Sbjct  618  GLLYIRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIM  677

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q EIPNHV+D RA
Sbjct  678  AQYMPLDSQPEIPNHVNDERA  698



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  550  LLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHV+D RA
Sbjct  610  QYMPLDSQSEVPNHVNDERA  629



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRAT+VKS WAAVWVILIGLG+  GGAYLVYKYR RSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKRATEVKSGWAAVWVILIGLGMAGGGAYLVYKYRWRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVSD RA
Sbjct  611  QYMPLDSQNEVPNHVSDDRA  630



>gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prunus dulcis]
Length=159

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  80   LLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  139

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  140  QYMPLDSQAEVPNHVNDERA  159



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHVS+ RA
Sbjct  609  QYMPLDSQSEVPNHVSEDRA  628



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHVS+ RA
Sbjct  609  QYMPLDSQSEVPNHVSEDRA  628



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+S+WAAVWVILIGL + +GGAYL+YKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKSGTEVRSSWAAVWVILIGLAMASGGAYLIYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVSDSRA
Sbjct  611  QYMPLDSQAEVPNHVSDSRA  630



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKR T+V+SAWAA WVILIGLG+ AGG YL+YKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKRGTEVRSAWAAFWVILIGLGMAAGGGYLIYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  611  QYMPLDSQAEVPNHVNDERA  630



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   114 bits (286),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA++ K+AW AVWVI IGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  555  LLYIRDHDTCISKRASETKTAWTAVWVIFIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  614

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+++PNH S+ RA
Sbjct  615  QYMPLDSQTDVPNHASEDRA  634



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA++VKSAW AVW+IL+GLG+ AGGAYLVYK+RLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKRASEVKSAWTAVWIILLGLGMAAGGAYLVYKHRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+ NHV+D RA
Sbjct  612  QYMPLDSQNEVQNHVNDERA  631



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA +VK+AWAAVWVILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  556  LLYIRDHDTCISKRAGEVKTAWAAVWVILIGLAIAAGGAYLVYKYRLRSYMDSEIRAIMA  615

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q+E+PNHV   R
Sbjct  616  QYMPLDSQTEVPNHVGHDR  634



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAAVWVI+IGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  547  LLYIRDHDTCISKSGTEVRSAWAAVWVIVIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHVS+ RA
Sbjct  607  QYMPLDSQAEVPNHVSEDRA  626



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKTGSQVKSAWTAVWLIVLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLDNQ E+PNHV+D RA
Sbjct  612  QYMPLDNQPEVPNHVNDERA  631



>gb|KHG15071.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=418

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAA+WVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  339  LLYIRDHDTCISKSGTEVRSAWAAMWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  398

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHVS+ RA
Sbjct  399  QYMPLDSQGEVPNHVSNDRA  418



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLDNQ E+PNHV+D RA
Sbjct  612  QYMPLDNQPEVPNHVNDERA  631



>dbj|BAD94353.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
Length=77

 Score =   103 bits (257),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  618  IRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYM  439
            +RDHDTCISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMAQYM
Sbjct  1    MRDHDTCISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYM  60

Query  438  PLDNQSEIPNHVSDSRA  388
            PLD+Q E+PNH +D RA
Sbjct  61   PLDSQPEVPNHTNDERA  77



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q EIPNHV+D RA
Sbjct  609  QYMPLDSQPEIPNHVNDERA  628



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYIRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRRYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q EIPNHV+D RA
Sbjct  607  QYMPLDSQPEIPNHVNDERA  626



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK +T+ KSAWAAVWVI+IGL +  GG YLVYKYRLRSYMD+EIRAIMA
Sbjct  565  LLYIRDHDTCISKSSTETKSAWAAVWVIVIGLAMAGGGGYLVYKYRLRSYMDSEIRAIMA  624

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV++  A
Sbjct  625  QYMPLDSQAEVPNHVNEVHA  644



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  548  LLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D RA
Sbjct  608  QYMPLDSQPEVPNHVNDERA  627



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+RLR YMD+EIRAIMA
Sbjct  531  LLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMA  590

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLDNQ E+PNHV+D RA
Sbjct  591  QYMPLDNQPEVPNHVNDERA  610



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q+E+PNHV D R
Sbjct  611  QYMPLDSQAEVPNHVHDER  629



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q+E+PNHV D R
Sbjct  611  QYMPLDSQAEVPNHVHDER  629



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  550  LLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  610  QYMPLDSQAEVPNHVNDERA  629



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  545  LLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D RA
Sbjct  605  QYMPLDSQPEVPNHVNDERA  624



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  545  LLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D RA
Sbjct  605  QYMPLDSQPEVPNHVNDERA  624



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  545  LLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D RA
Sbjct  605  QYMPLDSQPEVPNHVNDERA  624



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  550  LLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  610  QYMPLDSQAEVPNHVNDERA  629



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK   QV+SAWAA+W+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  548  LLYIRDHDTCISKTGAQVRSAWAAIWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D RA
Sbjct  608  QYMPLDSQPEVPNHVNDERA  627



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI DHDTCISK A QVK+AWAA+WVI IGL V A GAY+VYKYRL+SYMD+EIRAIMA
Sbjct  532  LLYITDHDTCISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYRLKSYMDSEIRAIMA  591

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+PNHVS+ RA
Sbjct  592  QYMPLDSQSEVPNHVSEERA  611



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  549  LLYMRDHDTCISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNH +D RA
Sbjct  609  QYMPLDSQPEVPNHTNDERA  628



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+QSE+ NHV++  A
Sbjct  611  QYMPLDSQSEVQNHVNEDHA  630



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  552  LLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NHV+D RA
Sbjct  612  QYMPLDSQPEVANHVNDERA  631



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +QVKSAWA VW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  551  LLYMRDHDTCISKTGSQVKSAWAGVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNH +D RA
Sbjct  611  QYMPLDSQPEVPNHTNDERA  630



>ref|XP_002489188.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
 gb|EES20283.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
Length=165

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK   Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  85   LLYIREHDTCISKTTVQAKAAWAAVWGILIVVAVVAVGSYVVYKYRLRSYMDSEIRAIMA  144

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLDNQ ++PNH  D
Sbjct  145  QYMPLDNQGDVPNHTHD  161



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  556  LLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIRAIMA  615

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NH+ D RA
Sbjct  616  QYMPLDSQPEVHNHLDDERA  635



>gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indica Group]
Length=215

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  135  LLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMA  194

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q E+PNH +D
Sbjct  195  QYMPLDSQGEVPNHTND  211



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  556  LLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIRAIMA  615

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NH+ D RA
Sbjct  616  QYMPLDSQPEVHNHLDDDRA  635



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  550  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D  A
Sbjct  610  QYMPLDSQPEVPNHVNDEHA  629



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D  A
Sbjct  607  QYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D  A
Sbjct  607  QYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHV+D  A
Sbjct  607  QYMPLDSQPEVPNHVNDEHA  626



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  550  LLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHVS+ RA
Sbjct  610  QYMPLDSQGEVPNHVSNDRA  629



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  545  LLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+PNHVS+ RA
Sbjct  605  QYMPLDSQGEVPNHVSNDRA  624



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  564  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  623

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  624  QYMPLDSQAEVPNHVNDQRA  643



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  564  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  623

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  624  QYMPLDSQAEVPNHVNDQRA  643



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK+A Q K  WAAVWV+L+GL     GAY+VYKYRLRSYMD+EIRAIMA
Sbjct  556  LLYMRDHDTCISKKAEQGKVGWAAVWVVLLGLAAAGVGAYVVYKYRLRSYMDSEIRAIMA  615

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLD+Q EIPNHV+
Sbjct  616  QYMPLDSQGEIPNHVN  631



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK   +VKSAW AVW+ILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIREHDTCISKTTAEVKSAWTAVWIILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV + RA
Sbjct  611  QYMPLDSQNEVPNHVHEDRA  630



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+ +HV++  A
Sbjct  611  QYMPLDSQNEVQSHVNEGHA  630



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK++LRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV + RA
Sbjct  611  QYMPLDSQAEVPNHVHEERA  630



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV++ RA
Sbjct  609  QYMPLDSQAEVPNHVNEERA  628



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV++ RA
Sbjct  609  QYMPLDSQAEVPNHVNEERA  628



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHD CISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYRLR YMD+EIRAIMA
Sbjct  548  LLYMRDHDACISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q EIPNH +D  A
Sbjct  608  QYMPLDSQPEIPNHANDEHA  627



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   106 bits (264),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q E+PNH +D
Sbjct  611  QYMPLDSQGEVPNHTND  627



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NHV+D RA
Sbjct  607  QYMPLDSQPEVQNHVNDERA  626



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  550  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NHV+D RA
Sbjct  610  QYMPLDSQPEVQNHVNDERA  629



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NHV+D RA
Sbjct  607  QYMPLDSQPEVQNHVNDERA  626



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYRLR YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E+ NHV+D RA
Sbjct  607  QYMPLDSQPEVQNHVNDERA  626



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK++LRSYMD+EIRAIMA
Sbjct  551  LLYMRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV + RA
Sbjct  611  QYMPLDSQAEVPNHVHEERA  630



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYKYR+RSYMD+EIRAIM
Sbjct  551  LLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSEIRAIM  610

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q EI NHVS+ RA
Sbjct  611  AQYMPLDSQGEIVNHVSEERA  631



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYKYR+RSYMD+EIRAIM
Sbjct  551  LLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSEIRAIM  610

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q EI NHVS+ RA
Sbjct  611  AQYMPLDSQGEIVNHVSEERA  631



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK A++ +SAWA VWVILI      G   +  KYRLRSYMD+EIRAIMA
Sbjct  553  LLYIRDHDTCISKTASETRSAWAIVWVILIVGMAAGGAYRVY-KYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV++  A
Sbjct  612  QYMPLDSQAEVPNHVNEEHA  631



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK +   KSAW AVWVIL+GL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  549  LLYIRDHDTCISKASGGGKSAWVAVWVILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q+E+PNHV++ R
Sbjct  609  QYMPLDSQAEVPNHVNEER  627



>ref|XP_004172174.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Cucumis 
sativus]
Length=114

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EIRAIMA
Sbjct  32   LLYMRDHDTCISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMA  91

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q E+PNHV   R
Sbjct  92   QYMPLDSQGEVPNHVHGDR  110



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQV--KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVYKYR+RSYMD+EIRAI
Sbjct  551  LLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDSEIRAI  610

Query  453  MAQYMPLDNQSEIPNHVSDSRA  388
            MAQYMPLD+QSE+ NHV+D RA
Sbjct  611  MAQYMPLDSQSEVVNHVNDERA  632



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+DHDTCISK A+Q KS WAA WVILIGLG++AGG +LVYKYR+R YMD+EIRAIMA
Sbjct  543  LLYIKDHDTCISKTASQAKSTWAAFWVILIGLGMIAGGGFLVYKYRIRQYMDSEIRAIMA  602

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+  RA
Sbjct  603  QYMPLDSQAEVPNHVNHQRA  622



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIRDHDTCISK-ASSGRSAWTAVWVILIGLTMAAGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PN+V+++RA
Sbjct  612  QYMPLDSQAEVPNYVNENRA  631



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIRDHDTCISK-ASSGRSAWTAVWVILIGLTMAAGGAYLVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PN+V+++RA
Sbjct  612  QYMPLDSQAEVPNYVNENRA  631



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  605

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  606  QYMPLDSQAEVPNHVNDQRA  625



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  547  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  607  QYMPLDSQAEVPNHVNDQRA  626



>gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis 
guineensis]
Length=243

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKYRLRSYMD+EIRAIM
Sbjct  162  GLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEIRAIM  221

Query  450  AQYMPLDNQSEIPNHVSD  397
            AQYMPLD+Q E+PNH ++
Sbjct  222  AQYMPLDSQGEVPNHANE  239



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  549  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  609  QYMPLDSQAEVPNHVNDQRA  628



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKYR+R YMD+EIRAIMA
Sbjct  549  LLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+D RA
Sbjct  609  QYMPLDSQAEVPNHVNDQRA  628



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK+A++ K  WAAVWV+LI L V A GAY +YKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIKEHDTCISKKASEAKVTWAAVWVLLIVLAVAAFGAYAIYKYRLRSYMDSEIRAIMA  612

Query  447  QYMPLDNQSEIPNH  406
            QYMPLD+Q E+PNH
Sbjct  613  QYMPLDSQGEVPNH  626



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK  T+VKSAW AVW+ILI L + AGGAY+VYK RLRSYMD+EIRAIMA
Sbjct  551  LLYIRDHDTCISK-TTEVKSAWTAVWIILIALALAAGGAYVVYKRRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV + RA
Sbjct  610  QYMPLDSQNEVPNHVDEDRA  629



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKYRLRSYMD+EIRAIM
Sbjct  550  GLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEIRAIM  609

Query  450  AQYMPLDNQSEIPNHVSD  397
            AQYMPLD+Q E+PNH ++
Sbjct  610  AQYMPLDSQGEVPNHANE  627



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKYR+R YMD+EIRAIMA
Sbjct  575  LLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIRAIMA  634

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+  RA
Sbjct  635  QYMPLDSQAEVPNHVNHQRA  654



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYKYR+RSYMD+EIRAIM
Sbjct  551  LLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSEIRAIM  610

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q E+ NHV + RA
Sbjct  611  AQYMPLDSQGEVVNHVHEERA  631



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYKYR+RSYMD+EIRAIM
Sbjct  551  LLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSEIRAIM  610

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q E+ NHV + RA
Sbjct  611  AQYMPLDSQGEVVNHVHEERA  631



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQ--VKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVYKYR+RSYMD+EIRAI
Sbjct  520  LLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDSEIRAI  579

Query  453  MAQYMPLDNQSEIPNHVSDSRA  388
            MAQYMPLD+QSE+ NHV+D RA
Sbjct  580  MAQYMPLDSQSEVVNHVNDERA  601



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EIRAIMA
Sbjct  550  LLYMRDHDTCISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q E+PNHV   R
Sbjct  610  QYMPLDSQGEVPNHVHGDR  628



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQ-VKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V AGGAYLVYKYR+RSYMD+EIRAIM
Sbjct  550  LLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAGGAYLVYKYRIRSYMDSEIRAIM  609

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+QSE+ NH +D RA
Sbjct  610  AQYMPLDSQSEVVNHANDERA  630



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIRDHDTCISK-ASSGRSAWTAVWVILIGLVMAAGGAYLVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PN+V+++RA
Sbjct  611  QYMPLDSQAEVPNYVNENRA  630



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQ-VKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHD CISK A+Q  KSAWAA WVI+IGL + A GAYLVYKYR+RSYMD+EIRAIM
Sbjct  550  LLYIRDHDACISKTASQEGKSAWAAFWVIVIGLVLAASGAYLVYKYRIRSYMDSEIRAIM  609

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q+E+ NHV+D RA
Sbjct  610  AQYMPLDSQAEVVNHVNDERA  630



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYL+YK+RLR YMD+EIRAIMA
Sbjct  548  LLYMRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLLYKHRLRQYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+ NH +D RA
Sbjct  608  QYMPLDSQAEV-NHANDERA  626



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A++ K+ W AVWVIL+ L   A GAY+VYKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIREHDICISKSASEAKATWTAVWVILVVLIFAAFGAYIVYKYRLRSYMDSEIRAIMA  612

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q E+PNH  +
Sbjct  613  QYMPLDSQGEVPNHAHE  629



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKYR+R YMD+EIRAIMA
Sbjct  544  LLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIRAIMA  603

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+E+PNHV+  RA
Sbjct  604  QYMPLDSQAEVPNHVNHQRA  623



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EIRAIMA
Sbjct  551  LLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q E+PNHV+  R
Sbjct  611  QYMPLDSQGEVPNHVNGDR  629



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYRLR+YMD+EIRAIMA
Sbjct  550  LLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q E+PNHV+  R
Sbjct  610  QYMPLDSQGEVPNHVNGDR  628



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++ DTCISK+A++ K+ WAA WV+L+ L + + GAY++YKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIKEQDTCISKKASEAKATWAAAWVLLMVLAIASFGAYVIYKYRLRSYMDSEIRAIMA  612

Query  447  QYMPLDNQSEIPNH  406
            QYMPLD Q E+PNH
Sbjct  613  QYMPLDGQGELPNH  626



>gb|EMS68621.1| Vacuolar-sorting receptor 4 [Triticum urartu]
Length=265

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK   Q K+AWAAVW IL+ L +VA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  183  LLYIKEHDTCISKTTVQAKAAWAAVWGILVALVIVAAGSYVVYKYRLRSYMDSEIRAIMA  242

Query  447  QYMPLDNQSEIPN  409
            QYMPLD+Q E+PN
Sbjct  243  QYMPLDSQGEVPN  255



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI+D DTCISK A+Q KS WAA WV+LI L ++AGG +LVYKYR+R YMD+EIRAIMA
Sbjct  544  LLYIKDQDTCISKTASQAKSTWAAFWVVLIALAMIAGGGFLVYKYRIRQYMDSEIRAIMA  603

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q E PNHV+  R 
Sbjct  604  QYMPLDSQEEGPNHVNHQRG  623



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKS-AWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK +   KS AWAAVWVILIGL + +GGAYLVYKYRLRSYMD+EIRAIM
Sbjct  550  LLYIRDHDTCISKTSGGSKSSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIM  609

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q+E+PNHV+D RA
Sbjct  610  AQYMPLDSQAEVPNHVNDERA  630



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK A + K+  AAVWVIL  L   A GAY++YKYRLRSYMD+EIRAIMA
Sbjct  553  LLYIREHDTCISKSAGEAKATQAAVWVILGVLAFAAFGAYILYKYRLRSYMDSEIRAIMA  612

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q E+PNH  +
Sbjct  613  QYMPLDSQGEVPNHAHE  629



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 12/89 (13%)
 Frame = -3

Query  627  LLYIRDHDTCIS------------KRATQVKSAWAAVWviliglgvvaggaylvYKYRLR  484
            LLYI++HDTCIS            K A Q K+AWAAVW ILI L VVA G+Y+VYKYRLR
Sbjct  551  LLYIKEHDTCISHLIYYLFDQSAGKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLR  610

Query  483  SYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            SYMD+EIRAIMAQYMPLD+Q E+PNH +D
Sbjct  611  SYMDSEIRAIMAQYMPLDSQGEVPNHTND  639



>ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Phoenix 
dactylifera]
Length=162

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+ D CIS  A+  K+ W A WVILI     A GAY+VYKYRLRSYMD+EIRAIM
Sbjct  81   GLLYMREQDICISDSASMAKATWIAFWVILILSAFAALGAYIVYKYRLRSYMDSEIRAIM  140

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLD+Q E+PNH 
Sbjct  141  AQYMPLDSQGEVPNHT  156



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKS-AWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLYIRDHDTCISK +   KS AW AVWVILIGL + AGGAYLVYKYRLRSYMD+EIRAIM
Sbjct  549  LLYIRDHDTCISKSSGGGKSSAWVAVWVILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIM  608

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLD+Q+E+PNHV++ RA
Sbjct  609  AQYMPLDSQAEVPNHVNEERA  629



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CI K A   + +W+ +WVI++ LG V  G Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMREHDACIGKNARNTEYSWSFIWVIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIM  604

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ EIPNHVS
Sbjct  605  AQYMPLDNQGEIPNHVS  621



>dbj|BAJ85815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK A + K AWAAV  IL+ L +VA G Y+VYKYRLRSYMD+EIRAIMA
Sbjct  365  LLYIKEHDTCISKTAVKAKEAWAAVCGILVALVIVAAGGYVVYKYRLRSYMDSEIRAIMA  424

Query  447  QYMPLDNQSEIPN  409
            QYMPLD+Q E+PN
Sbjct  425  QYMPLDSQGEVPN  437



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISKRAT  +  W+ +WVI  GL V   GAY VYKYR+RSYMD+EIRAIMA
Sbjct  542  LLYIKEHDTCISKRAT-TEVGWSFLWVIFFGLAVAGVGAYAVYKYRIRSYMDSEIRAIMA  600

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ E PNH+
Sbjct  601  QYMPLDNQGEAPNHI  615



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIM  604

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ EIPNHV
Sbjct  605  AQYMPLDNQGEIPNHV  620



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            G+LY+++HDTCISK A Q  + W  +WV L  L       Y VYKYR+RSYMD+EIRAIM
Sbjct  545  GMLYMKEHDTCISKSAGQ--AGWNFLWVTLFALATAGLAGYAVYKYRIRSYMDSEIRAIM  602

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ EIPNH
Sbjct  603  AQYMPLDNQGEIPNH  617



>gb|ACS91931.1| vacuolar sorting receptor protein [Lilium longiflorum]
Length=567

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HDTCISK+ T  +  W  +W+I +GL V     Y VYKYR+RSYMD+EIRAIMA
Sbjct  489  LLYMKEHDTCISKKPT-TEVGWNFLWIIFLGLAVAGISGYAVYKYRIRSYMDSEIRAIMA  547

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDNQ E+PNHVS
Sbjct  548  QYMPLDNQGEVPNHVS  563



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+R+HDTCISK+AT  +  W  VWVI +GL     G Y +YKYR+R YMD+EIRAIMA
Sbjct  545  LLYMREHDTCISKKAT-TEVGWNFVWVIFLGLAAAGIGGYAIYKYRIRRYMDSEIRAIMA  603

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ EIPNH+
Sbjct  604  QYMPLDNQGEIPNHM  618



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK   Q K+AWAAV  +L+ L V+A G+YLVYKYRLRSYMD+EIRAIMA
Sbjct  550  LLYIKEHDTCISKTTVQAKAAWAAVCGVLVALVVLAVGSYLVYKYRLRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNH  406
            QYMPLD Q+E+ N+
Sbjct  610  QYMPLDGQAEVSNY  623



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HD CI+K  T+ + +W  +W I++GL       Y VYKYR+R YMD+EIRAIM
Sbjct  551  GLLYMQEHDMCINKN-TRTEYSWGFIWTIILGLAAAGVAGYAVYKYRIRRYMDSEIRAIM  609

Query  450  AQYMPLDNQSEIPNHVSDSRA  388
            AQYMPLDNQ EIP+H   SR 
Sbjct  610  AQYMPLDNQGEIPSHTHASRG  630



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY++DHDTCISK A Q KSAWAAVW+ LIGL +VA G YL YKYR+R YMD+EIRAIMA
Sbjct  555  LLYMKDHDTCISKSAAQAKSAWAAVWLSLIGLAMVAAGGYLFYKYRIRQYMDSEIRAIMA  614

Query  447  QYMPLDNQSEIPNHVSDSRA  388
            QYMPLD+Q+EIPNH SD RA
Sbjct  615  QYMPLDSQTEIPNH-SDDRA  633



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WV+L GL       Y VYKYR+RSYMD+EIRAIM
Sbjct  616  GLLYMKEHDTCISKDAG-ARVGWNFLWVVLFGLAAAGIAVYAVYKYRIRSYMDSEIRAIM  674

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ EIP+H
Sbjct  675  AQYMPLDNQGEIPSH  689



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK+A   +  W+ +WVI  GL V   GAY+VYKYR+RSYMD+EIRAIMA
Sbjct  546  LLYIKEHDTCISKKAA-AEIGWSFLWVIFFGLAVAGVGAYMVYKYRIRSYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ E PNH+
Sbjct  605  QYMPLDNQGEAPNHI  619



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKYR+R YMD+EIRAIM
Sbjct  619  GLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEIRAIM  677

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ E+PNH
Sbjct  678  AQYMPLDNQGEVPNH  692



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            G LY+++HDTCISK A   +  W  +W +L GL  V    Y VYKYR+RSYMD+EIRAIM
Sbjct  539  GFLYMKEHDTCISKDAG-ARVGWNFLWFLLFGLAAVGIAGYAVYKYRIRSYMDSEIRAIM  597

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ EIPNH
Sbjct  598  AQYMPLDNQGEIPNH  612



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKYR+R YMD+EIRAIM
Sbjct  574  GLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEIRAIM  632

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ E+PNH
Sbjct  633  AQYMPLDNQGEVPNH  647



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDNQ E+PNHVS
Sbjct  605  QYMPLDNQGEVPNHVS  620



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDNQ E+PNHVS
Sbjct  605  QYMPLDNQGEVPNHVS  620



>gb|AAB72113.1| vacuolar sorting receptor homolog [Zea mays]
Length=152

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  71   MLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  130

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ     H
Sbjct  131  QYMPLDNQVGANQH  144



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCISK A+  + +W+ +W I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  542  GLLYMREHDTCISKDAS-AEVSWSFIWTIILGLAAAGIAGYAIYKYRIRRYMDSEIRAIM  600

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ EIP H
Sbjct  601  AQYMPLDNQGEIPVH  615



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EIRAIM
Sbjct  649  GLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIM  707

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++PNH
Sbjct  708  AQYMPLDNQGDVPNH  722



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+R+HD CISK   + + +W+ +WVI++GL     G Y +YKYR+R YMD+EIRAIMA
Sbjct  547  LLYMREHDACISKH-VKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIRAIMA  605

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ EIPNHV
Sbjct  606  QYMPLDNQGEIPNHV  620



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+R+HD CISK   + + +W+ +WVI++GL     G Y +YKYR+R YMD+EIRAIMA
Sbjct  546  LLYMREHDACISKH-VKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ EIPNHV
Sbjct  605  QYMPLDNQGEIPNHV  619



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -3

Query  624  LYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQ  445
            LYI +HDTCISK A+  + +W+ VWV+ +GL V     Y +YKYR+R YMD+EIRAIMAQ
Sbjct  547  LYIHEHDTCISKDAS-TEYSWSFVWVVFLGLAVAGAAGYALYKYRIRRYMDSEIRAIMAQ  605

Query  444  YMPLDNQSEIPNHVS  400
            YMPLDNQ E+PNH++
Sbjct  606  YMPLDNQGEVPNHMT  620



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLYI++HDTCISK A   +  W+ +W+I++ L       Y  YKYR+R YMD+EIRAIM
Sbjct  545  GLLYIQEHDTCISK-AANTEVGWSFIWIIILALAAAGVAGYATYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ EIP H
Sbjct  604  AQYMPLDNQGEIPVH  618



>gb|ACR34782.1| unknown [Zea mays]
Length=317

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  236  MLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  295

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ     H
Sbjct  296  QYMPLDNQEGANQH  309



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI +HDTCISK + + + +W  +WVI++G  +     Y +YKYR+R YMD+EIRAIMA
Sbjct  553  LLYIHEHDTCISKDSNR-EVSWGIMWVIVLGFALAGVAGYAIYKYRIRRYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ ++PNH+
Sbjct  612  QYMPLDNQGDVPNHL  626



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HDTCISK  T   S W  VWV+++ L  V    Y VYKYR+R YMD+EIRAIMA
Sbjct  545  LLYMQEHDTCISKEGTSTVS-WNFVWVMVLALAGVGVIGYGVYKYRIRRYMDSEIRAIMA  603

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLD+Q E+PNH+
Sbjct  604  QYMPLDSQGEVPNHI  618



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EIRAIM
Sbjct  512  GLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIM  570

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++PNH
Sbjct  571  AQYMPLDNQGDVPNH  585



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EIRAIM
Sbjct  547  GLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++PNH
Sbjct  606  AQYMPLDNQGDVPNH  620



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EIRAIM
Sbjct  547  GLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++PNH
Sbjct  606  AQYMPLDNQGDVPNH  620



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  624  LYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQ  445
            LYI +HDTCISK  +  + +W+ VWV+++GL V     Y +YKYR+R YMD+EIRAIMAQ
Sbjct  547  LYIHEHDTCISKD-SNTEYSWSFVWVVILGLAVSGVAGYALYKYRIRRYMDSEIRAIMAQ  605

Query  444  YMPLDNQSEIPNHVSDSR  391
            YMPLDNQ E+P+H+S  R
Sbjct  606  YMPLDNQGEVPDHMSHGR  623



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  552  LLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYRLRSYMDSEIRAIMA  611

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLDNQ E+PNH  D
Sbjct  612  QYMPLDNQGEVPNHTHD  628



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKYR+R YMD+EIRAIM
Sbjct  547  GLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++PNH
Sbjct  606  AQYMPLDNQGDVPNH  620



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HD CISK+AT  +  W+ +WVI  GL V   GAY+VYKYR+RSYMD+EIRAIMA
Sbjct  542  LLYMQEHDACISKKAT-TEVGWSFLWVIFFGLAVAGIGAYVVYKYRIRSYMDSEIRAIMA  600

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ E  NHV
Sbjct  601  QYMPLDNQGEAANHV  615



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  627  LLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKYR+R YMD+EIRAIM
Sbjct  546  LLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E+PNHVS
Sbjct  606  AQYMPLDNQGEVPNHVS  622



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  627  LLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKYR+R YMD+EIRAIM
Sbjct  546  LLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E+PNHVS
Sbjct  606  AQYMPLDNQGEVPNHVS  622



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WV+  GL  V    Y VYKYR+R YMD+EIRAIM
Sbjct  846  GLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAGYAVYKYRIRRYMDSEIRAIM  904

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPL+NQ EIP+H
Sbjct  905  AQYMPLENQGEIPSH  919



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKYRLRSYMD+EIRAIMA
Sbjct  546  LLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEIRAIMA  605

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q+++ +H+ +
Sbjct  606  QYMPLDSQNDVHHHLQE  622



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -3

Query  624  LYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQ  445
            LYI++HDTCISK  T  +  W+ +WVI  GL V   GAY VYKYR+RSYMD+EIRAIMAQ
Sbjct  543  LYIKEHDTCISKEGT-TEVGWSFLWVIFFGLAVAGMGAYAVYKYRIRSYMDSEIRAIMAQ  601

Query  444  YMPLDNQSEIPNHV  403
            YMPLDNQ E  NH+
Sbjct  602  YMPLDNQGEASNHI  615



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKYRLRSYMD+EIRAIMA
Sbjct  546  LLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEIRAIMA  605

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q+++ +H+ +
Sbjct  606  QYMPLDSQNDVHHHLQE  622



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY++ +D CISK A+   S+W  +W+I++ LG V  G Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMQAYDACISKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIM  604

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPL N+ E P HVS
Sbjct  605  AQYMPLGNEGEAPGHVS  621



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGVGAYAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDNQ E+PNH+S
Sbjct  605  QYMPLDNQGEVPNHIS  620



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  573  MLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  632

Query  447  QYMPLDNQ  424
            QYMPLDNQ
Sbjct  633  QYMPLDNQ  640



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  574  MLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  633

Query  447  QYMPLDNQ  424
            QYMPLDNQ
Sbjct  634  QYMPLDNQ  641



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  600  MLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  659

Query  447  QYMPLDNQ  424
            QYMPLDNQ
Sbjct  660  QYMPLDNQ  667



>ref|XP_001777810.1| predicted protein [Physcomitrella patens]
 gb|EDQ57348.1| predicted protein [Physcomitrella patens]
Length=626

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK++   K  WA   ++ +G+  +    Y+VYKYRLRSYMD+EIRAIMA
Sbjct  548  LLYIREHDTCISKKSQSSKLGWAVSLIVFLGVASLGVVGYVVYKYRLRSYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+ SE+ +H+++
Sbjct  608  QYMPLDSSSEVNHHLTE  624



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDNQ E+PNH+S
Sbjct  605  QYMPLDNQGEVPNHIS  620



>gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays]
Length=575

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  495  LLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYRLRSYMDSEIRAIMA  554

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLDNQ E+PNH  D
Sbjct  555  QYMPLDNQGEVPNHTHD  571



>gb|KGN58685.1| hypothetical protein Csa_3G728020 [Cucumis sativus]
Length=161

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+ +HDTCI    + V S W+ V + ++ L +     + VYKYR+R YMD+EIRAIM
Sbjct  82   GLLYMHEHDTCIGNIGSTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIM  140

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E  NHV+
Sbjct  141  AQYMPLDNQGETSNHVA  157



>gb|EPS72755.1| hypothetical protein M569_02000, partial [Genlisea aurea]
Length=514

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIRDHD CISK + +V+SAW+  W+I++GL + A GAYLVYKYR+RSYMD+EIRAIMA
Sbjct  447  LLYIRDHDACISKSSGRVRSAWSVFWIIILGLAIAAAGAYLVYKYRIRSYMDSEIRAIMA  506

Query  447  QYMPLDNQ  424
            QYMPLD+Q
Sbjct  507  QYMPLDSQ  514



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  551  LLYIREHDTCISKTAVQAKAAWAAVWGILIVIVVVAAGSYIVYKYRLRSYMDSEIRAIMA  610

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLDNQ E+PNH  +
Sbjct  611  QYMPLDNQGEVPNHTHE  627



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  545  LLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYRLRSYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLDNQ E+PNH  D
Sbjct  605  QYMPLDNQGEVPNHTHD  621



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK+ T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  548  MLYMREHDTCISKKGTTSTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ     H
Sbjct  608  QYMPLDNQEGANQH  621



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  627  LLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLY+++HDTCI+     +   +W  VWVI++GL V   GAY VYKYR+R YMD+EIRAIM
Sbjct  546  LLYMQEHDTCIAAGNDGKAAFSWGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E+PNH+S
Sbjct  606  AQYMPLDNQGEVPNHIS  622



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  545  GLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q++IP H
Sbjct  604  AQYMPLDSQADIPVH  618



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvY-KYRLRSYMDTEIRAIM  451
            LLY+RD D CISK A   KS+W A+ ++LI L V A G   +  KY LRSYMD+EIRAIM
Sbjct  524  LLYMRDQDACISKGAAAGKSSWVAISIVLIALAVAAAGGAYLLYKYSLRSYMDSEIRAIM  583

Query  450  AQYMPLDNQSEIPNH  406
            +QYMPL+NQSE+PNH
Sbjct  584  SQYMPLENQSEVPNH  598



>ref|XP_008660179.1| PREDICTED: vacuolar-sorting receptor 1 [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  548  MLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ     H
Sbjct  608  QYMPLDNQEGANQH  621



>ref|XP_011001696.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=532

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  452  GLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIM  510

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q++IP H
Sbjct  511  AQYMPLDSQADIPVH  525



>gb|EMS63262.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=864

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 56/88 (64%), Gaps = 13/88 (15%)
 Frame = -3

Query  630  GLLYIRDHDTCI-------------SKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            GLLY+++HDTCI             S +    +  W  +W +L GL  V    Y VYKYR
Sbjct  482  GLLYMKEHDTCINYLLKAYKVNTFYSGKDAGARVGWNFLWFLLFGLAAVGIAGYAVYKYR  541

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            +RSYMD+EIRAIMAQYMPLDNQ EIPNH
Sbjct  542  IRSYMDSEIRAIMAQYMPLDNQGEIPNH  569



>gb|KDO64104.1| hypothetical protein CISIN_1g0100102mg, partial [Citrus sinensis]
Length=109

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK   + +++W  VW++++GL       Y  YKYR+R YMD+EIRAIM
Sbjct  31   GLLYMQEHDTCISKD-VRSEASWGFVWMVILGLAATGVAGYAFYKYRIRRYMDSEIRAIM  89

Query  450  AQYMPLDNQSEIPN  409
            AQYMPLD+Q+E+ +
Sbjct  90   AQYMPLDSQAEVQH  103



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCISK     ++ W  +WV+  GL       Y VYKYR+R YMD+EIRAIM
Sbjct  548  GLLYMREHDTCISKNGGS-EAGWGFLWVVFFGLVAAGIAGYAVYKYRIRRYMDSEIRAIM  606

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++ +H
Sbjct  607  AQYMPLDNQGDVQSH  621



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCIS  A + + +W+ VW+I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  545  GLLYMREHDTCIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q++IP H
Sbjct  604  AQYMPLDSQADIPVH  618



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R +D CI K A+   S+   +W+I++ LG V  G Y+VYKYR+R YMD+EIRAIM
Sbjct  546  GLLYMRGYDACIGKNASGSGSSRGLIWIIILCLGAVGVGGYIVYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDN+  +P HVS
Sbjct  606  AQYMPLDNEGAVPGHVS  622



>ref|XP_006374052.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
 gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
Length=551

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A     +W+ VW+I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  471  GLLYMQEHDTCISK-AANTNYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIM  529

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q++IP H
Sbjct  530  AQYMPLDSQADIPVH  544



>gb|ACN25155.1| unknown [Zea mays]
Length=310

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKYR+R YMD+EIRAIM
Sbjct  231  GLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEIRAIM  289

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLD+Q ++ +H 
Sbjct  290  AQYMPLDSQGDVQSHA  305



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  547  MLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  606

Query  447  QYMPLDNQS  421
            QYMPLDNQ 
Sbjct  607  QYMPLDNQE  615



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI +HDTCISK A   + +W  +WVI++GL V     Y +YKYR+R YMD+EIRAIMA
Sbjct  550  LLYIHEHDTCISKDAANSEVSWGVMWVIILGLTVAGVAGYALYKYRIRRYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ   PNH+
Sbjct  610  QYMPLDNQ---PNHM  621



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK A   +  W  +WV+  GL  V   AY VYKYR+R YMD+EIRAIM
Sbjct  546  GLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAAYAVYKYRIRRYMDSEIRAIM  604

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPL+NQ EIP++
Sbjct  605  AQYMPLENQGEIPSN  619



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMKEHDTCISKNGA-TETGWGFLWVIFFGLVAAGIAGYAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++ +H
Sbjct  604  AQYMPLDNQGDVQSH  618



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WVI +GL       Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMKEHDTCISKNGA-TETGWGFLWVIFLGLVAAGIAGYAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++ +H
Sbjct  604  AQYMPLDNQGDVQSH  618



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++ +H
Sbjct  604  AQYMPLDNQGDVQSH  618



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R++D CI K  +   S+W  +WVI++ LG V  G + VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMRENDACIGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEIRAIM  604

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E+P+HV+
Sbjct  605  AQYMPLDNQGEVPSHVA  621



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLDNQ ++ +H
Sbjct  604  AQYMPLDNQGDVQSH  618



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYRLRSYMD+EIRAIMA
Sbjct  547  LLYIKEHDTCISKTAVQAKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLD+Q E+PNH  D  
Sbjct  607  QYMPLDSQGEVPNHTQDEE  625



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  549  MLYMREHDTCLSKEATST-VGWSFLWVIFFGLALAGVGAYAVYKYRLRSYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPN--HVS  400
            QYMPLDNQ E PN  HV+
Sbjct  608  QYMPLDNQ-EAPNQHHVA  624



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y V  Y +R YMD+EIRAIM
Sbjct  545  GLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAV--YNIR-YMDSEIRAIM  601

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ EIPNHV
Sbjct  602  AQYMPLDNQGEIPNHV  617



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HD CIS  A + + +W+ VW+I++GL       Y +YKYR+R YMD+EIRAIM
Sbjct  545  GLLYMREHDACIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q++IP H
Sbjct  604  AQYMPLDSQADIPVH  618



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK+ +  +  W+ +WVI  GL +   GAY +YKYR+RSYMD+EIRAIMA
Sbjct  545  LLYIKEHDTCISKKPS-TEVGWSFLWVIFFGLVIAGVGAYAIYKYRIRSYMDSEIRAIMA  603

Query  447  QYMPLDNQSEIPNHV  403
            QYMPLDNQ E  NH+
Sbjct  604  QYMPLDNQ-EAQNHI  617



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCIS     V   WA+ ++I++ LG V  G Y  YKYR+R YMD+EIRAIM
Sbjct  548  GLLYMQEHDTCISNGGGGV--GWASAFMIILVLGAVGTGGYAFYKYRIRRYMDSEIRAIM  605

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ EI  H+
Sbjct  606  AQYMPLDNQVEITTHI  621



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+ +HDTCI    + V S W+ V + ++ L +     + VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMHEHDTCIGNIGSTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E  NHV+
Sbjct  604  AQYMPLDNQGETSNHVA  620



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+ +HDTCISK   +   +W+ +WVI++ +  V  G Y +YKYR+R YMD+EIRAIMA
Sbjct  550  LLYMHEHDTCISKD-VKTDFSWSFIWVIILAVAAVGAGGYAMYKYRIRRYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ E+P H
Sbjct  609  QYMPLDNQGEVPLH  622



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY++ +D CI+ K A+   S+W  +W+I++ LG V  G Y VYKYR+R YMD+EIRAI
Sbjct  545  GLLYMQAYDACITGKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSEIRAI  604

Query  453  MAQYMPLDNQSEIPNHVS  400
            MAQYMPL N+ E P HVS
Sbjct  605  MAQYMPLGNEGEAPGHVS  622



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKYR+R YMD+EIRAIM
Sbjct  544  GLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEIRAIM  602

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLD+Q ++ +H 
Sbjct  603  AQYMPLDSQGDVQSHA  618



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            G LY+R+HDTCI K A+  K +W  VW I+ GL       Y  YKYR+R YMD+EIRAIM
Sbjct  545  GSLYMREHDTCIGKEAS-TKVSWGYVWAIIFGLVAAGAAGYAFYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ   PN+V
Sbjct  604  AQYMPLDNQ---PNNV  616



>ref|XP_002463394.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
 gb|EER99915.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
Length=636

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = -3

Query  624  LYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQ  445
            LYIR+HDTCISK+++     W  +WVI IGL +   GAY VYKYRLRSYMD+EIRAIMAQ
Sbjct  554  LYIREHDTCISKQSSS-SLGWGFLWVIFIGLALAGAGAYAVYKYRLRSYMDSEIRAIMAQ  612

Query  444  YMPLDNQSEIPNH  406
            YMPL++Q E+PN 
Sbjct  613  YMPLESQ-EMPNQ  624



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  547  MLYMREHDTCLSKEATSA-VGWSFLWVIFFGLVLAGVGAYAVYKYRLRSYMDSEIRAIMA  605

Query  447  QYMPLDNQSEIPNH  406
            QYMPLDNQ     H
Sbjct  606  QYMPLDNQEAANQH  619



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKYR+R YMD+EIRAIM
Sbjct  545  GSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ   PN+V
Sbjct  604  AQYMPLDNQ---PNNV  616



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKYR+R YMD+EIRAIM
Sbjct  545  GSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ   PN+V
Sbjct  604  AQYMPLDNQ---PNNV  616



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCIS+ A   +  W  +WVI  GL       Y VYKYR+R YMD+EIRAIM
Sbjct  563  GLLYMKEHDTCISESAA-AQVGWNFLWVIFFGLAAAGIAGYAVYKYRIRRYMDSEIRAIM  621

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPL+NQ +I +H
Sbjct  622  AQYMPLENQGDIHSH  636



>dbj|BAK05589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=802

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK AT     W  +WVI  GLG    GAY VYKYRLRSYMD+EIRAIMA
Sbjct  722  MLYMREHDTCISKVATS-SVGWGFLWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMA  780

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ E  +H
Sbjct  781  QYMPLENQ-ETSSH  793



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  546  MLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ E PN 
Sbjct  605  QYMPLENQ-ETPNQ  617



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKYR+RSYMD+EIRAIMA
Sbjct  551  LLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q+E+  H+ +
Sbjct  610  QYMPLDSQNEVHRHLEE  626



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKYR+RSYMD+EIRAIMA
Sbjct  551  LLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEIRAIMA  609

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q+E+  H+ +
Sbjct  610  QYMPLDSQNEVHRHLEE  626



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            G +Y+++HDTCIS    + V+ +   ++ I++ L  V   AY VYKYR+R YMD+EIRAI
Sbjct  547  GSIYMQEHDTCISATVESSVRLSMGGIFFIILCLAAVGVCAYAVYKYRIRRYMDSEIRAI  606

Query  453  MAQYMPLDNQSEIPNHVS  400
            MAQYMPLDNQ EIP HVS
Sbjct  607  MAQYMPLDNQGEIPTHVS  624



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  546  MLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ E PN 
Sbjct  605  QYMPLENQ-ETPNQ  617



>ref|XP_001785165.1| predicted protein [Physcomitrella patens]
 gb|EDQ50034.1| predicted protein [Physcomitrella patens]
Length=620

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSA-WAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            LLY  +HDTCI++++ Q K+A W    ++L GL V+  G+Y+VYKYRLR+YMD+EIRAIM
Sbjct  538  LLYFHEHDTCINRKSGQSKAAGWVVSLIVLAGLSVLGLGSYVVYKYRLRTYMDSEIRAIM  597

Query  450  AQYMPLDNQSEIPNH  406
            AQYMPLD+Q E+ NH
Sbjct  598  AQYMPLDSQGEVQNH  612



>gb|AFW64624.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=76

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -3

Query  618  IRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYM  439
            +++HDTCISK     ++ W  +WV++ GL       Y VYKYR+R YMD+EIRAIMAQYM
Sbjct  1    MKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYM  59

Query  438  PLDNQSEIPNH  406
            PLD+Q ++ +H
Sbjct  60   PLDSQGDVQSH  70



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK AT     W  +WVI  GLG    GAY VYKYRLRSYMD+EIRAIMA
Sbjct  560  MLYMREHDTCISKVATS-SLGWGFMWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMA  618

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ E  +H
Sbjct  619  QYMPLENQ-ETSSH  631



>ref|NP_001169232.1| hypothetical protein precursor [Zea mays]
 gb|ACN32039.1| unknown [Zea mays]
 gb|ACN34630.1| unknown [Zea mays]
 tpg|DAA64135.1| TPA: hypothetical protein ZEAMMB73_440222 [Zea mays]
Length=633

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -3

Query  624  LYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQ  445
            LYIR+HDTCISK ++   S W  +WV+ +GL +   GAY VYKYRLRSYMD+EIRAIMAQ
Sbjct  551  LYIREHDTCISKHSSSTPS-WGFLWVVFLGLALAGAGAYAVYKYRLRSYMDSEIRAIMAQ  609

Query  444  YMPLDNQ  424
            YMPL++Q
Sbjct  610  YMPLESQ  616



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 2/77 (3%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCISK   + +++W  VW++++GL       Y  YKYR+R YMD+EIRAIM
Sbjct  545  GLLYMQEHDTCISKD-VRSEASWGFVWMVILGLAATGVAGYAFYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLD+Q+E+  H S
Sbjct  604  AQYMPLDSQAEV-QHAS  619



>emb|CDY62642.1| BnaCnng40690D [Brassica napus]
Length=140

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 4/73 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +  ++W  +W+I++GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  64   LLYIREHDICISKDA-RGDASWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  122

Query  447  QYMPLDNQSEIPN  409
            QYMPLDN    PN
Sbjct  123  QYMPLDNH---PN  132



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++  L   +   Y +YKYR+RSYMD+EIRAI
Sbjct  545  GLLYMREHDTCIGSGKVGATKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSEIRAI  604

Query  453  MAQYMPLDNQSEIPNHVS  400
            MAQYMPLD+Q   PN  S
Sbjct  605  MAQYMPLDSQ---PNTAS  619



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+++HDTCISK+A+  +  W+ +WVIL GL +   G Y VYKYR+RSYMD+EIRAIMA
Sbjct  544  LLYMKEHDTCISKKAS-TEVGWSFLWVILFGLVIAGIGGYAVYKYRIRSYMDSEIRAIMA  602

Query  447  QYMPLDNQ-SEIPNHVSD  397
            QYMPLDNQ  +I  H  D
Sbjct  603  QYMPLDNQEGQIHVHHGD  620



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+R+HDTCI K     K +W+ +W+++  L   +   Y +YKYR+RSYMD+EIRAIM
Sbjct  545  GLLYMREHDTCIGKVGA-TKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLD+Q   PN  S
Sbjct  604  AQYMPLDSQ---PNTAS  617



>ref|XP_001759820.1| predicted protein [Physcomitrella patens]
 gb|EDQ75324.1| predicted protein [Physcomitrella patens]
Length=616

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYI +HDTCISK     K  W    ++L GL V+  G Y+VYKYRLRSYMD+EIRAIMA
Sbjct  538  LLYIGEHDTCISKCVQPSKLGWFVTLIVLAGLAVLGVGGYVVYKYRLRSYMDSEIRAIMA  597

Query  447  QYMPLDNQSEIPNHVSD  397
            QYMPLD+Q+E   H++D
Sbjct  598  QYMPLDSQNESQIHMAD  614



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+ +HDTCI    + V S W+ V ++++ L +     Y +YKYR+R YMD+EIRAIM
Sbjct  545  GLLYMHEHDTCIGNIGSTVTS-WSVVKIVILVLAITGIAGYAIYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLDNQ E  +HV+
Sbjct  604  AQYMPLDNQGETGSHVA  620



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R++D CI+ K  +   S+W  +WVI++ LG V  G + VYKYR+R YMD+EIRAI
Sbjct  545  GLLYMRENDACIAGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEIRAI  604

Query  453  MAQYMPLDNQSEIPNHVS  400
            MAQYMPLDNQ E+P+HV+
Sbjct  605  MAQYMPLDNQGEVPSHVA  622



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY++++DTCIS      KS     W++++GL     GAY+VYKYR+RSYMD+EIR+IM
Sbjct  549  GLLYMQEYDTCISTHPV-TKSFGVFFWIVILGLTAAGVGAYMVYKYRIRSYMDSEIRSIM  607

Query  450  AQYMPLDNQSEIPNHVS  400
            AQYMPLD Q+E+P+H S
Sbjct  608  AQYMPLDGQAEVPSHGS  624



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LYIR+HDTCISK +T     W  +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  556  MLYIREHDTCISKHSTST-IGWGFLWVIFFGLALAGAGAYAVYKYRLRSYMDSEIRAIMA  614

Query  447  QYMPLDNQSEIPNH  406
            QYMPL++  E+P+ 
Sbjct  615  QYMPLESH-EMPSQ  627



>gb|EMT02959.1| Vacuolar-sorting receptor 4 [Aegilops tauschii]
Length=575

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK AT     W  +WVI  GLG    GAY VYKYRLRSYMD+EIRAIMA
Sbjct  495  MLYMREHDTCISKVATS-SVGWGFMWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMA  553

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ E  +H
Sbjct  554  QYMPLENQ-ETSSH  566



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  558  LLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  616

Query  447  QYMPLDNQ  424
            QYMPLDN 
Sbjct  617  QYMPLDNH  624



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  566  LLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  624

Query  447  QYMPLDNQ  424
            QYMPLDN 
Sbjct  625  QYMPLDNH  632



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+ +HDTCISK  ++ + +W  VW I++GL V     Y VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAVVVGYAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLD Q E  NHVS
Sbjct  605  QYMPLD-QGEGANHVS  619



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLY+ +HDTCISK  ++ + +W  VW I++GL V A  A+ VYKYR+R YMD+EIRAIMA
Sbjct  546  LLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAAVVAFAVYKYRIRRYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLD Q E  NHVS
Sbjct  605  QYMPLD-QGEGANHVS  619



>emb|CDY38158.1| BnaA07g02250D [Brassica napus]
Length=302

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  225  LLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  283

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  284  QYMPLDNH---PNTQPSSQ  299



>ref|XP_001751750.1| predicted protein [Physcomitrella patens]
 gb|EDQ83185.1| predicted protein [Physcomitrella patens]
Length=636

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 8/85 (9%)
 Frame = -3

Query  627  LLYIRDHDTCIS--------KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMD  472
            LLY   HDTCIS        K A    + W    ++L G+ V+  G+Y+VYKYRLR+YMD
Sbjct  549  LLYFHQHDTCISECSASSYQKGAQSETAGWVVSLIVLAGISVLGLGSYVVYKYRLRTYMD  608

Query  471  TEIRAIMAQYMPLDNQSEIPNHVSD  397
            +EIRAIMAQYMPLD+QSEI NH  D
Sbjct  609  SEIRAIMAQYMPLDSQSEIQNHSRD  633



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK  +     W  +WVI  GL +   GAY VYKYRLRSYMD+EIRAIMA
Sbjct  550  MLYMREHDTCISKVGSS-SVGWGFLWVIFFGLALAGVGAYAVYKYRLRSYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNH  406
            QYMPL+NQ     H
Sbjct  609  QYMPLENQETQNQH  622



>ref|XP_001759928.1| predicted protein [Physcomitrella patens]
 gb|EDQ75432.1| predicted protein [Physcomitrella patens]
Length=566

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 11/79 (14%)
 Frame = -3

Query  627  LLYIRDHDTCISK--RATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            LLYI +HDTCIS   + T +   W            V  GAY+VYKYRLRSYMD+EIRAI
Sbjct  495  LLYIGEHDTCISGVGKGTDLGVCWPVC---------VQVGAYVVYKYRLRSYMDSEIRAI  545

Query  453  MAQYMPLDNQSEIPNHVSD  397
            MAQYMPLD+Q+E  NH++D
Sbjct  546  MAQYMPLDSQNESQNHMAD  564



>ref|XP_001765481.1| predicted protein [Physcomitrella patens]
 gb|EDQ69742.1| predicted protein [Physcomitrella patens]
Length=623

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = -3

Query  630  GLLYIRDHDTCISKR-ATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+++HDTCIS+  A Q K       ++L GL ++A G+Y+VYKYRLR+YMD+EIRAI
Sbjct  541  GLLYMQEHDTCISESSAAQSKLGLTVSLIVLAGLSILALGSYVVYKYRLRTYMDSEIRAI  600

Query  453  MAQYMPLDNQSE-IPNHVSD  397
            MAQYMPLDNQ+E I +H+ D
Sbjct  601  MAQYMPLDNQNESIQSHLQD  620



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  550  LLYIREHDICISKDA-RGDVSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  609  QYMPLDNH---PNSQPSSQ  624



>gb|AAG60258.1| EGF receptor-like protein [Physcomitrella patens]
Length=360

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+++HDTCI++ ++Q K       ++L G+ V+  G Y+VYKYRLRSYMD+EIRAIM
Sbjct  279  GLLYMQEHDTCINRISSQSKLGLTVSLIVLAGISVLGLGGYVVYKYRLRSYMDSEIRAIM  338

Query  450  AQYMPLDNQSE-IPNHVSDS  394
            AQYMPLD+Q++ +  H  D+
Sbjct  339  AQYMPLDSQNDSVQTHSQDN  358



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  550  LLYIREHDICISKDA-RGDVSWGVIWIIVMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  608

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  609  QYMPLDNH---PNSQPSSQ  624



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQSEI--PNHV  403
            MAQYMPL++Q     P+H+
Sbjct  606  MAQYMPLESQPNPSGPHHM  624



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY+ +HDTCI      V S W+ V + ++ L +     + VYKYR+R YMD+EIRAIM
Sbjct  545  GLLYMHEHDTCIGNIGNTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIM  603

Query  450  AQYMPLDNQSE  418
            AQYMPLDNQ E
Sbjct  604  AQYMPLDNQGE  614



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W ++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  543  GLLYMREHDTCIGSGKVGTTKLSWSFLWFLIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  602

Query  453  MAQYMPLDNQSEIPN  409
            MAQYMPL++Q   PN
Sbjct  603  MAQYMPLESQP--PN  615



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CI++ A +   +W  +W+I++GLG  A GAY VYKYR+R+YMD+EIRAIMA
Sbjct  548  LLYIREHDICINRDA-RGDFSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMA  606

Query  447  QYMPLDN  427
            QYMPLDN
Sbjct  607  QYMPLDN  613



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GL Y+R+HDTCI K    +K +W+ +W++L+         Y +YKYR+RSYMD+EIR IM
Sbjct  545  GLFYLREHDTCIGKFGA-MKLSWSFLWILLLASAAATLTGYAIYKYRIRSYMDSEIRTIM  603

Query  450  AQYMPLDNQSEIPN  409
            AQYMPLD+Q   PN
Sbjct  604  AQYMPLDSQ---PN  614



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQSEIPN  409
            MAQYMPL++Q   PN
Sbjct  606  MAQYMPLESQP--PN  618



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  543  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  602

Query  453  MAQYMPLDNQSEIPN  409
            MAQYMPL++Q   PN
Sbjct  603  MAQYMPLESQP--PN  615



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  543  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  602

Query  453  MAQYMPLDNQSEIPN  409
            MAQYMPL++Q   PN
Sbjct  603  MAQYMPLESQP--PN  615



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  543  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  602

Query  453  MAQYMPLDNQSEIPN  409
            MAQYMPL++Q   PN
Sbjct  603  MAQYMPLESQP--PN  615



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +WV++IG+ V     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSGKVGTTKLSWSFLWVLIIGVAVAGLSGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQ  424
            MAQYMPL++Q
Sbjct  606  MAQYMPLESQ  615



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LYIR+HD C+SK A +    W  +W++L         AY  YKYR+R+YMD+EIRAIMA
Sbjct  549  MLYIREHDLCLSKDA-KADVRWGLIWILLFVFAAAVLAAYFAYKYRIRTYMDSEIRAIMA  607

Query  447  QYMPLDNQSEIPNHVS  400
            QYMPLDN +   +H S
Sbjct  608  QYMPLDNDNHPNSHPS  623



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQ  424
            MAQYMPL++Q
Sbjct  606  MAQYMPLESQ  615



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGIGVAGLSGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQ  424
            MAQYMPL++Q
Sbjct  606  MAQYMPLESQ  615



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 54/96 (56%), Gaps = 22/96 (23%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKS----------------------AWAAVWviliglgvvagg  514
            LLY+ + DTCISK    + S                      +W+  WV+++ +  V   
Sbjct  541  LLYLHEQDTCISKHKKVIVSLSFIIHILTTVVCIAGKAGSGPSWSVAWVVILAMAAVGLA  600

Query  513  aylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
             Y VYKYR+R YMD+EIRAIMAQYMPLDN+ E+ NH
Sbjct  601  GYTVYKYRIRRYMDSEIRAIMAQYMPLDNEGEMRNH  636



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQ  424
            MAQYMPL++Q
Sbjct  606  MAQYMPLESQ  615



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  630  GLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIM  451
            GLLY R++DTCI K  + V      +W+I++ L V   G Y  YKYR++ YMD+EIR+IM
Sbjct  546  GLLYSRENDTCIGKYTSSV----VNIWMIILVLVVTLSGGYAFYKYRIQRYMDSEIRSIM  601

Query  450  AQYMPLDNQSEIPNHV  403
            AQYMPLDNQ EI N V
Sbjct  602  AQYMPLDNQPEISNQV  617



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  630  GLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAI  454
            GLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKYR+RSYMD EIR I
Sbjct  546  GLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAEIRGI  605

Query  453  MAQYMPLDNQ  424
            MAQYMPL++Q
Sbjct  606  MAQYMPLESQ  615



>ref|XP_010233902.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=646

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+HDTCISK A+        +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  565  MLYMREHDTCISKVASS-SVGQGFLWVIFFGLAFAGVGAYAVYKYRLRSYMDSEIRAIMA  623

Query  447  QYMPLDNQ--SEIP  412
            QYMPL+N   S IP
Sbjct  624  QYMPLENHEMSSIP  637



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CI+K A +   +W  +W+I++GLG  A GAY +YKYR+R+YMD+EIRAIMA
Sbjct  546  LLYIREHDICINKDA-RGDVSWGVIWIIIMGLGAAALGAYTIYKYRIRTYMDSEIRAIMA  604

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  605  QYMPLDNN---PNSQPSSQ  620



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR+R+YMD+EIRAIMA
Sbjct  548  LLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  607  QYMPLDNN---PNGQPSSQ  622



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR+R+YMD+EIRAIMA
Sbjct  548  LLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  607  QYMPLDNN---PNGQPSSQ  622



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 4/79 (5%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            LLYIR+HD CI+K A +   +W  +W+I +GLG  A GAY +YKYR+R+YMD+EIRAIMA
Sbjct  548  LLYIREHDICINKDA-RGDVSWGVIWIIFMGLGAAALGAYTIYKYRIRTYMDSEIRAIMA  606

Query  447  QYMPLDNQSEIPNHVSDSR  391
            QYMPLDN    PN    S+
Sbjct  607  QYMPLDNN---PNGQPSSQ  622



>ref|XP_010228654.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=627

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -3

Query  627  LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMA  448
            +LY+R+ DTCISK+A      W+ +WVI  GL     GAY VYKYRLRSYMD+EIRAIMA
Sbjct  546  MLYMREQDTCISKQAVS-SVGWSFMWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMA  604

Query  447  QYMPLDNQ  424
            QYMPLD+Q
Sbjct  605  QYMPLDSQ  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875