BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041H01

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763380.1|  PREDICTED: myosin type-2 heavy chain 1-like        213   2e-61   Nicotiana sylvestris
ref|XP_009626788.1|  PREDICTED: coiled-coil domain-containing pro...    207   4e-59   Nicotiana tomentosiformis
ref|XP_009605544.1|  PREDICTED: myb-like protein X isoform X2           198   9e-56   Nicotiana tomentosiformis
ref|XP_009605543.1|  PREDICTED: myb-like protein X isoform X1           197   1e-55   Nicotiana tomentosiformis
ref|XP_009793116.1|  PREDICTED: protein MLP1-like isoform X1            189   9e-53   Nicotiana sylvestris
emb|CBI40114.3|  unnamed protein product                                184   1e-52   Vitis vinifera
ref|XP_010911457.1|  PREDICTED: factor of DNA methylation 5-like        179   1e-52   
ref|XP_010911713.1|  PREDICTED: factor of DNA methylation 1-like        179   2e-52   Elaeis guineensis
ref|XP_008362754.1|  PREDICTED: uncharacterized protein LOC103426447    178   4e-52   
ref|XP_006341360.1|  PREDICTED: myosin-9-like                           188   4e-52   Solanum tuberosum [potatoes]
ref|XP_004235934.1|  PREDICTED: factor of DNA methylation 1             188   4e-52   Solanum lycopersicum
ref|XP_008375509.1|  PREDICTED: putative leucine-rich repeat-cont...    187   9e-52   Malus domestica [apple tree]
gb|KDP41984.1|  hypothetical protein JCGZ_27002                         187   9e-52   Jatropha curcas
ref|XP_010920577.1|  PREDICTED: factor of DNA methylation 1-like        181   1e-51   
ref|XP_003531733.1|  PREDICTED: protein MLP1-like isoform X1            186   3e-51   Glycine max [soybeans]
gb|EYU21705.1|  hypothetical protein MIMGU_mgv1a020880mg                178   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_008361182.1|  PREDICTED: putative leucine-rich repeat-cont...    185   4e-51   Malus domestica [apple tree]
ref|XP_011467028.1|  PREDICTED: factor of DNA methylation 1             184   8e-51   Fragaria vesca subsp. vesca
gb|KHG15531.1|  suppressor of gene silencing 3                          184   1e-50   Gossypium arboreum [tree cotton]
gb|KJB56539.1|  hypothetical protein B456_009G124400                    182   3e-50   Gossypium raimondii
gb|KJB56538.1|  hypothetical protein B456_009G124400                    183   3e-50   Gossypium raimondii
ref|XP_010678967.1|  PREDICTED: factor of DNA methylation 1-like        182   4e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002267381.1|  PREDICTED: factor of DNA methylation 1             182   6e-50   Vitis vinifera
ref|XP_003530299.1|  PREDICTED: structural maintenance of chromos...    182   7e-50   Glycine max [soybeans]
ref|XP_010910789.1|  PREDICTED: factor of DNA methylation 1-like        181   1e-49   
emb|CAN62667.1|  hypothetical protein VITISV_028278                     181   2e-49   Vitis vinifera
emb|CDO98219.1|  unnamed protein product                                180   3e-49   Coffea canephora [robusta coffee]
gb|KHN04171.1|  hypothetical protein glysoja_032667                     177   1e-48   Glycine soja [wild soybean]
ref|XP_007023402.1|  XH/XS domain-containing protein                    178   1e-48   
ref|XP_008454609.1|  PREDICTED: putative leucine-rich repeat-cont...    178   1e-48   Cucumis melo [Oriental melon]
ref|XP_008461480.1|  PREDICTED: putative leucine-rich repeat-cont...    178   2e-48   Cucumis melo [Oriental melon]
ref|XP_008454606.1|  PREDICTED: putative leucine-rich repeat-cont...    178   2e-48   Cucumis melo [Oriental melon]
gb|EYU21722.1|  hypothetical protein MIMGU_mgv1a002818mg                177   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_010232023.1|  PREDICTED: factor of DNA methylation 1-like ...    176   4e-48   Brachypodium distachyon [annual false brome]
gb|AES86419.2|  XH/XS domain protein                                    176   5e-48   Medicago truncatula
emb|CAN83544.1|  hypothetical protein VITISV_021077                     176   6e-48   Vitis vinifera
ref|XP_002527307.1|  conserved hypothetical protein                     176   7e-48   Ricinus communis
ref|XP_003604222.1|  hypothetical protein MTR_4g006760                  176   9e-48   
ref|XP_007135809.1|  hypothetical protein PHAVU_010G160300g             175   1e-47   Phaseolus vulgaris [French bean]
ref|XP_007135808.1|  hypothetical protein PHAVU_010G160300g             175   1e-47   Phaseolus vulgaris [French bean]
emb|CBI40115.3|  unnamed protein product                                174   2e-47   Vitis vinifera
ref|XP_010937610.1|  PREDICTED: factor of DNA methylation 1-like        174   3e-47   
ref|XP_010537880.1|  PREDICTED: factor of DNA methylation 1-like        174   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_002267670.1|  PREDICTED: factor of DNA methylation 1 isofo...    174   5e-47   Vitis vinifera
ref|XP_004139640.1|  PREDICTED: uncharacterized protein LOC101205093    174   6e-47   Cucumis sativus [cucumbers]
dbj|BAD52538.1|  putative transcription factor X1                       169   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387522.1|  PREDICTED: uncharacterized protein LOC103974422    173   7e-47   
ref|XP_010656778.1|  PREDICTED: factor of DNA methylation 1 isofo...    173   8e-47   Vitis vinifera
ref|XP_008784591.1|  PREDICTED: uncharacterized protein LOC103703501    173   1e-46   Phoenix dactylifera
ref|NP_001041898.1|  Os01g0126600                                       169   1e-46   
ref|XP_010256908.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      172   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_006645454.1|  PREDICTED: centrosomal protein of 128 kDa-like     171   5e-46   Oryza brachyantha
ref|XP_004499526.1|  PREDICTED: uncharacterized protein LOC101512210    161   1e-45   
ref|XP_008228782.1|  PREDICTED: interaptin-like                         170   1e-45   Prunus mume [ume]
ref|XP_011073344.1|  PREDICTED: factor of DNA methylation 1             169   2e-45   Sesamum indicum [beniseed]
ref|XP_008799862.1|  PREDICTED: MAR-binding filament-like protein 1     169   3e-45   Phoenix dactylifera
ref|XP_010063555.1|  PREDICTED: CAP-Gly domain-containing linker ...    169   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010497500.1|  PREDICTED: factor of DNA methylation 1             169   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_003566895.1|  PREDICTED: factor of DNA methylation 1             168   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_002303841.1|  XH domain-containing family protein                168   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006465197.1|  PREDICTED: myosin-10-like                          167   7e-45   Citrus sinensis [apfelsine]
gb|KDO42995.1|  hypothetical protein CISIN_1g006762mg                   167   7e-45   Citrus sinensis [apfelsine]
ref|XP_006427593.1|  hypothetical protein CICLE_v10025142mg             167   7e-45   
dbj|BAB21190.1|  putative transcription factor                          167   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010476691.1|  PREDICTED: factor of DNA methylation 1-like        167   1e-44   
ref|XP_008802711.1|  PREDICTED: paramyosin, long form-like              166   3e-44   Phoenix dactylifera
ref|XP_009149026.1|  PREDICTED: nuclear mitotic apparatus protein 1     166   3e-44   Brassica rapa
ref|XP_006659121.1|  PREDICTED: putative leucine-rich repeat-cont...    165   6e-44   Oryza brachyantha
ref|XP_002890136.1|  XH/XS domain-containing protein                    165   7e-44   
ref|XP_007214938.1|  hypothetical protein PRUPE_ppa002776mg             165   7e-44   Prunus persica
ref|XP_010931277.1|  PREDICTED: factor of DNA methylation 5-like ...    158   1e-43   Elaeis guineensis
ref|XP_003610367.1|  hypothetical protein MTR_4g131350                  164   1e-43   
ref|XP_002457444.1|  hypothetical protein SORBIDRAFT_03g007450          157   2e-43   
ref|XP_010931274.1|  PREDICTED: factor of DNA methylation 1-like ...    158   3e-43   Elaeis guineensis
ref|XP_006306990.1|  hypothetical protein CARUB_v10008566mg             162   4e-43   Capsella rubella
ref|XP_004968083.1|  PREDICTED: synaptonemal complex protein 1-like     162   5e-43   Setaria italica
ref|XP_009416142.1|  PREDICTED: uncharacterized protein LOC103996844    162   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010429907.1|  PREDICTED: factor of DNA methylation 5-like        154   9e-43   Camelina sativa [gold-of-pleasure]
ref|NP_001042014.1|  Os01g0147700                                       162   1e-42   
gb|EAZ10533.1|  hypothetical protein OsJ_00365                          162   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72526.1|  hypothetical protein OsI_00387                          162   1e-42   Oryza sativa Indica Group [Indian rice]
emb|CDM83432.1|  unnamed protein product                                160   2e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010459126.1|  PREDICTED: factor of DNA methylation 1-like        159   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004968205.1|  PREDICTED: uncharacterized protein LOC101778142    160   3e-42   Setaria italica
ref|NP_173043.1|  factor of DNA methylation 1                           160   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32486.1|  XH/XS domain protein                                    160   3e-42   Medicago truncatula
ref|XP_010678965.1|  PREDICTED: factor of DNA methylation 1-like        159   5e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655910.1|  PREDICTED: myosin-9-like                           159   7e-42   Oryza brachyantha
ref|XP_010265641.1|  PREDICTED: factor of DNA methylation 1-like ...    159   9e-42   Nelumbo nucifera [Indian lotus]
gb|EMT09583.1|  hypothetical protein F775_10228                         158   1e-41   
ref|XP_002278500.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...    158   1e-41   Vitis vinifera
ref|XP_008655632.1|  PREDICTED: centrosomal protein of 128 kDa-like     159   2e-41   Zea mays [maize]
ref|XP_010658558.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...    158   2e-41   Vitis vinifera
ref|XP_004972828.1|  PREDICTED: synaptonemal complex protein 1-li...    157   3e-41   Setaria italica
ref|XP_004972827.1|  PREDICTED: synaptonemal complex protein 1-li...    157   3e-41   
ref|XP_010101455.1|  hypothetical protein L484_012877                   157   3e-41   Morus notabilis
ref|XP_010092186.1|  hypothetical protein L484_013504                   157   3e-41   Morus notabilis
gb|EMS50669.1|  hypothetical protein TRIUR3_29122                       157   4e-41   Triticum urartu
ref|XP_010234408.1|  PREDICTED: factor of DNA methylation 1-like ...    157   4e-41   Brachypodium distachyon [annual false brome]
ref|XP_010234409.1|  PREDICTED: factor of DNA methylation 1-like ...    157   4e-41   Brachypodium distachyon [annual false brome]
gb|EMS57892.1|  hypothetical protein TRIUR3_23802                       157   6e-41   Triticum urartu
ref|XP_006416865.1|  hypothetical protein EUTSA_v10007054mg             157   6e-41   Eutrema salsugineum [saltwater cress]
ref|XP_002443867.1|  hypothetical protein SORBIDRAFT_07g003550          157   6e-41   
ref|XP_007009224.1|  XH/XS domain-containing protein, putative          153   6e-41   Theobroma cacao [chocolate]
gb|AAF02798.1|AF195115_18  F5I10.22 gene product                        157   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001169159.1|  putative XH domain family protein                  156   7e-41   Zea mays [maize]
gb|EYU17877.1|  hypothetical protein MIMGU_mgv1a002871mg                156   9e-41   Erythranthe guttata [common monkey flower]
gb|EMT32524.1|  hypothetical protein F775_28173                         155   9e-41   
dbj|BAK05532.1|  predicted protein                                      156   9e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011091511.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           156   1e-40   Sesamum indicum [beniseed]
emb|CDY35048.1|  BnaA06g10580D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_008673715.1|  PREDICTED: intraflagellar transport protein ...    155   2e-40   Zea mays [maize]
emb|CDY35898.1|  BnaA07g00890D                                          150   5e-40   Brassica napus [oilseed rape]
ref|XP_002316281.2|  XH/XS domain-containing family protein             155   5e-40   Populus trichocarpa [western balsam poplar]
gb|KDP44945.1|  hypothetical protein JCGZ_01445                         154   5e-40   Jatropha curcas
dbj|BAJ94618.1|  predicted protein                                      154   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_567176.2|  XH/XS domain-containing protein                       154   6e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69939.1|  hypothetical protein OsI_00386                          152   6e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010690753.1|  PREDICTED: factor of DNA methylation 5-like        151   7e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS59185.1|  hypothetical protein M569_15623                         153   8e-40   Genlisea aurea
gb|KJB73898.1|  hypothetical protein B456_011G262900                    150   8e-40   Gossypium raimondii
gb|EMT13639.1|  hypothetical protein F775_24890                         153   1e-39   
ref|XP_010940184.1|  PREDICTED: factor of DNA methylation 1-like        155   1e-39   
ref|XP_006389833.1|  hypothetical protein EUTSA_v10018261mg             152   2e-39   Eutrema salsugineum [saltwater cress]
emb|CDM82421.1|  unnamed protein product                                153   2e-39   Triticum aestivum [Canadian hard winter wheat]
gb|EMS64523.1|  hypothetical protein TRIUR3_35150                       153   3e-39   Triticum urartu
ref|XP_010690719.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           152   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002455202.1|  hypothetical protein SORBIDRAFT_03g006150          152   4e-39   Sorghum bicolor [broomcorn]
gb|EMT16997.1|  hypothetical protein F775_14651                         153   5e-39   
ref|XP_008461675.1|  PREDICTED: flagellar attachment zone protein 1     151   5e-39   Cucumis melo [Oriental melon]
ref|XP_009353657.1|  PREDICTED: uncharacterized protein LOC103944909    151   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_002533154.1|  conserved hypothetical protein                     151   6e-39   Ricinus communis
gb|EMS54623.1|  hypothetical protein TRIUR3_33647                       151   7e-39   Triticum urartu
gb|KHG08146.1|  Nif-specific regulatory                                 147   8e-39   Gossypium arboreum [tree cotton]
ref|NP_001168342.1|  putative XH domain family protein                  150   9e-39   Zea mays [maize]
emb|CDY33370.1|  BnaC05g12130D                                          153   9e-39   Brassica napus [oilseed rape]
ref|XP_003569416.1|  PREDICTED: factor of DNA methylation 1-like        150   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_010678966.1|  PREDICTED: factor of DNA methylation 5-like        150   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007009298.1|  XH/XS domain-containing protein, putative is...    150   1e-38   
ref|XP_007009299.1|  XH/XS domain-containing protein, putative is...    150   1e-38   
ref|XP_009104485.1|  PREDICTED: myosin-9-like                           150   1e-38   Brassica rapa
ref|XP_011035877.1|  PREDICTED: factor of DNA methylation 4             150   1e-38   Populus euphratica
ref|XP_006378650.1|  XH/XS domain-containing family protein             150   2e-38   
dbj|BAJ97190.1|  predicted protein                                      150   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007206603.1|  hypothetical protein PRUPE_ppa020716mg             150   2e-38   
gb|EAY85442.1|  hypothetical protein OsI_06823                          149   3e-38   Oryza sativa Indica Group [Indian rice]
dbj|BAD21477.1|  putative X1                                            149   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569414.1|  PREDICTED: factor of DNA methylation 1-like        149   3e-38   Brachypodium distachyon [annual false brome]
gb|EEE56772.1|  hypothetical protein OsJ_06333                          149   4e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10823.1|  unnamed protein product                                150   4e-38   Coffea canephora [robusta coffee]
emb|CDX67967.1|  BnaA07g20070D                                          149   4e-38   
ref|XP_010241796.1|  PREDICTED: factor of DNA methylation 1-like        148   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010651011.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           148   5e-38   
ref|XP_011027214.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           149   5e-38   Populus euphratica
ref|XP_008457475.1|  PREDICTED: centrosomal protein of 83 kDa           149   6e-38   Cucumis melo [Oriental melon]
ref|XP_008223681.1|  PREDICTED: uncharacterized protein PFB0765w        148   7e-38   Prunus mume [ume]
ref|XP_004969258.1|  PREDICTED: uncharacterized protein LOC101768...    139   8e-38   
ref|XP_006602003.1|  PREDICTED: microtubule-associated tumor supp...    145   8e-38   
ref|XP_004147687.1|  PREDICTED: uncharacterized protein LOC101219429    148   9e-38   Cucumis sativus [cucumbers]
ref|XP_008384852.1|  PREDICTED: calponin homology domain-containi...    148   1e-37   Malus domestica [apple tree]
dbj|BAD68892.1|  X1-like                                                140   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009343557.1|  PREDICTED: myosin heavy chain, cardiac muscl...    147   2e-37   
ref|XP_010523138.1|  PREDICTED: factor of DNA methylation 4             147   4e-37   
gb|KJB83761.1|  hypothetical protein B456_013G263400                    144   4e-37   Gossypium raimondii
ref|XP_004969257.1|  PREDICTED: uncharacterized protein LOC101768...    139   5e-37   
gb|KHG06632.1|  KilA-N domain-containing protein                        145   5e-37   Gossypium arboreum [tree cotton]
gb|KDP20451.1|  hypothetical protein JCGZ_05296                         146   5e-37   Jatropha curcas
ref|XP_010429902.1|  PREDICTED: factor of DNA methylation 5-like        145   5e-37   Camelina sativa [gold-of-pleasure]
gb|AAM22638.2|AF434195_1  X1                                            143   5e-37   Zea mays [maize]
ref|XP_009357740.1|  PREDICTED: myosin heavy chain, cardiac muscl...    145   5e-37   Pyrus x bretschneideri [bai li]
ref|XP_004242072.2|  PREDICTED: factor of DNA methylation 4-like        143   6e-37   Solanum lycopersicum
ref|XP_008343538.1|  PREDICTED: myosin-2 heavy chain-like               145   7e-37   
gb|KGN50554.1|  hypothetical protein Csa_5G182100                       146   7e-37   Cucumis sativus [cucumbers]
ref|XP_008354129.1|  PREDICTED: myosin-2 heavy chain-like               145   7e-37   
ref|XP_008371804.1|  PREDICTED: WEB family protein At4g27595, chl...    145   8e-37   Malus domestica [apple tree]
emb|CDY52860.1|  BnaA09g56520D                                          145   9e-37   Brassica napus [oilseed rape]
ref|XP_009117794.1|  PREDICTED: myosin-11-like                          145   9e-37   Brassica rapa
gb|KDO69291.1|  hypothetical protein CISIN_1g0065972mg                  144   1e-36   Citrus sinensis [apfelsine]
gb|EMT17491.1|  hypothetical protein F775_14734                         147   1e-36   
gb|KJB83759.1|  hypothetical protein B456_013G263400                    144   2e-36   Gossypium raimondii
gb|KJB83760.1|  hypothetical protein B456_013G263400                    144   2e-36   Gossypium raimondii
ref|XP_007220898.1|  hypothetical protein PRUPE_ppa002712mg             144   2e-36   Prunus persica
ref|XP_011461210.1|  PREDICTED: factor of DNA methylation 4 isofo...    144   2e-36   Fragaria vesca subsp. vesca
ref|XP_003568833.1|  PREDICTED: factor of DNA methylation 1-like        145   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_008233634.1|  PREDICTED: LOW QUALITY PROTEIN: CAP-Gly doma...    144   2e-36   Prunus mume [ume]
emb|CDX79353.1|  BnaC06g19500D                                          144   2e-36   
ref|XP_010108755.1|  hypothetical protein L484_011413                   144   2e-36   
ref|XP_004294497.2|  PREDICTED: factor of DNA methylation 4 isofo...    144   2e-36   Fragaria vesca subsp. vesca
ref|XP_011461209.1|  PREDICTED: factor of DNA methylation 4 isofo...    144   3e-36   Fragaria vesca subsp. vesca
ref|XP_010429908.1|  PREDICTED: factor of DNA methylation 5-like        138   3e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001050601.2|  Os03g0596400                                       135   3e-36   
ref|XP_006435548.1|  hypothetical protein CICLE_v10030937mg             143   3e-36   Citrus clementina [clementine]
ref|XP_002456013.1|  hypothetical protein SORBIDRAFT_03g028860          143   5e-36   Sorghum bicolor [broomcorn]
ref|XP_006302778.1|  hypothetical protein CARUB_v10020898mg             137   5e-36   Capsella rubella
ref|XP_004240949.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           142   6e-36   Solanum lycopersicum
dbj|BAH20228.1|  AT1G80790                                              142   8e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EMT15579.1|  hypothetical protein F775_11438                         142   9e-36   
emb|CDY53226.1|  BnaA02g19420D                                          136   1e-35   Brassica napus [oilseed rape]
gb|AAV69067.1|  X1                                                      141   1e-35   Zea mays subsp. mexicana [annual teosinte]
ref|XP_006362467.1|  PREDICTED: myosin-2 heavy chain-like isoform X2    142   1e-35   Solanum tuberosum [potatoes]
ref|NP_178194.1|  FACTOR OF DNA METHYLATION 5                           141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001146275.1|  putative transcription factor                      141   2e-35   Zea mays [maize]
gb|KJB67635.1|  hypothetical protein B456_010G201400                    141   2e-35   Gossypium raimondii
gb|AAV69069.1|  X1                                                      141   2e-35   Zea luxurians [Florida teosinte]
ref|XP_006362466.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    142   2e-35   
ref|XP_010417660.1|  PREDICTED: factor of DNA methylation 5-like        141   2e-35   Camelina sativa [gold-of-pleasure]
emb|CDP00105.1|  unnamed protein product                                141   2e-35   Coffea canephora [robusta coffee]
emb|CDY63974.1|  BnaC02g46630D                                          135   2e-35   Brassica napus [oilseed rape]
gb|EEC69937.1|  hypothetical protein OsI_00381                          139   2e-35   Oryza sativa Indica Group [Indian rice]
gb|KJB76093.1|  hypothetical protein B456_012G071000                    141   2e-35   Gossypium raimondii
gb|AGT17258.1|  X1 protein                                              141   2e-35   Saccharum hybrid cultivar R570
ref|XP_010106489.1|  hypothetical protein L484_025247                   138   2e-35   Morus notabilis
gb|KHG15173.1|  Forkhead-associated domain-containing 1                 141   2e-35   Gossypium arboreum [tree cotton]
ref|XP_006846222.1|  hypothetical protein AMTR_s00012p00230440          141   2e-35   Amborella trichopoda
ref|XP_003557426.1|  PREDICTED: factor of DNA methylation 1-like        142   2e-35   Brachypodium distachyon [annual false brome]
gb|KJB67636.1|  hypothetical protein B456_010G201400                    139   4e-35   Gossypium raimondii
gb|EEC71144.1|  hypothetical protein OsI_02969                          140   5e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010472874.1|  PREDICTED: factor of DNA methylation 5-like        140   5e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001043655.1|  Os01g0633200                                       140   5e-35   
ref|XP_004145335.1|  PREDICTED: uncharacterized LOC101207144            140   6e-35   
emb|CDM81289.1|  unnamed protein product                                132   7e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AAV69068.1|  X1                                                      139   8e-35   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006644407.1|  PREDICTED: intracellular protein transport p...    139   8e-35   Oryza brachyantha
gb|KEH34701.1|  XH/XS domain protein                                    139   8e-35   Medicago truncatula
emb|CDY69135.1|  BnaAnng29410D                                          135   1e-34   Brassica napus [oilseed rape]
ref|XP_004154410.1|  PREDICTED: uncharacterized protein LOC101207144    140   1e-34   
ref|XP_010690702.1|  PREDICTED: factor of DNA methylation 2-like        133   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004165825.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   1e-34   
gb|KGN65727.1|  hypothetical protein Csa_1G522530                       140   1e-34   Cucumis sativus [cucumbers]
emb|CDY68592.1|  BnaAnng27750D                                          133   1e-34   Brassica napus [oilseed rape]
gb|EMT28948.1|  hypothetical protein F775_22883                         132   1e-34   
ref|XP_006488337.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    138   2e-34   Citrus sinensis [apfelsine]
gb|KDO72840.1|  hypothetical protein CISIN_1g038527mg                   138   2e-34   Citrus sinensis [apfelsine]
ref|XP_004503147.1|  PREDICTED: myosin-11-like isoform X1               138   3e-34   Cicer arietinum [garbanzo]
ref|XP_011461207.1|  PREDICTED: factor of DNA methylation 2-like        132   3e-34   Fragaria vesca subsp. vesca
gb|AGT16789.1|  hypothetical protein SHCRBa_009_B01_R_10                137   4e-34   Saccharum hybrid cultivar R570
gb|EMS67897.1|  hypothetical protein TRIUR3_24560                       138   4e-34   Triticum urartu
gb|KHN33379.1|  hypothetical protein glysoja_005421                     136   5e-34   Glycine soja [wild soybean]
ref|XP_010658561.1|  PREDICTED: factor of DNA methylation 5-like ...    135   5e-34   Vitis vinifera
ref|XP_006391678.1|  hypothetical protein EUTSA_v10024003mg             133   5e-34   
ref|XP_010658559.1|  PREDICTED: factor of DNA methylation 5-like ...    135   5e-34   Vitis vinifera
ref|XP_006424841.1|  hypothetical protein CICLE_v10029911mg             138   6e-34   
emb|CDY16109.1|  BnaC08g40140D                                          137   7e-34   Brassica napus [oilseed rape]
ref|XP_009768237.1|  PREDICTED: uncharacterized protein LOC104219279    137   7e-34   Nicotiana sylvestris
ref|XP_002874349.1|  hypothetical protein ARALYDRAFT_910798             128   9e-34   
gb|AGT16810.1|  transcription factor                                    136   9e-34   Saccharum hybrid cultivar R570
emb|CDP00108.1|  unnamed protein product                                135   1e-33   Coffea canephora [robusta coffee]
gb|KHN17925.1|  hypothetical protein glysoja_017976                     136   1e-33   Glycine soja [wild soybean]
ref|XP_003538408.1|  PREDICTED: putative leucine-rich repeat-cont...    136   1e-33   
emb|CDY26616.1|  BnaA09g46610D                                          137   1e-33   Brassica napus [oilseed rape]
ref|XP_006597270.1|  PREDICTED: uncharacterized protein PFB0765w-...    136   2e-33   Glycine max [soybeans]
ref|XP_006597269.1|  PREDICTED: uncharacterized protein PFB0765w-...    136   2e-33   
ref|XP_010419381.1|  PREDICTED: factor of DNA methylation 5-like        129   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006369526.1|  hypothetical protein POPTR_0001s24750g             134   3e-33   
ref|XP_006846214.1|  hypothetical protein AMTR_s00012p00226630          135   3e-33   Amborella trichopoda
gb|EEC75682.1|  hypothetical protein OsI_12489                          134   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_010067411.1|  PREDICTED: coiled-coil domain-containing pro...    135   3e-33   Eucalyptus grandis [rose gum]
ref|XP_004968196.1|  PREDICTED: uncharacterized protein LOC101775413    127   4e-33   
ref|XP_006595902.1|  PREDICTED: uncharacterized protein LOC100790...    137   4e-33   
ref|XP_006350773.1|  PREDICTED: uncharacterized protein LOC102596562    135   4e-33   Solanum tuberosum [potatoes]
ref|XP_003545257.1|  PREDICTED: uncharacterized protein LOC100790...    137   5e-33   Glycine max [soybeans]
gb|KCW65539.1|  hypothetical protein EUGRSUZ_G02937                     135   5e-33   Eucalyptus grandis [rose gum]
ref|XP_009597794.1|  PREDICTED: interaptin-like                         135   5e-33   Nicotiana tomentosiformis
ref|XP_006645498.1|  PREDICTED: uncharacterized protein LOC102715808    132   7e-33   
ref|XP_007150328.1|  hypothetical protein PHAVU_005G144400g             135   8e-33   Phaseolus vulgaris [French bean]
ref|XP_009589398.1|  PREDICTED: golgin candidate 4                      134   8e-33   Nicotiana tomentosiformis
ref|XP_011462130.1|  PREDICTED: factor of DNA methylation 1-like        128   9e-33   Fragaria vesca subsp. vesca
ref|XP_011089476.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...    134   9e-33   Sesamum indicum [beniseed]
ref|XP_011089473.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...    134   1e-32   
ref|XP_007141865.1|  hypothetical protein PHAVU_008G232300g             134   3e-32   Phaseolus vulgaris [French bean]
gb|AAO38006.1|  putative transcription factor                           127   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009799105.1|  PREDICTED: golgin candidate 4                      132   3e-32   Nicotiana sylvestris
emb|CDP09063.1|  unnamed protein product                                132   4e-32   Coffea canephora [robusta coffee]
gb|KHN30167.1|  hypothetical protein glysoja_010545                     130   5e-32   Glycine soja [wild soybean]
emb|CDY33798.1|  BnaA09g46040D                                          131   5e-32   Brassica napus [oilseed rape]
ref|XP_006575506.1|  PREDICTED: uncharacterized protein LOC100806...    134   5e-32   Glycine max [soybeans]
gb|KHN41100.1|  hypothetical protein glysoja_013442                     134   5e-32   Glycine soja [wild soybean]
ref|XP_009118027.1|  PREDICTED: uncharacterized protein LOC103843080    132   5e-32   Brassica rapa
ref|XP_006575503.1|  PREDICTED: uncharacterized protein LOC100806...    134   5e-32   Glycine max [soybeans]
emb|CDY68705.1|  BnaAnng28060D                                          125   5e-32   
ref|XP_010106492.1|  hypothetical protein L484_025250                   131   6e-32   
emb|CDY01551.1|  BnaC07g35410D                                          125   6e-32   
ref|XP_006846220.1|  hypothetical protein AMTR_s00012p00229720          129   6e-32   
ref|XP_006841392.1|  hypothetical protein AMTR_s02578p00002400          129   7e-32   
gb|KDO41498.1|  hypothetical protein CISIN_1g037047mg                   125   7e-32   
ref|XP_010476408.1|  PREDICTED: factor of DNA methylation 4-like ...    132   1e-31   
ref|XP_010476407.1|  PREDICTED: factor of DNA methylation 4-like ...    132   1e-31   
ref|XP_006300857.1|  hypothetical protein CARUB_v10019950mg             130   1e-31   
ref|XP_007207033.1|  hypothetical protein PRUPE_ppb023971mg             126   2e-31   
ref|XP_006595025.1|  PREDICTED: myosin-11-like isoform X1               130   2e-31   
ref|XP_007207781.1|  hypothetical protein PRUPE_ppa026045mg             122   2e-31   
ref|XP_010495608.1|  PREDICTED: factor of DNA methylation 4-like        130   2e-31   
ref|XP_004294519.1|  PREDICTED: factor of DNA methylation 4-like ...    127   3e-31   
ref|XP_004968194.1|  PREDICTED: uncharacterized protein LOC101774612    127   3e-31   
ref|XP_010043544.1|  PREDICTED: myosin-4-like                           130   3e-31   
gb|KCW85560.1|  hypothetical protein EUGRSUZ_B023591                    130   3e-31   
ref|XP_011461206.1|  PREDICTED: factor of DNA methylation 4-like ...    126   3e-31   
ref|NP_001042013.1|  Os01g0147400                                       128   3e-31   
emb|CDY16058.1|  BnaC08g40650D                                          130   3e-31   
ref|XP_007156380.1|  hypothetical protein PHAVU_003G281400g             129   3e-31   
gb|EAY72523.1|  hypothetical protein OsI_00384                          125   4e-31   
ref|XP_007163408.1|  hypothetical protein PHAVU_001G232400g             129   6e-31   
gb|KJB67633.1|  hypothetical protein B456_010G201300                    129   8e-31   
ref|NP_172834.1|  SGS3-like protein FDM4                                129   1e-30   
emb|CDY27826.1|  BnaC09g28530D                                          122   1e-30   
ref|XP_010472879.1|  PREDICTED: factor of DNA methylation 1-like        124   1e-30   
ref|XP_003616411.1|  Transcription factor X1-like protein               129   1e-30   
ref|XP_009128392.1|  PREDICTED: uncharacterized protein PF11_0207       124   2e-30   
gb|KJB67632.1|  hypothetical protein B456_010G201300                    129   2e-30   
gb|KHG17770.1|  suppressor of gene silencing 3 -like protein            129   2e-30   
ref|XP_004487000.1|  PREDICTED: cingulin-like protein 1-like            127   2e-30   
ref|XP_004307495.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           127   3e-30   
ref|XP_006306867.1|  hypothetical protein CARUB_v10008414mg             127   3e-30   
emb|CDP00109.1|  unnamed protein product                                121   3e-30   
gb|EMS45500.1|  hypothetical protein TRIUR3_12203                       127   3e-30   
ref|XP_010322357.1|  PREDICTED: factor of DNA methylation 4-like        124   4e-30   
tpg|DAA50216.1|  TPA: putative XH domain family protein                 127   4e-30   
ref|XP_010460676.1|  PREDICTED: factor of DNA methylation 1-like        125   4e-30   
gb|EMT07790.1|  hypothetical protein F775_28070                         126   4e-30   
gb|KEH34706.1|  XH/XS domain protein                                    124   4e-30   
ref|XP_010272851.1|  PREDICTED: factor of DNA methylation 4-like        123   5e-30   
gb|AAL35831.2|AF434705_1  putative transcription factor X1              126   6e-30   
ref|XP_010520107.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      126   6e-30   
ref|XP_006585879.1|  PREDICTED: myosin heavy chain, clone 203-lik...    126   7e-30   
gb|EMT14402.1|  hypothetical protein F775_20219                         126   1e-29   
dbj|BAJ90280.1|  predicted protein                                      125   1e-29   
ref|XP_004490889.1|  PREDICTED: uncharacterized protein LOC101499...    127   1e-29   
ref|XP_002464269.1|  hypothetical protein SORBIDRAFT_01g015250          125   1e-29   
ref|XP_006491884.1|  PREDICTED: calponin homology domain-containi...    125   2e-29   
ref|XP_006431940.1|  hypothetical protein CICLE_v10000571mg             125   2e-29   
gb|EYU24614.1|  hypothetical protein MIMGU_mgv1a004328mg                124   2e-29   
gb|KEH32517.1|  XH/XS domain protein                                    120   3e-29   
ref|XP_010458844.1|  PREDICTED: LOW QUALITY PROTEIN: factor of DN...    125   3e-29   
ref|XP_009601726.1|  PREDICTED: uncharacterized protein LOC104096...    120   7e-29   
ref|XP_010478264.1|  PREDICTED: factor of DNA methylation 2-like        121   7e-29   
ref|XP_003568908.1|  PREDICTED: factor of DNA methylation 1-like        122   1e-28   
ref|XP_009146609.1|  PREDICTED: uncharacterized protein LOC103870246    122   1e-28   
emb|CDY08424.1|  BnaA05g26600D                                          122   1e-28   
emb|CDY42155.1|  BnaC05g40640D                                          122   2e-28   
gb|AFK46180.1|  unknown                                                 115   2e-28   
ref|XP_008223671.1|  PREDICTED: protein bfr2-like                       119   2e-28   
gb|KEH39446.1|  XH/XS domain protein                                    122   2e-28   
gb|EMS65455.1|  hypothetical protein TRIUR3_13658                       122   2e-28   
ref|XP_010417664.1|  PREDICTED: factor of DNA methylation 5-like        117   3e-28   
ref|XP_006407322.1|  hypothetical protein EUTSA_v10020282mg             121   4e-28   
emb|CDM81288.1|  unnamed protein product                                119   4e-28   
ref|XP_002890022.1|  XH/XS domain-containing protein                    121   5e-28   
ref|XP_010690736.1|  PREDICTED: factor of DNA methylation 1-like ...    117   6e-28   
ref|XP_009791210.1|  PREDICTED: uncharacterized protein LOC104238...    122   6e-28   
ref|XP_010520104.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      120   6e-28   
ref|XP_009761116.1|  PREDICTED: cingulin-like                           120   7e-28   
ref|XP_010690742.1|  PREDICTED: factor of DNA methylation 1-like ...    117   7e-28   
emb|CDP07770.1|  unnamed protein product                                117   7e-28   
gb|ABB89773.1|  At3g12550-like protein                                  120   8e-28   
ref|XP_004293066.1|  PREDICTED: factor of DNA methylation 4-like        118   8e-28   
ref|XP_006435549.1|  hypothetical protein CICLE_v10033798mg             118   9e-28   
gb|EMS58631.1|  hypothetical protein TRIUR3_15740                       117   1e-27   
ref|XP_010690731.1|  PREDICTED: factor of DNA methylation 1-like ...    117   1e-27   
gb|AAB94013.1|  gene X-like protein                                     121   1e-27   
ref|XP_002455204.1|  hypothetical protein SORBIDRAFT_03g006160          118   1e-27   
ref|XP_006417088.1|  hypothetical protein EUTSA_v10006952mg             120   1e-27   
ref|XP_011461202.1|  PREDICTED: factor of DNA methylation 2-like ...    118   1e-27   
ref|XP_011461204.1|  PREDICTED: factor of DNA methylation 2-like ...    118   1e-27   
ref|XP_006486472.1|  PREDICTED: myosin heavy chain, cardiac muscl...    118   1e-27   
gb|EMT25049.1|  hypothetical protein F775_00149                         119   1e-27   
ref|XP_006486471.1|  PREDICTED: myosin heavy chain, cardiac muscl...    118   1e-27   
ref|XP_002875517.1|  predicted protein                                  115   1e-27   
ref|XP_011461200.1|  PREDICTED: factor of DNA methylation 2-like ...    118   1e-27   
ref|XP_009610604.1|  PREDICTED: uncharacterized protein LOC104104...    120   2e-27   
gb|KHN27026.1|  hypothetical protein glysoja_039182                     119   2e-27   
ref|XP_002882779.1|  hypothetical protein ARALYDRAFT_318024             119   2e-27   
ref|XP_009601722.1|  PREDICTED: uncharacterized protein LOC104096...    116   3e-27   
ref|XP_006345969.1|  PREDICTED: uncharacterized protein LOC102583...    119   4e-27   
gb|KEH39444.1|  XH/XS domain protein                                    116   4e-27   
ref|XP_006345968.1|  PREDICTED: uncharacterized protein LOC102583...    119   4e-27   
ref|XP_006345966.1|  PREDICTED: uncharacterized protein LOC102583...    119   5e-27   
emb|CDM81241.1|  unnamed protein product                                116   5e-27   
ref|XP_010465028.1|  PREDICTED: factor of DNA methylation 3-like        118   6e-27   
ref|XP_010486975.1|  PREDICTED: factor of DNA methylation 3             117   6e-27   
ref|NP_566849.2|  XH domain-containing protein                          115   8e-27   
gb|KEH39445.1|  XH/XS domain protein                                    117   8e-27   
ref|NP_001054677.1|  Os05g0153200                                       117   1e-26   
ref|XP_010685748.1|  PREDICTED: factor of DNA methylation 4             117   1e-26   
gb|EMS51933.1|  hypothetical protein TRIUR3_15169                       115   1e-26   
ref|XP_003559697.1|  PREDICTED: factor of DNA methylation 4-like        116   2e-26   
gb|EEE62370.1|  hypothetical protein OsJ_17159                          117   2e-26   
gb|EMS60036.1|  hypothetical protein TRIUR3_01024                       115   2e-26   
gb|EYU18979.1|  hypothetical protein MIMGU_mgv1a025152mg                117   2e-26   
gb|EMS49993.1|  hypothetical protein TRIUR3_32685                       113   3e-26   
ref|XP_002444012.1|  hypothetical protein SORBIDRAFT_07g005860          114   4e-26   
ref|XP_009137118.1|  PREDICTED: uncharacterized protein LOC103861167    110   7e-26   
gb|EAY96594.1|  hypothetical protein OsI_18500                          114   7e-26   
ref|XP_006664659.1|  PREDICTED: uncharacterized protein LOC102712773    112   7e-26   
ref|XP_006599359.1|  PREDICTED: uncharacterized protein PFB0765w-...    115   8e-26   
gb|EMS57088.1|  hypothetical protein TRIUR3_02882                       115   8e-26   
ref|XP_004239795.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      115   9e-26   
gb|EYU37790.1|  hypothetical protein MIMGU_mgv1a002821mg                114   1e-25   
emb|CDM81211.1|  unnamed protein product                                110   2e-25   
ref|XP_010499136.1|  PREDICTED: factor of DNA methylation 3-like        113   2e-25   
ref|XP_009613957.1|  PREDICTED: cingulin-like                           112   2e-25   
gb|EMT01206.1|  hypothetical protein F775_16922                         110   3e-25   
gb|KEH34705.1|  XH/XS domain protein                                    109   3e-25   
ref|XP_010316797.1|  PREDICTED: factor of DNA methylation 1-like        111   3e-25   
emb|CDY05861.1|  BnaC08g20380D                                          113   3e-25   
ref|XP_009149803.1|  PREDICTED: myosin-11                               112   4e-25   
ref|XP_004287122.1|  PREDICTED: factor of DNA methylation 3-like        110   4e-25   
ref|XP_004975017.1|  PREDICTED: uncharacterized protein LOC101757106    109   5e-25   
emb|CDY08088.1|  BnaA06g16380D                                          112   5e-25   
ref|XP_011462129.1|  PREDICTED: factor of DNA methylation 1-like        112   6e-25   
ref|XP_010092498.1|  hypothetical protein L484_019257                   110   6e-25   
ref|XP_010429909.1|  PREDICTED: factor of DNA methylation 5-like        107   1e-24   
gb|AAC72860.1|  contains similarity to ribosomal protein L7Ae (Pf...    110   2e-24   
ref|XP_010034355.1|  PREDICTED: uncharacterized protein LOC104423588    107   2e-24   
emb|CAB62356.1|  putative protein                                       110   3e-24   
ref|NP_190436.2|  XH/XS domain-containing protein                       110   3e-24   
emb|CDX77918.1|  BnaC03g53010D                                          110   3e-24   
ref|XP_006664124.1|  PREDICTED: uncharacterized protein LOC102703635    107   4e-24   
ref|XP_002442365.1|  hypothetical protein SORBIDRAFT_08g018875          107   4e-24   
gb|EPS61376.1|  hypothetical protein M569_13419                         109   5e-24   
ref|NP_187861.2|  XH/XS domain-containing protein                       109   5e-24   
gb|AAG51004.1|AC069474_3  unknown protein; 49125-46422                  109   5e-24   
ref|XP_009150181.1|  PREDICTED: uncharacterized protein LOC103873521    109   5e-24   
ref|XP_006297188.1|  hypothetical protein CARUB_v10013193mg             109   5e-24   
ref|XP_006292435.1|  hypothetical protein CARUB_v10018651mg             108   1e-23   
ref|XP_006366492.1|  PREDICTED: interaptin-like                         108   1e-23   
gb|EMT06773.1|  hypothetical protein F775_17939                         108   1e-23   
ref|XP_010426360.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           108   2e-23   
gb|EMS46575.1|  hypothetical protein TRIUR3_13999                       105   2e-23   
gb|KFK42457.1|  hypothetical protein AALP_AA2G259200                    105   2e-23   
gb|EMT07338.1|  hypothetical protein F775_27883                         105   2e-23   
ref|XP_002875916.1|  XH/XS domain-containing protein                    107   3e-23   
ref|XP_004977060.1|  PREDICTED: myosin heavy chain, clone 203-like      107   3e-23   
ref|XP_010503501.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      107   3e-23   
gb|KJB73986.1|  hypothetical protein B456_011G265400                    102   3e-23   
emb|CDY37917.1|  BnaA06g19000D                                          107   3e-23   
ref|XP_002531437.1|  conserved hypothetical protein                     103   3e-23   
gb|ABA99675.1|  XH domain containing protein, expressed                 105   3e-23   
ref|XP_010321721.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      107   4e-23   
ref|NP_001067092.1|  Os12g0572500                                       105   4e-23   
gb|EAZ20946.1|  hypothetical protein OsJ_36596                          105   4e-23   
ref|XP_011461195.1|  PREDICTED: factor of DNA methylation 3-like ...    104   5e-23   
ref|XP_011461196.1|  PREDICTED: factor of DNA methylation 3-like ...    104   6e-23   
emb|CDM84354.1|  unnamed protein product                                103   8e-23   
gb|AAD22640.1|AC007138_4  hypothetical protein                          104   8e-23   
ref|XP_010474507.1|  PREDICTED: factor of DNA methylation 5-like        102   1e-22   
ref|NP_192087.2|  XH/XS domain-containing protein                       104   1e-22   
ref|XP_002887810.1|  hypothetical protein ARALYDRAFT_340143             100   1e-22   
gb|EMT12826.1|  hypothetical protein F775_22463                       99.8    1e-22   
ref|XP_006391023.1|  hypothetical protein EUTSA_v10019728mg             105   2e-22   
ref|XP_006282252.1|  hypothetical protein CARUB_v10028526mg             104   2e-22   
ref|XP_002443870.1|  hypothetical protein SORBIDRAFT_07g003565        97.4    3e-22   
gb|EMT31294.1|  hypothetical protein F775_03433                         101   4e-22   
gb|EMS47309.1|  hypothetical protein TRIUR3_25171                       101   6e-22   
gb|EMT01620.1|  hypothetical protein F775_32750                         100   1e-21   
ref|XP_010690707.1|  PREDICTED: factor of DNA methylation 5-like ...    102   1e-21   
gb|EMS56026.1|  hypothetical protein TRIUR3_13486                       102   1e-21   
ref|XP_004510284.1|  PREDICTED: uncharacterized protein PFB0145c-...    102   2e-21   
ref|XP_010690710.1|  PREDICTED: factor of DNA methylation 5-like ...    102   2e-21   
gb|KJB68816.1|  hypothetical protein B456_011G264300                    100   2e-21   
ref|XP_004962689.1|  PREDICTED: uncharacterized protein LOC101771...    100   2e-21   
ref|XP_006400966.1|  hypothetical protein EUTSA_v10013147mg             101   3e-21   
gb|KJB73943.1|  hypothetical protein B456_011G262700                  98.6    4e-21   
gb|EAY83599.1|  hypothetical protein OsI_38821                        97.1    4e-21   
gb|KEH29632.1|  XH/XS domain protein                                    100   1e-20   
ref|XP_006664660.1|  PREDICTED: uncharacterized protein LOC102713040  97.4    2e-20   
ref|XP_010232389.1|  PREDICTED: factor of DNA methylation 1-like      97.1    2e-20   
gb|EMS51269.1|  hypothetical protein TRIUR3_11448                     96.7    2e-20   
dbj|BAK00892.1|  predicted protein                                    96.7    3e-20   
ref|XP_011461197.1|  PREDICTED: factor of DNA methylation 4-like ...  95.5    6e-20   
ref|XP_008358553.1|  PREDICTED: myb-like protein X                    96.3    6e-20   
ref|XP_007016398.1|  XH/XS domain-containing protein, putative is...  95.9    1e-19   
ref|XP_007016397.1|  XH/XS domain-containing protein, putative is...  96.3    2e-19   
ref|XP_007016399.1|  XH/XS domain-containing protein, putative is...  95.9    2e-19   
ref|XP_010485238.1|  PREDICTED: factor of DNA methylation 4-like      95.9    3e-19   
ref|XP_010092494.1|  hypothetical protein L484_019253                 93.6    3e-19   
ref|XP_010483561.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    95.1    5e-19   
gb|KJB31978.1|  hypothetical protein B456_005G216900                  90.5    5e-19   
gb|EMT22338.1|  hypothetical protein F775_15062                       94.4    5e-19   
ref|XP_006404228.1|  hypothetical protein EUTSA_v10010188mg           95.1    6e-19   
ref|XP_002440617.1|  hypothetical protein SORBIDRAFT_09g004150        95.1    6e-19   
ref|XP_010454940.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    94.7    6e-19   
gb|KGN44516.1|  hypothetical protein Csa_7G323110                     94.4    8e-19   
ref|NP_200747.1|  XH/XS domain-containing protein                     94.4    8e-19   
dbj|BAH30638.1|  hypothetical protein                                 94.4    9e-19   
ref|XP_010443691.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    94.0    1e-18   
gb|EEC69943.1|  hypothetical protein OsI_00394                        86.3    4e-18   
gb|EMS62541.1|  hypothetical protein TRIUR3_25973                     88.2    9e-18   
gb|EMT16668.1|  hypothetical protein F775_11900                       89.7    4e-17   
gb|KDO42997.1|  hypothetical protein CISIN_1g006762mg                 89.4    4e-17   
ref|XP_006598038.1|  PREDICTED: interaptin-like                       89.0    5e-17   
ref|XP_009120446.1|  PREDICTED: structural maintenance of chromos...  88.6    7e-17   
emb|CDX80273.1|  BnaC09g34690D                                        88.2    9e-17   
gb|KEH39385.1|  XH/XS domain protein, putative                        88.2    1e-16   
ref|XP_003638053.1|  Gene X-like protein                              88.2    1e-16   
ref|XP_010232024.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...  87.8    1e-16   
ref|XP_007009301.1|  XH/XS domain-containing protein, putative is...  87.0    3e-16   
ref|XP_007009300.1|  XH/XS domain-containing protein, putative is...  87.0    3e-16   
ref|XP_007009302.1|  XH/XS domain-containing protein isoform 5        87.0    3e-16   
ref|XP_006603103.1|  PREDICTED: intracellular protein transport p...  87.0    3e-16   
gb|KJB71309.1|  hypothetical protein B456_011G117800                  81.6    5e-16   



>ref|XP_009763380.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
 ref|XP_009763381.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
Length=632

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            + LI GL++LL SGRSHIGIRRMGEID KAF N CKQRF  EEA++KALELCSLWQEK+K
Sbjct  480  RTLITGLNELLTSGRSHIGIRRMGEIDSKAFQNACKQRFPNEEAEIKALELCSLWQEKIK  539

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            D +WHPF+   + + + E++I+E+DE L KLKEEWG+EI  AV +A++E+ EYN SGRYV
Sbjct  540  DSDWHPFKTFMVDESKAEKVIDENDEALKKLKEEWGDEIYNAVTEALKEIEEYNPSGRYV  599

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPELWNFKE RKATLKE +SFIFKQLKTHKRKR
Sbjct  600  IPELWNFKEQRKATLKEAISFIFKQLKTHKRKR  632



>ref|XP_009626788.1| PREDICTED: coiled-coil domain-containing protein 150-like [Nicotiana 
tomentosiformis]
Length=632

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            + LI GL++LL SGRSHIGIRRMGEI+ KAF N CKQRF  EEA++KALELCSLWQEK+K
Sbjct  480  RTLITGLNELLTSGRSHIGIRRMGEIESKAFQNACKQRFPNEEAEIKALELCSLWQEKIK  539

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            D +WHPF+   + + + E++I+EDDE L KLKEEWG+EI  AV +A++E+ EYN SGRYV
Sbjct  540  DSDWHPFKTFMVDESKAEKVIDEDDEALKKLKEEWGDEIYNAVTEALKEIEEYNPSGRYV  599

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPE+WN KE RKATLKE +SFIFKQLKTHKRKR
Sbjct  600  IPEMWNSKEQRKATLKEAISFIFKQLKTHKRKR  632



>ref|XP_009605544.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009605546.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
Length=635

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++L SGRS IGI+RMGEID KAF N  KQR  + EAD+KALELCSLWQEK+K  
Sbjct  484  LIDGLKEMLTSGRSQIGIKRMGEIDAKAFQNALKQRLPSAEADIKALELCSLWQEKLKAQ  543

Query  432  NWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            +WHPF+ + + + R E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+I 
Sbjct  544  DWHPFKTVMVDESRVERVIDENDEALQKLKEEWGDEIYNAVTTALKEIEEYNPSGRYIIN  603

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            ELWNFKEGRKATLKEV S+IFKQLKTHKRKR
Sbjct  604  ELWNFKEGRKATLKEVTSYIFKQLKTHKRKR  634



>ref|XP_009605543.1| PREDICTED: myb-like protein X isoform X1 [Nicotiana tomentosiformis]
Length=647

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++L SGRS IGI+RMGEID KAF N  KQR  + EAD+KALELCSLWQEK+K  
Sbjct  496  LIDGLKEMLTSGRSQIGIKRMGEIDAKAFQNALKQRLPSAEADIKALELCSLWQEKLKAQ  555

Query  432  NWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            +WHPF+ + + + R E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+I 
Sbjct  556  DWHPFKTVMVDESRVERVIDENDEALQKLKEEWGDEIYNAVTTALKEIEEYNPSGRYIIN  615

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            ELWNFKEGRKATLKEV S+IFKQLKTHKRKR
Sbjct  616  ELWNFKEGRKATLKEVTSYIFKQLKTHKRKR  646



>ref|XP_009793116.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793117.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793118.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793119.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
Length=635

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            + LI GL +++ SGRS IGI+RMGEID KAF N  KQR  + EA++KALELCSLWQE +K
Sbjct  482  RTLIDGLKEIVTSGRSQIGIKRMGEIDAKAFQNALKQRLPSAEAEIKALELCSLWQENLK  541

Query  438  DPNWHPFRVINIHDRP-EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
              +WHPF+ + + +   E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+
Sbjct  542  AQDWHPFKTVMVDESHVERMIDENDESLQKLKEEWGDEIFNAVTTALKEIEEYNPSGRYI  601

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            I ELWNFKEGRKATLKEV S+IFKQLKTHKRKR
Sbjct  602  INELWNFKEGRKATLKEVTSYIFKQLKTHKRKR  634



>emb|CBI40114.3| unnamed protein product [Vitis vinifera]
Length=352

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGE+D K F N CKQRFS EEA+V+A  L SLWQ+ +K P
Sbjct  204  LITGLKDML-SGRTNIGLKRMGELDEKPFLNTCKQRFSLEEANVQAYTLVSLWQDNLKKP  262

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +     +IINE+DE+L KLK+EWG+EI  AV K+++E+NEYN SGRY + E
Sbjct  263  EWHPFKIVEVEGETLEIINEEDEKLQKLKQEWGDEIYMAVTKSLKEINEYNPSGRYTVFE  322

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  323  LWNFKEGRKATLKEVIQYILKNMKTLKRKR  352



>ref|XP_010911457.1| PREDICTED: factor of DNA methylation 5-like [Elaeis guineensis]
Length=206

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++L SGR+ IGI+RMGE+D K F   CKQR S + ADV A+ LCS WQ++++
Sbjct  56   KELISGLKEML-SGRTLIGIKRMGELDEKPFQTACKQRCSKDNADVNAIMLCSKWQDELR  114

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPF+VI +  +P++II EDDE+L  LKE+ G+E+   V  A+ E+NEYN SGRYVI
Sbjct  115  KPEWHPFKVITVDGKPQEIIQEDDEKLQALKEDLGDEVYKVVTTALLEMNEYNPSGRYVI  174

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV+ +I KQ KTHKRKR
Sbjct  175  PELWNFKEGRKATLKEVIQYIMKQWKTHKRKR  206



>ref|XP_010911713.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=206

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++L SGR+ IGI+RMGE+D K F   CKQRFS + ADV A+ LCS WQ++++
Sbjct  56   KELISGLKEML-SGRTLIGIKRMGELDEKPFQTACKQRFSKDNADVNAIMLCSKWQDELR  114

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPF+VI +  +P++II EDDE+L  LKEE G+E+   V  A+ E+NEYN SGRYVI
Sbjct  115  KPEWHPFKVITVDGKPQEIIQEDDEKLQALKEELGDEVYKVVTTALLEMNEYNPSGRYVI  174

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKE + +I KQLKT KR R
Sbjct  175  PELWNFKEGRKATLKEAIQYILKQLKTCKRTR  206



>ref|XP_008362754.1| PREDICTED: uncharacterized protein LOC103426447 [Malus domestica]
Length=218

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  588  LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  409
            L SGRSHIGI+RMG++D K F   CK+R+S EEA+++A   CSLWQ  + +  WHPF+++
Sbjct  76   LLSGRSHIGIKRMGDLDQKPFLKACKERYSLEEAEMQAFTQCSLWQNNLTNSEWHPFKIV  135

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
             + ++PE+I+NE+DE+L  LKE+WG +I   V+ A++E+NEYN SGRYVIPELWNFKEGR
Sbjct  136  TVTEQPEEIVNEEDEKLRSLKEDWGTDIYECVVTALKELNEYNPSGRYVIPELWNFKEGR  195

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKEV+SF+ K +KT KRKR
Sbjct  196  KATLKEVISFVLKNIKTLKRKR  217



>ref|XP_006341360.1| PREDICTED: myosin-9-like [Solanum tuberosum]
Length=635

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            + L +GL ++L+S R+HIGI+RMGEID KAF    KQ+F  +EA++KA+EL SLWQEK+K
Sbjct  482  RTLKEGLLEVLSSARAHIGIKRMGEIDSKAFQTALKQKFPNQEAEIKAVELLSLWQEKIK  541

Query  438  DPNWHPFRVINIHDRP-EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+WHPF+ I I +   E++I+E+DEEL KLK+E G+EI  AV  A++E+ EYN SGRY 
Sbjct  542  DPDWHPFKTIMIDESNVERVIDENDEELGKLKQELGDEIYDAVTVALKEIEEYNPSGRYA  601

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPELWNFKEGRKATLKEV+S+IFKQLKT KRKR
Sbjct  602  IPELWNFKEGRKATLKEVISYIFKQLKTQKRKR  634



>ref|XP_004235934.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
 ref|XP_010318733.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
Length=634

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            + L +GL ++L+S R+HIGI+RMGEID KAF N  KQ+F  +EA++KA+EL SLWQEK+K
Sbjct  482  RTLKEGLIEVLSSARAHIGIKRMGEIDSKAFQNALKQKFPNQEAEIKAVELLSLWQEKIK  541

Query  438  DPNWHPFRVINIHDRP-EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+WHPF+ I I +   E++I+E+DEEL KLK+E+G+EI  AV  A++E+ EYN SGRY 
Sbjct  542  DPDWHPFKTIMIDESNVERVIDENDEELGKLKQEFGDEIYDAVTVALKEIEEYNPSGRYA  601

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPELWNFKEGRKATLKEV+S+IFKQ+K  KRKR
Sbjct  602  IPELWNFKEGRKATLKEVISYIFKQVKAQKRKR  634



>ref|XP_008375509.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLS++L SGRS+IGI+RMG++D K F N CK+RF+ EEA V+A  LCSLWQ+ + 
Sbjct  483  KELIAGLSEML-SGRSNIGIKRMGDLDQKPFMNTCKERFTLEEAQVQASTLCSLWQDNLT  541

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+VI +++ P++I++E+DE+L  L+EEWG EI   V+ A++E+N+YN SGRYVI
Sbjct  542  NPDWHPFKVITVNEEPKEILDEEDEKLRNLREEWGNEIHECVVTALKELNDYNPSGRYVI  601

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKEGRKATLKEV+SF+ K +KT KRKR
Sbjct  602  SELWNFKEGRKATLKEVISFVLKSIKTLKRKR  633



>gb|KDP41984.1| hypothetical protein JCGZ_27002 [Jatropha curcas]
Length=636

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSG-RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKV  442
            K LI GL D L S  R++IGI+RMGEID KAF N CKQ+F+TEEA V+A  LCSLWQE +
Sbjct  483  KELILGLKDTLASSVRTNIGIKRMGEIDQKAFLNTCKQKFATEEAQVQASTLCSLWQENL  542

Query  441  KDPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            KDPNWHPF+++ +   + E+I++E+DE+L  LK+EWG +I  AV+ A++E+NEYN SGRY
Sbjct  543  KDPNWHPFKIVTDAEGKHEEIVDEEDEKLQNLKQEWGGDIYMAVVTALKEINEYNPSGRY  602

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            V PELWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  603  VTPELWNFKEGRKATLKEVIGYIVKNIKTLKRKR  636



>ref|XP_010920577.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=358

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DLLN GR+ IGI+RMGE+D K FHN C++R+  ++AD KA ELC+ WQE++K
Sbjct  208  KELIVGLDDLLN-GRTLIGIKRMGELDEKPFHNACRKRYKADDADTKAAELCTSWQEELK  266

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++++  +   +II+EDDE+L  L  E G+++C AV  A+ E+NEYN SGRYVI
Sbjct  267  QPSWHPYKIVHDDEGAREIIDEDDEKLKNLWIELGDDVCNAVKTALIEINEYNPSGRYVI  326

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKAT+KEV+ +IFKQ K +KRKR
Sbjct  327  PELWNFKEGRKATMKEVIQYIFKQWKNNKRKR  358



>ref|XP_003531733.1| PREDICTED: protein MLP1-like isoform X1 [Glycine max]
 ref|XP_006585612.1| PREDICTED: protein MLP1-like isoform X2 [Glycine max]
 gb|KHN38029.1| hypothetical protein glysoja_007071 [Glycine soja]
Length=629

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+LN  R++IG++RMGE+D K F N CK+RF  EEA  K +ELCSLWQE VK
Sbjct  477  KELINGLDDMLNGPRTNIGLKRMGELDQKIFVNNCKKRFPLEEAGTKGVELCSLWQENVK  536

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V+ + D+PE IINE+DE+L  LK+EWG+EI +AV+ A++E+NEYNASG Y +
Sbjct  537  NSAWHPFKVVTVDDKPENIINEEDEKLRSLKQEWGDEIYSAVVTALKEINEYNASGGYTV  596

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I   +K  KRKR
Sbjct  597  KELWNFKEKRKATLKEVINYIMDHIKPLKRKR  628



>gb|EYU21705.1| hypothetical protein MIMGU_mgv1a020880mg [Erythranthe guttata]
Length=272

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL ++L S R +IGI+RMGEID KAF N CK RF  EEAD+K +ELCSLWQEK+K
Sbjct  119  KELIEGLQEMLISSRVNIGIKRMGEIDEKAFKNACKLRFPPEEADIKTVELCSLWQEKMK  178

Query  438  DPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P+WHPFRV+ +     +  I EDDE LS LK EWG+++  AV  A++E++EYN SG Y 
Sbjct  179  HPDWHPFRVVEDSKGNCQNYIKEDDELLSGLKNEWGDDVYDAVTTALKEMHEYNPSGCYS  238

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWNFKE RKATLKEV+S+IF QLKT KRKR
Sbjct  239  VPELWNFKENRKATLKEVISYIFAQLKTLKRKR  271



>ref|XP_008361182.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
 ref|XP_008361190.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLS++L SGRS+IGI+RMG++D K F N CK+RF+ E+A V+A  LCSLWQ+ + 
Sbjct  483  KELIVGLSEML-SGRSNIGIKRMGDLDQKPFMNTCKERFTLEKAQVQASTLCSLWQDNLT  541

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+VI +++ P++I++E+DE+L  LKEEWG EI   V+ A++E+N+YN SGRYVI
Sbjct  542  NPDWHPFKVITVNEEPKEILDEEDEKLRNLKEEWGNEIHECVVTALKELNDYNPSGRYVI  601

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKEGRKATLKEV+SF+ K +KT KRKR
Sbjct  602  SELWNFKEGRKATLKEVISFVLKSIKTLKRKR  633



>ref|XP_011467028.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011467029.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLS++L  G++HIGI+RMGE+D K F + CK +FS EEA V+A  LCSLWQE +K
Sbjct  489  KELIAGLSEML-VGQAHIGIKRMGELDQKPFLDACKSKFSLEEAQVQAFTLCSLWQENLK  547

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPFRVI    + E++I+E+DE+L KLKEEWG +I   V+ A++E+NEYN SGRYV+
Sbjct  548  DPDWHPFRVIEKEGKAEELIDEEDEKLHKLKEEWGLDIHDCVVTALKEMNEYNPSGRYVV  607

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN KE RKATLKEV++FI K +KTHKRKR
Sbjct  608  PELWNMKEKRKATLKEVIAFILKNIKTHKRKR  639



>gb|KHG15531.1| suppressor of gene silencing 3 [Gossypium arboreum]
Length=633

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LIQGL +LL   R++IG++RMGE+D KAFH+ CK RF ++EA+++A  LCS WQE +K
Sbjct  482  KVLIQGLPELL-GNRTNIGLKRMGELDPKAFHDTCKSRFPSDEAEIQATTLCSSWQENLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+VI     P++I+NE+DE+L+ LK EWGEEI  AV+ A++E+NEYN SGRYVI
Sbjct  541  NPDWHPFKVIVEGGNPKEILNEEDEKLTNLKLEWGEEIYNAVVTALKELNEYNPSGRYVI  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEVV ++ + +KT KRKR
Sbjct  601  SELWNFKENRKATLKEVVGYVVRNIKTAKRKR  632



>gb|KJB56539.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=617

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LIQGL +LL   R++IG++RMGE+D KAFH+ CK RF  +EA+++A  LCS WQE +K
Sbjct  466  KVLIQGLPELL-GNRTNIGLKRMGELDPKAFHDTCKSRFPPDEAEIQATTLCSSWQENLK  524

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+VI     P++I+NE+DE+L+ LK EWGEEI  AV+ A++E+NEYN SGRYVI
Sbjct  525  NPDWHPFKVIVEGGNPKEILNEEDEKLTNLKLEWGEEIYNAVVTALKELNEYNPSGRYVI  584

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEVV ++ + +KT KRKR
Sbjct  585  SELWNFKENRKATLKEVVGYVVRNIKTAKRKR  616



>gb|KJB56538.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56541.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56542.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56543.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56544.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=633

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LIQGL +LL   R++IG++RMGE+D KAFH+ CK RF  +EA+++A  LCS WQE +K
Sbjct  482  KVLIQGLPELL-GNRTNIGLKRMGELDPKAFHDTCKSRFPPDEAEIQATTLCSSWQENLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+VI     P++I+NE+DE+L+ LK EWGEEI  AV+ A++E+NEYN SGRYVI
Sbjct  541  NPDWHPFKVIVEGGNPKEILNEEDEKLTNLKLEWGEEIYNAVVTALKELNEYNPSGRYVI  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEVV ++ + +KT KRKR
Sbjct  601  SELWNFKENRKATLKEVVGYVVRNIKTAKRKR  632



>ref|XP_010678967.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=631

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  436
            +LI  L D+L S R++IGI+RMGEID +AF   CK+RF+ +EA +KA E CSLWQE +KD
Sbjct  481  VLITALLDILQSNRTNIGIKRMGEIDERAFVAECKKRFTVDEALIKASEGCSLWQENLKD  540

Query  435  PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            P WHPFR+I  + + +++INEDDE+L KLKE+WG+E+  AV  A++E+NEYN SGRYVI 
Sbjct  541  PAWHPFRIIEHNGKTDEVINEDDEKLKKLKEQWGDEVYQAVTVALKELNEYNPSGRYVIN  600

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            ELWN+KEGRKAT+KEVV++IFK LKT KRKR
Sbjct  601  ELWNYKEGRKATVKEVVNYIFKNLKTLKRKR  631



>ref|XP_002267381.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
 ref|XP_010656777.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
Length=626

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGE+D K F N CKQRFS EEA+V+A  L SLWQ+ +K P
Sbjct  478  LITGLKDML-SGRTNIGLKRMGELDEKPFLNTCKQRFSLEEANVQAYTLVSLWQDNLKKP  536

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +     +IINE+DE+L KLK+EWG+EI  AV K+++E+NEYN SGRY + E
Sbjct  537  EWHPFKIVEVEGETLEIINEEDEKLQKLKQEWGDEIYMAVTKSLKEINEYNPSGRYTVFE  596

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  597  LWNFKEGRKATLKEVIQYILKNMKTLKRKR  626



>ref|XP_003530299.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006583096.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X2 [Glycine max]
Length=629

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL D+LN+ R+ IG++RMGE+D K F N CK+RF  EEA  K +ELCSLWQE VK
Sbjct  477  KELIKGLDDMLNAPRTKIGLKRMGELDQKVFVNNCKKRFPLEEAGTKGVELCSLWQENVK  536

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V+ + D+ E IINE+DE+L  LK EWG+EI +AV+ A++E+NEYNASG Y +
Sbjct  537  NSAWHPFKVVTVDDKAENIINEEDEKLRSLKHEWGDEIYSAVVTALKEINEYNASGGYTV  596

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFK+ RKATLKEV+++I + +K  KRKR
Sbjct  597  VELWNFKDNRKATLKEVINYIMEHIKPLKRKR  628



>ref|XP_010910789.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=625

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DLLN GR+ IGI+RMGE+D K FHN C++R+  ++AD KA ELC+ WQE++K
Sbjct  475  KELIMGLDDLLN-GRTLIGIKRMGELDEKPFHNACRKRYKADDADTKAAELCTSWQEELK  533

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++++  +   +II+EDDE+L  L  E G+++C AV  A+ E+NEYN SGRYVI
Sbjct  534  QPSWHPYKIVHDDEGAREIIDEDDEKLKNLWIELGDDVCNAVKTALIEINEYNPSGRYVI  593

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKAT+KEV+ +IFKQ K +KRKR
Sbjct  594  PELWNFKEGRKATMKEVIQYIFKQWKNNKRKR  625



>emb|CAN62667.1| hypothetical protein VITISV_028278 [Vitis vinifera]
Length=626

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGE+D K F N CKQRFS EEA+V+A  L SLWQ+ +K P
Sbjct  478  LITGLKDML-SGRTNIGLKRMGELDEKPFLNTCKQRFSLEEANVQAYTLVSLWQDNLKKP  536

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +     +IINE+DE+L KLK+EWG+EI  AV K+++E+NEYN SGRY + E
Sbjct  537  EWHPFKIVEVEGETLEIINEEDEKLQKLKQEWGDEIYMAVTKSLKEINEYNPSGRYTVFE  596

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  597  LWNFKEGRKATLKEVIQYILKNMKTLKRKR  626



>emb|CDO98219.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLS++L  GR+HIG++RMGEID K F   CKQR+  ++ D KALELCSLWQE++K
Sbjct  526  KELISGLSEMLTRGRAHIGVKRMGEIDPKTFEGECKQRYP-DDYDYKALELCSLWQERLK  584

Query  438  DPNWHPFRVINIHDRPEQ-IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+W+PF+++ +     Q I++EDDE+L +L+ EWGE I  A+  A+++++EYN+SGRYV
Sbjct  585  DPDWYPFQIVRVDSENHQKILDEDDEKLRELRSEWGENIYLAITMALKDIDEYNSSGRYV  644

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNFK+ RKATLKEV+ FIFKQLKT KRKR
Sbjct  645  VSELWNFKDDRKATLKEVIGFIFKQLKTLKRKR  677



>gb|KHN04171.1| hypothetical protein glysoja_032667 [Glycine soja]
Length=491

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -1

Query  606  QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  427
            +GL D+LN+ R+ IG++RMGE+D K F N CK+RF  EEA  K +ELCSLWQE VK+  W
Sbjct  343  KGLDDMLNAPRTKIGLKRMGELDQKVFVNNCKKRFPLEEAGTKGVELCSLWQENVKNSAW  402

Query  426  HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  247
            HPF+V+ + D+ E IINE+DE+L  LK EWG+EI +AV+ A++E+NEYNASG Y + ELW
Sbjct  403  HPFKVVTVDDKAENIINEEDEKLRSLKHEWGDEIYSAVVTALKEINEYNASGGYTVVELW  462

Query  246  NFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            NFK+ RKATLKEV+++I + +K  KRKR
Sbjct  463  NFKDNRKATLKEVINYIMEHIKPLKRKR  490



>ref|XP_007023402.1| XH/XS domain-containing protein [Theobroma cacao]
 gb|EOY26024.1| XH/XS domain-containing protein [Theobroma cacao]
Length=633

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LIQGL +LL   R +IG++RMGE+D KAF N CK RFS +EA V+A  LCSLW+E +K
Sbjct  482  KVLIQGLRELL-GARVNIGLKRMGELDEKAFQNTCKLRFSPDEAAVQATTLCSLWEENLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHPF++IN     ++I+NE+DE+L  LK+EWGE I  AV+ A +E+NEYN SGRYVI
Sbjct  541  NPEWHPFKIINEGGNHKEIVNEEDEKLRNLKQEWGEGIYEAVVTAFKELNEYNPSGRYVI  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I K +KT KRKR
Sbjct  601  SELWNFKENRKATLKEVINYIVKNIKTAKRKR  632



>ref|XP_008454609.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Cucumis melo]
Length=632

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + 
Sbjct  480  KELISGLQDQSSNARVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLT  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+V+ I    ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +
Sbjct  540  DPNWHPFKVVTIDGDSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSV  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEV+++I K +K+ KRKR
Sbjct  600  PELWNFKEDRKATLKEVINYIVKSIKSLKRKR  631



>ref|XP_008461480.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
 ref|XP_008461481.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
Length=632

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + 
Sbjct  480  KELISGLQDQSSNARVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLT  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+V+ I    ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +
Sbjct  540  DPNWHPFKVVTIDGDSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSV  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEV+++I K +K+ KRKR
Sbjct  600  PELWNFKEDRKATLKEVINYIVKSIKSLKRKR  631



>ref|XP_008454606.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
 ref|XP_008454607.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
Length=633

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + 
Sbjct  481  KELISGLQDQSSNARVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLT  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+V+ I    ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +
Sbjct  541  DPNWHPFKVVTIDGDSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSV  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEV+++I K +K+ KRKR
Sbjct  601  PELWNFKEDRKATLKEVINYIVKSIKSLKRKR  632



>gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Erythranthe guttata]
Length=634

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL ++L S R +IGI+RMGEID KAF N CK RF  EEAD+K +ELCSLWQEK+K
Sbjct  481  KELIEGLQEMLISSRVNIGIKRMGEIDEKAFKNACKLRFPPEEADIKTVELCSLWQEKMK  540

Query  438  DPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P+WHPFRV+ +     +  I EDDE LS LK EWG+++  AV  A++E++EYN SG Y 
Sbjct  541  HPDWHPFRVVEDSKGNCQNYIKEDDELLSGLKNEWGDDVYDAVTTALKEMHEYNPSGCYS  600

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWNFKE RKATLKEV+S+IF QLKT KRKR
Sbjct  601  VPELWNFKENRKATLKEVISYIFAQLKTLKRKR  633



>ref|XP_010232023.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=600

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D + +GR++IGI+RMG++D K+F   CK +FS E+A+V A  LCS WQE++K
Sbjct  444  KKLIDGLRDTI-TGRTNIGIKRMGDLDLKSFAIACKSKFSKEDAEVSASILCSKWQEEIK  502

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+  + + ++I+ EDDE+L KLKEE+GEE+ A VIKA+ EVNEYN SGRY +
Sbjct  503  NPDWHPFRVVMENGKEKEILREDDEKLQKLKEEYGEEVYALVIKALLEVNEYNPSGRYAV  562

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKEVV +I KQ +THKRKR
Sbjct  563  PELWNYKEGRKATLKEVVQYILKQWRTHKRKR  594



>gb|AES86419.2| XH/XS domain protein [Medicago truncatula]
Length=626

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL+++L   +++IG +RMG++D K F N CK+RFS++EA +KA+ELCSLWQE VK
Sbjct  473  KELIEGLNEMLTGAKTNIGTKRMGDLDQKVFVNACKKRFSSDEAGIKAVELCSLWQENVK  532

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V++ +D P  +I+E+DE+L KLK+EWG+EI +AV+ A++EVNEYN SG Y +
Sbjct  533  NSAWHPFKVVSQNDNPVSVIDEEDEKLQKLKKEWGDEIYSAVVTALKEVNEYNPSGGYTV  592

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I   +K  KRKR
Sbjct  593  WELWNFKENRKATLKEVITYIVDHMKQLKRKR  624



>emb|CAN83544.1| hypothetical protein VITISV_021077 [Vitis vinifera]
Length=633

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGEI+ K F N  KQRFS EEA+V+A  L SLWQE +K P
Sbjct  485  LITGLKDML-SGRTNIGLKRMGEIEEKPFVNTYKQRFSPEEANVQAYTLVSLWQENLKKP  543

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +  +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + E
Sbjct  544  EWHPFKIVEVEGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIE  603

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K LKT KRKR
Sbjct  604  LWNFKEGRKATLKEVIQYILKNLKTLKRKR  633



>ref|XP_002527307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35059.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 120/156 (77%), Gaps = 4/156 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSG-RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKV  442
            K LI GL D+L+S  R++IGI+RMGEID K F N CKQ+F  EEA V+A  LCSLWQE +
Sbjct  482  KELIAGLGDMLSSVVRTNIGIKRMGEIDQKPFLNTCKQKFPLEEAQVQATTLCSLWQENL  541

Query  441  KDPNWHPFRVI---NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
            KD +W PF+++    +  +  +I++E+DE+L  LK EWG+EI  AV+ A++E+NEYNASG
Sbjct  542  KDSSWQPFKIVPDAEVEGKVNEIVDEEDEKLQNLKLEWGDEIYNAVVTALKEINEYNASG  601

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            RY+ PELWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  602  RYITPELWNFKEGRKATLKEVIGYIVKNIKTLKRKR  637



>ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago truncatula]
Length=657

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL+++L   +++IG +RMG++D K F N CK+RFS++EA +KA+ELCSLWQE VK
Sbjct  504  KELIEGLNEMLTGAKTNIGTKRMGDLDQKVFVNACKKRFSSDEAGIKAVELCSLWQENVK  563

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V++ +D P  +I+E+DE+L KLK+EWG+EI +AV+ A++EVNEYN SG Y +
Sbjct  564  NSAWHPFKVVSQNDNPVSVIDEEDEKLQKLKKEWGDEIYSAVVTALKEVNEYNPSGGYTV  623

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I   +K  KRKR
Sbjct  624  WELWNFKENRKATLKEVITYIVDHMKQLKRKR  655



>ref|XP_007135809.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07803.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=629

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL D+LN  RS+IG++RMGE+D   F   CK+RFS EE   K +ELCSLWQE VK
Sbjct  477  KELIKGLEDMLNGPRSNIGLKRMGELDQNVFVAKCKERFSPEEYGTKGVELCSLWQENVK  536

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V+ + + PE  I+E+D++L  LK+EWG+EI +AV+ A+ E+NEYNASG Y +
Sbjct  537  NSAWHPFKVVVVDNNPENSIDENDDKLRSLKQEWGDEIYSAVVTALTEINEYNASGGYTV  596

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I  ++K +KRKR
Sbjct  597  VELWNFKEKRKATLKEVITYIMDRIKPNKRKR  628



>ref|XP_007135808.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07802.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=640

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL D+LN  RS+IG++RMGE+D   F   CK+RFS EE   K +ELCSLWQE VK
Sbjct  488  KELIKGLEDMLNGPRSNIGLKRMGELDQNVFVAKCKERFSPEEYGTKGVELCSLWQENVK  547

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+V+ + + PE  I+E+D++L  LK+EWG+EI +AV+ A+ E+NEYNASG Y +
Sbjct  548  NSAWHPFKVVVVDNNPENSIDENDDKLRSLKQEWGDEIYSAVVTALTEINEYNASGGYTV  607

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV+++I  ++K +KRKR
Sbjct  608  VELWNFKEKRKATLKEVITYIMDRIKPNKRKR  639



>emb|CBI40115.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P
Sbjct  431  LITGLKDML-SGRTNIGLKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKP  489

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +  +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + E
Sbjct  490  EWHPFKIVEVEGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIE  549

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K LKT KRKR
Sbjct  550  LWNFKEGRKATLKEVIQYILKNLKTLKRKR  579



>ref|XP_010937610.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=631

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+GL ++L   +S IGI+RMGE+D KAF + CK++F+ ++AD+KA   CS WQE +KDP
Sbjct  483  LIRGLKEILGK-KSDIGIKRMGELDDKAFQSACKRKFAEDDADIKAAVFCSEWQEYLKDP  541

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            NWHP++++ I  + +++INEDDE+L  L E   EE   AV  A+ E+NEYN SGRYVIPE
Sbjct  542  NWHPYKIVTIDGKTQEVINEDDEKLLALMELLDEEAYEAVTTALLEINEYNPSGRYVIPE  601

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+KEGRKATLKEVV F+  + KTHKRKR
Sbjct  602  LWNYKEGRKATLKEVVQFVLNKWKTHKRKR  631



>ref|XP_010537880.1| PREDICTED: factor of DNA methylation 1-like [Tarenaya hassleriana]
Length=633

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +LL +G ++IG++RMGEID K F  VCKQRF  EEA ++A  LCS WQE +K
Sbjct  482  KALIAGLPELLGNG-TNIGVKRMGEIDDKPFQVVCKQRFPPEEAVIQAATLCSQWQENLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF++     +  ++ +E+DE+L KLKEEWGEE+  AV  A+EE+NEYN SGRYV+
Sbjct  541  DPAWHPFKITTYGGKATEVADEEDEKLKKLKEEWGEEVQNAVKTALEELNEYNGSGRYVV  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
            PELWNFKEGRKATLKEV+++I   +K  KRKR+
Sbjct  601  PELWNFKEGRKATLKEVIAYIANSIKNLKRKRN  633



>ref|XP_002267670.1| PREDICTED: factor of DNA methylation 1 isoform X2 [Vitis vinifera]
Length=633

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P
Sbjct  485  LITGLKDML-SGRTNIGLKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKP  543

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +  +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + E
Sbjct  544  EWHPFKIVEVEGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIE  603

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K LKT KRKR
Sbjct  604  LWNFKEGRKATLKEVIQYILKNLKTLKRKR  633



>ref|XP_004139640.1| PREDICTED: uncharacterized protein LOC101205093 [Cucumis sativus]
 ref|XP_004168328.1| PREDICTED: uncharacterized LOC101205093 [Cucumis sativus]
Length=632

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R +IGI+RMG+ID K F N CK +FS +EA V+A  LCSLWQ+ + 
Sbjct  480  KELISGLQDQSSNARVNIGIKRMGDIDIKPFQNTCKHKFSPDEAMVQASTLCSLWQDNLT  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+V+ I    ++ I+EDDE+L  LK+EWG EI  AV+ A++E+NEYN SGRY +
Sbjct  540  DPNWHPFKVVTIDGDSQENIDEDDEKLKGLKQEWGGEIYNAVVTALKEMNEYNPSGRYSV  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEV+++I K +K+ KRKR
Sbjct  600  PELWNFKEDRKATLKEVINYIVKSIKSLKRKR  631



>dbj|BAD52538.1| putative transcription factor X1 [Oryza sativa Japonica Group]
Length=346

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LI+G  D++  GR++IGI+RMG ID KAF N  KQR   E+ADV A ELCSLW+ ++K
Sbjct  196  KVLIEGFQDII-VGRTNIGIKRMGVIDFKAFTNAYKQRSLEEDADVSAAELCSLWENEIK  254

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            + +WHPFRV+ +  +  +I++EDD +L +LKEE GEEICA V KA+ E+NEYN SGRY +
Sbjct  255  NSDWHPFRVVMVDGKEMEILSEDDGKLCELKEEHGEEICAMVTKALLELNEYNPSGRYPV  314

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEVV ++  Q K +KRKR
Sbjct  315  PELWNFKENRKATLKEVVQYVLNQWKKNKRKR  346



>ref|XP_009387522.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387523.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL DLL SGR+ IGI+RMGE+D KAF N C++++  EEAD+KA ELCS WQE++K
Sbjct  491  KELIKGLEDLL-SGRTLIGIKRMGELDEKAFQNACRKKYKAEEADIKAAELCSSWQEELK  549

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPF+++    + +++I+EDD  L KL  E G+++C AV  A+ E+N+YN SGRYVI
Sbjct  550  KPAWHPFKIVTSDGKEQEVIDEDDTNLKKLWIELGDDVCNAVKTALVELNDYNPSGRYVI  609

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKAT+KEV+  I KQ ++ KRKR
Sbjct  610  PELWNFKERRKATMKEVIVAILKQWRSQKRKR  641



>ref|XP_010656778.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
 ref|XP_010656779.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
Length=657

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL D+L SGR++IG++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P
Sbjct  509  LITGLKDML-SGRTNIGLKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKP  567

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+++ +  +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + E
Sbjct  568  EWHPFKIVEVEGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIE  627

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K LKT KRKR
Sbjct  628  LWNFKEGRKATLKEVIQYILKNLKTLKRKR  657



>ref|XP_008784591.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
 ref|XP_008784593.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
Length=625

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DLL S R+ IGI+RMGE+D K F N C++R+  E+AD KA ELCS WQE++K
Sbjct  475  KELIMGLDDLL-SARALIGIKRMGELDEKPFQNACRKRYKAEDADTKAAELCSSWQEELK  533

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP++++N  +   +II+EDDE+L  L  E G+++  AV  A+ E+N+YN SGRYVI
Sbjct  534  IPSWHPYKIVNDDEGAREIIDEDDEKLKNLWIELGDDVYNAVKIALMEINDYNPSGRYVI  593

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKAT+KEV+ +IFKQ K +KRKR
Sbjct  594  PELWNFKEGRKATMKEVIQYIFKQWKNNKRKR  625



>ref|NP_001041898.1| Os01g0126600 [Oryza sativa Japonica Group]
 dbj|BAF03812.1| Os01g0126600, partial [Oryza sativa Japonica Group]
Length=403

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LI+G  D++  GR++IGI+RMG ID KAF N  KQR   E+ADV A ELCSLW+ ++K
Sbjct  253  KVLIEGFQDII-VGRTNIGIKRMGVIDFKAFTNAYKQRSLEEDADVSAAELCSLWENEIK  311

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            + +WHPFRV+ +  +  +I++EDD +L +LKEE GEEICA V KA+ E+NEYN SGRY +
Sbjct  312  NSDWHPFRVVMVDGKEMEILSEDDGKLCELKEEHGEEICAMVTKALLELNEYNPSGRYPV  371

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEVV ++  Q K +KRKR
Sbjct  372  PELWNFKENRKATLKEVVQYVLNQWKKNKRKR  403



>ref|XP_010256908.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256909.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256910.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
Length=642

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSH---IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            K LI+GL DL ++ +     IGI+RMG++D K F    K+++S EEA  KA++LCSLW+E
Sbjct  488  KQLIEGLKDLTSNRKPSNCLIGIKRMGDLDSKPFFEAVKRKYSEEEAQEKAVDLCSLWEE  547

Query  447  KVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  268
             +KDP WHPF+++ I+ + E+IINEDDE+L  LK EWGEE+C AV+ A+ E+NEYN SGR
Sbjct  548  YLKDPLWHPFKMVMINGKDEEIINEDDEKLKSLKNEWGEEVCKAVVTALMEINEYNPSGR  607

Query  267  YVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            Y I ELWN KEGRKATLKE +++I KQ K HKRK+
Sbjct  608  YTISELWNLKEGRKATLKEGIAYILKQWKQHKRKK  642



>ref|XP_006645454.1| PREDICTED: centrosomal protein of 128 kDa-like [Oryza brachyantha]
Length=570

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G  ++   GR++IGI+RMGE+D KAF N CKQRFS  + D  A+ LCS W++++K
Sbjct  418  KELIDGFKEI-TVGRTNIGIKRMGELDLKAFANACKQRFSKGDVDETAVMLCSQWEDEIK  476

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ I  +  +I++EDDE+L +LKEE GE I A V +A++E+NEYN SGRY +
Sbjct  477  NPDWHPFRVVMIKGKETEIVSEDDEKLRELKEEHGETIYALVTQALKELNEYNPSGRYPV  536

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGR+ATLKEVV ++ KQ +THKRKR
Sbjct  537  PELWNFKEGRRATLKEVVQYVLKQWRTHKRKR  568



>ref|XP_004499526.1| PREDICTED: uncharacterized protein LOC101512210 [Cicer arietinum]
Length=200

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL+++L   +++IG +RMG++D K F   CK+RF  EEA +K +ELCSLWQE VK
Sbjct  49   KELIEGLNEMLTGPKTNIGTKRMGDLDQKVFVTACKKRFPLEEAGIKGVELCSLWQENVK  108

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+VI + DR E +       +     EWG+EI +AV+ AV+EVNEYN SG Y I
Sbjct  109  NSAWHPFKVIRVDDRHE-VCTIKTYFVFLSDVEWGDEIYSAVVTAVKEVNEYNPSGGYTI  167

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KE RKATLKEV+++I + +K  K KR
Sbjct  168  WELWNYKEKRKATLKEVINYIVEHMKQLKHKR  199



>ref|XP_008228782.1| PREDICTED: interaptin-like [Prunus mume]
 ref|XP_008228783.1| PREDICTED: interaptin-like [Prunus mume]
Length=635

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL  +L+  RSHI I+RMG++D K F+NVCK+RFS EEA V+A  LCSLWQ+ + 
Sbjct  484  KELIAGLRGMLDV-RSHIQIKRMGDLDYKPFYNVCKERFSDEEAQVQASTLCSLWQDNLT  542

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
              +WHPF++I +    ++IINE+DE+L  LKEEWG EI   V+ A++E+NEYN SGRY +
Sbjct  543  KTDWHPFKIITVDGNAQEIINEEDEKLRNLKEEWGHEIYECVVTALKELNEYNPSGRYAV  602

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KEGRKATLKEV+S+I  ++KT KRKR
Sbjct  603  SELWNVKEGRKATLKEVISYILSKIKTLKRKR  634



>ref|XP_011073344.1| PREDICTED: factor of DNA methylation 1 [Sesamum indicum]
Length=635

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+ L D+L+S R +IGI+RMGEID KAF N CK+RF   EA++KA E+ SLWQEK+K
Sbjct  482  KELIEALKDMLSSSRVNIGIKRMGEIDEKAFKNACKERFPPGEAEMKAAEVVSLWQEKLK  541

Query  438  DPNWHPFRVINIHDRPEQ-IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            +P WHPF++I       Q +I EDDE L  LKEEWG+ +  AV  A++E++EYN SG YV
Sbjct  542  NPEWHPFQIIEDEKGNHQSLIKEDDELLQGLKEEWGDAVYDAVTVALKELHEYNPSGCYV  601

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWNFKE RKATLKEV+++IF QLKT KRKR
Sbjct  602  VPELWNFKENRKATLKEVIAYIFAQLKTLKRKR  634



>ref|XP_008799862.1| PREDICTED: MAR-binding filament-like protein 1 [Phoenix dactylifera]
Length=632

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+GL ++L   +  IGI+RMGE+DGKAF + CK++F+ ++AD+KA E CS WQE +KDP
Sbjct  484  LIKGLKEILGK-KFDIGIKRMGELDGKAFQSACKRKFAEDDADIKAAEFCSEWQEYLKDP  542

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            NWHP++++ I  + +++INEDDE+L  LKE  G E   AV  A+ E+NEYN SGRY IPE
Sbjct  543  NWHPYKIVTIDGKSKEVINEDDEKLIVLKELLGNEAYEAVTTALLEINEYNPSGRYAIPE  602

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+ EGRKATLKEVV ++  + KT KRKR
Sbjct  603  LWNYIEGRKATLKEVVQYVLNKWKTQKRKR  632



>ref|XP_010063555.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063556.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063557.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063558.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063559.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 gb|KCW70793.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
 gb|KCW70794.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
Length=633

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LIQGLS++L +  + IGIRRMGE+D K F   CK+RFS +EA ++A +LCSLWQ +V 
Sbjct  483  KELIQGLSEVLGAS-ADIGIRRMGELDDKPFLTACKKRFSAQEAPMQASKLCSLWQSQV-  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPFR I I  + + ++ E+D++L KLKEEWG+E+C+AV+ A++E+NEYN SG YV+
Sbjct  541  NSQWHPFRTIEIDGKAQAMLVEEDDKLQKLKEEWGDEVCSAVVTALKELNEYNPSGMYVV  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RKATLKEV++FI K++KT KRKR
Sbjct  601  SELWNFKEKRKATLKEVIAFIAKKIKTPKRKR  632



>ref|XP_010497500.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
 ref|XP_010497504.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
Length=636

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL  LL +  + IG++RMGE+D K F NVCK R+S  EA V+A  LCS WQE +K
Sbjct  485  KKLITGLIGLLGA-ETDIGVKRMGEVDEKPFLNVCKLRYSANEATVEAATLCSTWQENLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+ +    R +++++E+DE+L KLK EWGE +  AV  A+EE+NEYNASGRY  
Sbjct  544  NPSWHPFKRVGSGGRVKEVVDEEDEQLKKLKREWGEAVHNAVKTALEEMNEYNASGRYAT  603

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV+SFI + +KT KRKR
Sbjct  604  PELWNFKEGRKATLKEVISFISENIKTLKRKR  635



>ref|XP_003566895.1| PREDICTED: factor of DNA methylation 1 [Brachypodium distachyon]
Length=599

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D++ +GR++IGI+RMGE+D K+F   CK + S ++A+V A  LCS W+ ++K
Sbjct  449  KKLIDGLLDII-TGRANIGIKRMGELDLKSFTVACKHKLSKQDAEVTAAILCSKWEAEIK  507

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHPFRV+ +  + ++I+ EDDE+L +LKEE+GEE+ A V  A+ EVNEYN SGRY +
Sbjct  508  NPEWHPFRVVMVDGKEKEILREDDEKLRELKEEYGEEVHALVTNALREVNEYNPSGRYAV  567

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKEV+ +I KQ +THKRKR
Sbjct  568  PELWNYKEGRKATLKEVIQYILKQWRTHKRKR  599



>ref|XP_002303841.1| XH domain-containing family protein [Populus trichocarpa]
 gb|EEE78820.1| XH domain-containing family protein [Populus trichocarpa]
Length=626

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L   R+ IG++RMGEID K FHN CK+RF  E+  + A   CSLWQEK+K
Sbjct  475  KNLIVGLGDML-GARTLIGLKRMGEIDEKPFHNACKERFP-EDPLLHASTQCSLWQEKLK  532

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHPF+VI++    +QI+NE+DEEL  LK+EWG+EI  AV+ A+ E+ EYN SGRYV+
Sbjct  533  NPAWHPFKVIDVDGNAKQILNEEDEELRNLKKEWGDEIYTAVVTALNELEEYNPSGRYVV  592

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKEGRKATLKEV+++I K + T KRK+
Sbjct  593  SELWNFKEGRKATLKEVIAYIVKNINTLKRKK  624



>ref|XP_006465197.1| PREDICTED: myosin-10-like [Citrus sinensis]
 gb|KDO42996.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQGLSDL+ + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K  
Sbjct  484  LIQGLSDLIGA-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKAT  542

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF++I++   P++II+ +++E  K  +E G+EI  AV  A++E+NEYN SGRYVIP+
Sbjct  543  EWHPFKIIHVEGTPKEIID-EEDEKIKSLKELGDEIYMAVTTALKELNEYNPSGRYVIPD  601

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+S+I   ++  KRKR
Sbjct  602  LWNFKEGRKATLKEVISYIVGNIRRLKRKR  631



>gb|KDO42995.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQGLSDL+ + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K  
Sbjct  484  LIQGLSDLIGA-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKAT  542

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF++I++   P++II+ +++E  K  +E G+EI  AV  A++E+NEYN SGRYVIP+
Sbjct  543  EWHPFKIIHVEGTPKEIID-EEDEKIKSLKELGDEIYMAVTTALKELNEYNPSGRYVIPD  601

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+S+I   ++  KRKR
Sbjct  602  LWNFKEGRKATLKEVISYIVGNIRRLKRKR  631



>ref|XP_006427593.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 ref|XP_006427594.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40833.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40834.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
Length=634

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQGLSDL+ + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K  
Sbjct  484  LIQGLSDLIGA-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKAT  542

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF++I++   P++II+ +++E  K  +E G+EI  AV  A++E+NEYN SGRYVIP+
Sbjct  543  EWHPFKIIHVEGTPKEIID-EEDEKIKSLKELGDEIYMAVTTALKELNEYNPSGRYVIPD  601

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+S+I   ++  KRKR
Sbjct  602  LWNFKEGRKATLKEVISYIVGNIRRLKRKR  631



>dbj|BAB21190.1| putative transcription factor [Oryza sativa Japonica Group]
 gb|EEC69862.1| hypothetical protein OsI_00219 [Oryza sativa Indica Group]
 gb|EEE53794.1| hypothetical protein OsJ_00215 [Oryza sativa Japonica Group]
Length=560

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LI+G  D++  GR++IGI+RMG ID KAF N  KQR   E+ADV A ELCSLW+ ++K
Sbjct  410  KVLIEGFQDII-VGRTNIGIKRMGVIDFKAFTNAYKQRSLEEDADVSAAELCSLWENEIK  468

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            + +WHPFRV+ +  +  +I++EDD +L +LKEE GEEICA V KA+ E+NEYN SGRY +
Sbjct  469  NSDWHPFRVVMVDGKEMEILSEDDGKLCELKEEHGEEICAMVTKALLELNEYNPSGRYPV  528

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKEVV ++  Q K +KRKR
Sbjct  529  PELWNFKENRKATLKEVVQYVLNQWKKNKRKR  560



>ref|XP_010476691.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=636

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL+ LL +  + IG++RMGE+D K F NVCK R+S  EA V+A  LCS WQE +K
Sbjct  485  KKLIKGLTGLLGA-ETDIGVKRMGELDEKPFLNVCKLRYSANEATVEAATLCSTWQENLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W PF+ +    R +++++E+DE+L KLK EWGE +  AV  A+EE+NEYNASGRY  
Sbjct  544  NPSWLPFKRVGSGGRVKEVVDEEDEQLKKLKREWGEAVHNAVKTALEEMNEYNASGRYAT  603

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV+SFI + +KT KRKR
Sbjct  604  PELWNFKEGRKATLKEVISFISENIKTLKRKR  635



>ref|XP_008802711.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
 ref|XP_008802712.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
Length=631

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++L S R+ IGI+RMGE+D   F   C QRFS +EA V A  LCS WQ++++
Sbjct  481  KELISGLKEML-STRTSIGIKRMGELDETPFKIACNQRFSKDEAAVNAAMLCSKWQDELR  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPF+V  +  +P+++I EDDE+L  LKEE G+E+   V  A+ E+NEYN SGRYVI
Sbjct  540  KPEWHPFKVTIVDGKPQEVIQEDDEKLQALKEELGDEVYKVVTTALLEMNEYNPSGRYVI  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATL EVV +I +Q KTHKRKR
Sbjct  600  PELWNFKEGRKATLTEVVRYIMRQWKTHKRKR  631



>ref|XP_009149026.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
 ref|XP_009149027.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
Length=636

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+ LL +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS WQE +K
Sbjct  485  KKLIAGLTGLLGA-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCSTWQENLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D +W PFR     D+ +++++EDDE+L KLK EWGEE+  AV  A+EE+NEYNASGRY  
Sbjct  544  DSSWQPFRREGTGDKAKEVVDEDDEQLKKLKGEWGEEVHNAVKTALEEMNEYNASGRYTT  603

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  604  SELWNFKVGRKATLKEVINFISNDIKTVKRKR  635



>ref|XP_006659121.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Oryza brachyantha]
Length=626

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLSDLL   RS+IGI+RMGE+D + F   CKQR+  +EA +KA ++CS WQE +K
Sbjct  476  KELISGLSDLLGP-RSNIGIKRMGELDERPFLTACKQRYGADEAVMKAAQICSKWQENLK  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D NWHPF+++ I  + EQIINEDDE+L  LKEE G+E+ +AVI A+ E+NEYNASG YV+
Sbjct  535  DANWHPFKIVTIGGKTEQIINEDDEKLVGLKEELGDEVHSAVITALLEINEYNASGSYVV  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE RKA+++E +  + KQ K H+RKR
Sbjct  595  SELWNNKENRKASMQEALQHVLKQWKLHRRKR  626



>ref|XP_002890136.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66395.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=635

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LIQGL+ LL +  + IG++RMGE++ K F +VCK R+S  +A V+A  LCS WQE +K
Sbjct  484  KKLIQGLTGLLGA-ETDIGVKRMGELNEKPFLDVCKLRYSANDATVEAATLCSTWQENLK  542

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W PF+     DR +++++EDDE+L KLK EWGEE+  AV  A+ E+NEYNASGRY  
Sbjct  543  NPSWQPFKREGTGDRAKEMVDEDDEQLKKLKGEWGEEVHNAVKTALGEMNEYNASGRYTT  602

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV++FI  ++K+ KRKR
Sbjct  603  PELWNFKEGRKATLKEVITFISTEIKSLKRKR  634



>ref|XP_007214938.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
 gb|EMJ16137.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
Length=635

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL  +L+  RS I I+RMG++D K F+NVCK+RFS EEA V+A  LCSLWQ+ + 
Sbjct  484  KELIAGLRGMLDV-RSLIQIKRMGDLDYKPFYNVCKERFSDEEAQVQASTLCSLWQDNLT  542

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
              +WHPF++I +    ++IINE+DE+L  LKEEWG EI   V+ A++E+NEYN SGRY +
Sbjct  543  KTDWHPFKIITVDGNAQEIINEEDEKLWNLKEEWGHEIYECVVTALKELNEYNPSGRYAV  602

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KEGRKATLKEV+S+I  ++KT KRKR
Sbjct  603  SELWNVKEGRKATLKEVISYILSKIKTLKRKR  634



>ref|XP_010931277.1| PREDICTED: factor of DNA methylation 5-like isoform X2 [Elaeis 
guineensis]
Length=276

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G  D  +S RS IG++R+GE++ K F + C+QRF  EE DVK+ ELCSLWQ  + 
Sbjct  117  KELITGFKDFFSS-RSLIGVKRLGELNDKPFQDACRQRFPNEEPDVKSAELCSLWQCHIT  175

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  W+PFRV  I  + +  +NE DE+L  LK EWGEEI  AV  ++ E+NE+N SGRY++
Sbjct  176  NSEWYPFRVTTIEGKAQDTLNESDEKLQALKSEWGEEIYKAVATSLMELNEHNPSGRYIV  235

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHK  172
            PELWNFKEGR ATLKE + ++FKQ+++ K
Sbjct  236  PELWNFKEGRIATLKEAIQYLFKQIRSLK  264



>ref|XP_003610367.1| hypothetical protein MTR_4g131350 [Medicago truncatula]
 gb|AES92564.1| XH/XS domain protein [Medicago truncatula]
Length=682

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNS-GRSHIGIRRMGEIDGKAFHNVCKQRF-STEEADVKALELCSLWQEK  445
            K LI+GL+++L    +++IG +RMG++D K F  VCK+RF S EEA +KA+ELCS+WQE 
Sbjct  528  KELIKGLNEMLTGINKTNIGTKRMGDLDEKVFVQVCKKRFVSQEEAGMKAMELCSVWQEN  587

Query  444  VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            VK+  WHPF+V+ ++D  E +INE+DE+L KLK+EWG+EI +AV  A++EVNEYN SG Y
Sbjct  588  VKNSAWHPFKVVRVNDTHESVINEEDEKLKKLKQEWGDEIYSAVETALKEVNEYNPSGGY  647

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             + ELWNFKE RKATLKEV+++I + +K  KRKR
Sbjct  648  SVHELWNFKEQRKATLKEVITYIVEHMKQLKRKR  681



>ref|XP_002457444.1| hypothetical protein SORBIDRAFT_03g007450 [Sorghum bicolor]
 gb|EES02564.1| hypothetical protein SORBIDRAFT_03g007450 [Sorghum bicolor]
Length=261

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G ++L  +GR++IGI+RMGE+D K F   C++R   E+A V +  LCS W+E+++
Sbjct  110  KELIHGFNELAVAGRANIGIKRMGELDLKVFGIACRKRLPKEDAAVTSALLCSKWEEEIR  169

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +PNW+PF+V  +  +  +++ EDD  L +LK+E GEEI   V KA+ E+NEYN SGRY +
Sbjct  170  NPNWYPFKVKVVDGKEMEVLKEDDAMLQELKQEHGEEIYGLVTKALLEINEYNPSGRYPV  229

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKE V  + KQ KTHKRKR
Sbjct  230  PELWNYKEGRKATLKEAVQHVMKQWKTHKRKR  261



>ref|XP_010931274.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010931275.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Elaeis 
guineensis]
Length=327

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G  D  +S RS IG++R+GE++ K F + C+QRF  EE DVK+ ELCSLWQ  + 
Sbjct  168  KELITGFKDFFSS-RSLIGVKRLGELNDKPFQDACRQRFPNEEPDVKSAELCSLWQCHIT  226

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  W+PFRV  I  + +  +NE DE+L  LK EWGEEI  AV  ++ E+NE+N SGRY++
Sbjct  227  NSEWYPFRVTTIEGKAQDTLNESDEKLQALKSEWGEEIYKAVATSLMELNEHNPSGRYIV  286

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHK  172
            PELWNFKEGR ATLKE + ++FKQ+++ K
Sbjct  287  PELWNFKEGRIATLKEAIQYLFKQIRSLK  315



>ref|XP_006306990.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 ref|XP_006306991.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39888.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39889.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
Length=633

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI  L+ LL +  + IG++RMGE+D K F NVCK+R+S  EA V+A  LCS WQE +K
Sbjct  482  KKLIAVLTVLLGA-ETEIGVKRMGELDEKPFLNVCKRRYSANEATVEAATLCSTWQENLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W PF+     D+ +++++E+DE+L KL+ EWGEE+  AV  A+EE+NEYNASGRY  
Sbjct  541  NPSWLPFKREGTGDKVKEVVDEEDEQLKKLRREWGEEVHNAVKTALEEMNEYNASGRYTT  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV+ FI   +KT KRKR
Sbjct  601  PELWNFKEGRKATLKEVICFISDNIKTLKRKR  632



>ref|XP_004968083.1| PREDICTED: synaptonemal complex protein 1-like [Setaria italica]
Length=631

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G  +L + GR +IGI+RMGE+D KAF N C++R S ++A+V +  LCS W+++++
Sbjct  481  KELIAGFKEL-SVGRINIGIKRMGELDPKAFGNACRKRLSKDDAEVTSAILCSKWEDEIR  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +PNWHPF+V+ I  +  ++++E+DE LSKLKEE GEEI   V KA+ E+NEYN SGRY +
Sbjct  540  NPNWHPFKVVLIDGKETEVLSEEDENLSKLKEEHGEEIYVLVTKALVEINEYNPSGRYPV  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKE V  + KQ +THKRKR
Sbjct  600  PELWNFKEGRKATLKEAVQHVMKQWRTHKRKR  631



>ref|XP_009416142.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416143.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416144.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416145.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416146.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
Length=630

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LIQGL DLL S RS I I+RMGE+D   F   CKQRFS +EA++KA E CS WQ ++K
Sbjct  480  KALIQGLGDLLGS-RSLIAIKRMGELDDGPFLPACKQRFSKDEAEIKAAEYCSHWQHELK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPF++++   +P++ I EDDE+L  LKEE G+ +  AV  A+ E+NEYN SGRY I
Sbjct  539  KPEWHPFKIVDTDGKPQEFIKEDDEKLRALKEELGDAVYKAVTTALLEMNEYNPSGRYPI  598

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN K  RKATL EV+++I KQ KT+KRKR
Sbjct  599  PELWNSKAERKATLTEVINYILKQWKTYKRKR  630



>ref|XP_010429907.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=220

 Score =   154 bits (390),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL+DL +  RS I ++RMGE+D KAF   CK RF+ E+A+V+   LCS WQE ++DP
Sbjct  69   LISGLTDL-SDKRSTIRVKRMGELDEKAFVKACKGRFTDEKAEVEQYFLCSTWQEYIRDP  127

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+ +   +   ++++EDD +L  LKEEWGEE+  AV KAVEE+NE+N SGRY++PE
Sbjct  128  AWHPFKRVGTGENITEVVDEDDAKLKNLKEEWGEEVKNAVKKAVEEINEFNPSGRYLVPE  187

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWNF + RKATLKE ++ +   +KTHKRK
Sbjct  188  LWNFNQKRKATLKEGIAQLMTLIKTHKRK  216



>ref|NP_001042014.1| Os01g0147700 [Oryza sativa Japonica Group]
 dbj|BAD61126.1| putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAD61269.1| putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAF03928.1| Os01g0147700 [Oryza sativa Japonica Group]
Length=700

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L +GR+ IGI+RMGE+D K F N CK+++  ++ + KA EL S WQE++K
Sbjct  548  KELIMGLEDML-TGRTAIGIKRMGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIK  606

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++I +    ++++++DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+
Sbjct  607  KPSWHPYKIITVDGEDKEVVDDDDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVV  666

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ +IF Q++T  ++R
Sbjct  667  PELWNFRKGRKATMKEVLKYIFGQIETTSKRR  698



>gb|EAZ10533.1| hypothetical protein OsJ_00365 [Oryza sativa Japonica Group]
Length=701

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L +GR+ IGI+RMGE+D K F N CK+++  ++ + KA EL S WQE++K
Sbjct  549  KELIMGLEDML-TGRTAIGIKRMGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIK  607

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++I +    ++++++DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+
Sbjct  608  KPSWHPYKIITVDGEDKEVVDDDDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVV  667

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ +IF Q++T  ++R
Sbjct  668  PELWNFRKGRKATMKEVLKYIFGQIETTSKRR  699



>gb|EAY72526.1| hypothetical protein OsI_00387 [Oryza sativa Indica Group]
Length=700

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L +GR+ IGI+RMGE+D K F N CK+++  ++ + KA EL S WQE++K
Sbjct  548  KELIMGLEDML-TGRTAIGIKRMGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIK  606

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++I +    ++++++DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+
Sbjct  607  KPSWHPYKIITVDGEDKEVVDDDDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVV  666

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ +IF Q++T  ++R
Sbjct  667  PELWNFRKGRKATMKEVLKYIFGQIETTSKRR  698



>emb|CDM83432.1| unnamed protein product [Triticum aestivum]
Length=528

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL   + +GR++IGI+RMGE+D K+   VC ++FS E+A+V A  LCS W+  ++
Sbjct  378  KKLIDGLQ-TITTGRANIGIKRMGELDLKSLAIVCGRKFSKEDAEVTAAILCSKWEADIR  436

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPFRV+ ++ + +++I+EDD +L  L+EE+GEE+ + V KA+ EVNEYN  GRY +
Sbjct  437  KPEWHPFRVVMVNGKKKELISEDDAKLQALREEYGEEVYSLVTKALLEVNEYNPRGRYAV  496

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  497  PELWNYKEGRKATLKEALQYVLKQWRTHKRKR  528



>ref|XP_010459126.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=510

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -1

Query  606  QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  427
            +GL+ LL +  + IG++RMGE++ K F NVCK R+S  EA V+A  LCS WQE +K+P+W
Sbjct  363  KGLTGLLGA-ETDIGVKRMGEVNEKPFLNVCKLRYSANEATVEAATLCSTWQENLKNPSW  421

Query  426  HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  247
            HPF+ +    R +++++E+DE+L KLK EWGE +  AV  A+EE+NEYNASGRY  PELW
Sbjct  422  HPFKRVGSGGREKEVVDEEDEQLKKLKREWGEAVHNAVKTALEEMNEYNASGRYATPELW  481

Query  246  NFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            NFKEGRKATLKEV+SFI + +KT KRKR
Sbjct  482  NFKEGRKATLKEVISFISENIKTLKRKR  509



>ref|XP_004968205.1| PREDICTED: uncharacterized protein LOC101778142 [Setaria italica]
Length=699

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D LN GR+ IGI+RMGE+D K F N C+++F  ++  VKA EL + WQE++K
Sbjct  547  KELIMGLEDELN-GRAAIGIKRMGELDEKPFQNACRRKFGNDDYQVKAAELITNWQEELK  605

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHPF+V+ ++   ++++++DD +L  L  E+G+++C AV  A+ E+NEYN SGRYV+
Sbjct  606  KPSWHPFKVVQVNGEDKEVLDDDDAKLKFLWIEYGDDVCNAVKTALMEINEYNPSGRYVV  665

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT KEV+ ++F Q++T  ++R
Sbjct  666  PELWNFRKGRKATTKEVLKYLFGQMETTTKRR  697



>ref|NP_173043.1| factor of DNA methylation 1 [Arabidopsis thaliana]
 sp|Q9S9P3.1|FDM1_ARATH RecName: Full=Factor of DNA methylation 1; AltName: Full=Protein 
IDN2 PARALOG 1; AltName: Full=Protein IDN2-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAF18488.1|AC010924_1 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays. ESTs gb|F14071, gb|Z26823, gb|AI998935 come from 
this gene [Arabidopsis thaliana]
 gb|AEE29382.1| factor of DNA methylation 1 [Arabidopsis thaliana]
Length=634

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+ LL +  + IG++RMGE+D K F +VCK R+S  EA V+A  LCS WQE +K
Sbjct  483  KKLIAGLTGLLGA-ETDIGVKRMGELDEKPFLDVCKLRYSANEAAVEAATLCSTWQENLK  541

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W PF+     D  E++++EDDE+L KLK EWG+E+  AV  A+ E+NEYNASGRY  
Sbjct  542  NPSWQPFKHEGTGDGAEEVVDEDDEQLKKLKREWGKEVHNAVKTALVEMNEYNASGRYTT  601

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKEGRKATLKEV++FI   +K  KRKR
Sbjct  602  PELWNFKEGRKATLKEVITFISNDIKILKRKR  633



>gb|KEH32486.1| XH/XS domain protein [Medicago truncatula]
Length=629

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLN-SGRSHIGIRRMGEIDGKAFHNVCKQRF-STEEADVKALELCSLWQEK  445
            K LI GL+++L  + +++IG +RMG++D K F NVCK+RF S EEA +KA+ELCS WQE 
Sbjct  475  KELIAGLNEMLTGNNKTNIGTKRMGDLDQKVFVNVCKKRFLSEEEAGMKAMELCSFWQEN  534

Query  444  VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            VK+  WHPF+V+  +D    ++NE+DE+L KLK+EWG+EI +AV  A++EVNEYN SG Y
Sbjct  535  VKNSAWHPFKVVRENDSHVSVMNEEDEKLKKLKQEWGDEIYSAVETALKEVNEYNPSGGY  594

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             + ELWNFKE RKATLKEV+++I + +K  KRKR
Sbjct  595  AVYELWNFKEQRKATLKEVITYIVEHMKQLKRKR  628



>ref|XP_010678965.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++L S R++IG++RMGEID KAF   CK+++  +EA +KA + CSLWQ+ + DP
Sbjct  484  LIAGLLEILQSNRTNIGVKRMGEIDEKAFVMQCKKKYKGDEALMKASKGCSLWQKYLGDP  543

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF++I  + + E+IINE+DE+L +LK +WG E+  AV  A++E+NEYN SGRYV+ E
Sbjct  544  AWHPFKIIETNGKNEEIINEEDEKLKRLKAQWGNEVYRAVTVALQELNEYNPSGRYVVNE  603

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+KEGRKAT+KEVVS++FK LK  KRK+
Sbjct  604  LWNYKEGRKATVKEVVSYVFKNLKALKRKK  633



>ref|XP_006655910.1| PREDICTED: myosin-9-like [Oryza brachyantha]
Length=697

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L +GR+ IGI+RMGE+D K F N C++++  ++ + KA EL S WQE++K
Sbjct  545  KELITGLEDML-TGRTAIGIKRMGELDEKPFQNACRRKYGNDDYETKAAELVSSWQEEIK  603

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP++++ I+   ++++++DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+
Sbjct  604  KPSWHPYKIVTINGEDKEVVDDDDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVV  663

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELW+F++GRKAT+KEV+ +IF Q++T  ++R
Sbjct  664  PELWDFRKGRKATMKEVLKYIFGQMETTGKRR  695



>ref|XP_010265641.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265643.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265644.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265645.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
Length=633

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL+D+L +GR++IGI+RMGE+D K F    K+R  +++A++++ +LCSLWQE +++P
Sbjct  485  LISGLTDIL-AGRTNIGIKRMGELDEKPFQVAFKKRLPSDKAEMESTKLCSLWQEYLREP  543

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +WHPF+++    +  +II+E+DE+L  L+E++G EI  AV+ A+ E+NEYN SGRY +PE
Sbjct  544  SWHPFKIVESEGQATEIIDEEDEKLKVLREKFGNEIYEAVVTALWEMNEYNPSGRYPVPE  603

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV+ +I K +K+ KRK+
Sbjct  604  LWNFKEGRKATLKEVIDYICKNIKSCKRKK  633



>gb|EMT09583.1| hypothetical protein F775_10228 [Aegilops tauschii]
Length=598

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DL  +GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+E++K
Sbjct  448  KKLIDGLRDL-TTGRGIIGIKRMGDLDLKSFAIACKNKMSKEDAAVTASLLCSKWEEEIK  506

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SGRY +
Sbjct  507  DPEWHPFKVIMDEGKEKEILREDDEKLRELKEEYGEEVYGLVTKALLEVNEYNPSGRYPV  566

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKE V ++ +Q +T KRKR
Sbjct  567  PELWNFKEKRKATLKEAVQYVLRQWRTQKRKR  598



>ref|XP_002278500.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X2 [Vitis vinifera]
 emb|CBI31664.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  SGR+HIG++RMGE+D K FH  CK+++   E + +ALELCSLW+E ++
Sbjct  489  KELISGLKEM--SGRAHIGVKRMGELDNKPFHEACKRKYGVAEPEERALELCSLWEEFLR  546

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D  WHPF+V+ I  + + +I+++DE+L  +++E G+E+  AV  A+ E+NEYN SGRY+I
Sbjct  547  DSEWHPFKVVEIEGKHQGVIDDNDEKLRSVRDELGDEVYTAVRTALIEINEYNPSGRYII  606

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+ EGRKATL+E V+FI ++ KT++ KR
Sbjct  607  SELWNYGEGRKATLQEGVAFILRKWKTYRDKR  638



>ref|XP_008655632.1| PREDICTED: centrosomal protein of 128 kDa-like [Zea mays]
 gb|AFW80053.1| putative XH domain family protein [Zea mays]
Length=691

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL + LN GR+ IG++RMGE+D K F N CK ++  +E ++KA EL + WQ+++K
Sbjct  539  KELIKGLEEELN-GRTAIGVKRMGELDEKPFQNACKTKYGKDEYEIKAAELVTSWQDELK  597

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHPF+++ ++   ++I+++DD +L  L  E+G+++C AV  A+ E+NEYN SGRYV+
Sbjct  598  KPSWHPFKMVEVNGENKEILDDDDTKLKFLWIEYGDDVCNAVKTALMEINEYNPSGRYVV  657

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ ++F Q+ T  ++R
Sbjct  658  PELWNFRKGRKATVKEVLKYLFSQMDTTTKRR  689



>ref|XP_010658558.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X1 [Vitis vinifera]
Length=656

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  SGR+HIG++RMGE+D K FH  CK+++   E + +ALELCSLW+E ++
Sbjct  504  KELISGLKEM--SGRAHIGVKRMGELDNKPFHEACKRKYGVAEPEERALELCSLWEEFLR  561

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D  WHPF+V+ I  + + +I+++DE+L  +++E G+E+  AV  A+ E+NEYN SGRY+I
Sbjct  562  DSEWHPFKVVEIEGKHQGVIDDNDEKLRSVRDELGDEVYTAVRTALIEINEYNPSGRYII  621

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+ EGRKATL+E V+FI ++ KT++ KR
Sbjct  622  SELWNYGEGRKATLQEGVAFILRKWKTYRDKR  653



>ref|XP_004972828.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Setaria 
italica]
Length=626

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL++LL   RS+IGI+RMGE+DGK F   CKQR+  ++AD+KA +LCS WQE++K
Sbjct  477  KELISGLAELLGP-RSNIGIKRMGELDGKPFLVACKQRYG-DDADMKAAKLCSSWQEQLK  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+++      EQ+I++ DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+
Sbjct  535  DPNWHPFKIVTTGPTAEQVIDDKDEKLVGLKQQLGEEVYKAVTTALLEINEYNASGSYVV  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE RKA + E +  + KQ K  KR+R
Sbjct  595  SELWNNKENRKANITEAIQHVLKQWKALKRRR  626



>ref|XP_004972827.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Setaria 
italica]
Length=630

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL++LL   RS+IGI+RMGE+DGK F   CKQR+  ++AD+KA +LCS WQE++K
Sbjct  481  KELISGLAELLGP-RSNIGIKRMGELDGKPFLVACKQRYG-DDADMKAAKLCSSWQEQLK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+++      EQ+I++ DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+
Sbjct  539  DPNWHPFKIVTTGPTAEQVIDDKDEKLVGLKQQLGEEVYKAVTTALLEINEYNASGSYVV  598

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE RKA + E +  + KQ K  KR+R
Sbjct  599  SELWNNKENRKANITEAIQHVLKQWKALKRRR  630



>ref|XP_010101455.1| hypothetical protein L484_012877 [Morus notabilis]
 gb|EXB88438.1| hypothetical protein L484_012877 [Morus notabilis]
Length=632

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -1

Query  597  SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  418
            +DLL + ++HIGI+RMG++D K F  VC++R S EE +++   LCSLW EK+KDP+WHP 
Sbjct  489  TDLL-TAKTHIGIKRMGDLDEKPFIKVCRER-SLEEPELQGSTLCSLWTEKLKDPSWHPL  546

Query  417  RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  238
            +V+ I+   +++I+E+DE+L  L+EEWG+EI  AV+ A +E+NEYN SGRY + ELWNFK
Sbjct  547  KVVTINGNHQEVIDEEDEQLRNLREEWGDEIYTAVVTAFKEINEYNPSGRYTVLELWNFK  606

Query  237  EGRKATLKEVVSFIFKQLKTHKRKR  163
            EGRKATLKEV++F    +K  KRKR
Sbjct  607  EGRKATLKEVIAFALMNMKQLKRKR  631



>ref|XP_010092186.1| hypothetical protein L484_013504 [Morus notabilis]
 gb|EXB50412.1| hypothetical protein L484_013504 [Morus notabilis]
Length=632

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -1

Query  597  SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  418
            +DLL + ++HIGI+RMG++D K F  VC++R S EE +++   LCSLW EK+KDP+WHP 
Sbjct  489  TDLL-TAKTHIGIKRMGDLDEKPFIKVCRER-SLEEPELQGSTLCSLWAEKLKDPSWHPL  546

Query  417  RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  238
            +V+ I+   +++I+E+DE+L  L+EEWG+EI  AV+ A +E+NEYN SGRY + ELWNFK
Sbjct  547  KVVTINGNHQEVIDEEDEQLRNLREEWGDEIYTAVVTAFKEINEYNPSGRYTVLELWNFK  606

Query  237  EGRKATLKEVVSFIFKQLKTHKRKR  163
            EGRKATLKEV++F    +K  KRKR
Sbjct  607  EGRKATLKEVIAFALMNMKQLKRKR  631



>gb|EMS50669.1| hypothetical protein TRIUR3_29122 [Triticum urartu]
Length=528

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL   + +GR++IGI+RMGE+D K+    C ++ S E+A+V A  LCS W+  +K
Sbjct  378  KKLIDGLQ-TITTGRANIGIKRMGELDLKSLAIACGRKLSKEDAEVTAAILCSKWEADIK  436

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPFRV+ ++ +  ++I+EDD +L  L+EE+GEE+ + V KA+ EVNEYN  GRY +
Sbjct  437  KPEWHPFRVVMVNGKKRELISEDDAKLQTLREEYGEEVYSLVTKALLEVNEYNPRGRYPV  496

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  497  PELWNYKEGRKATLKEALQYVLKQWRTHKRKR  528



>ref|XP_010234408.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=632

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLSDLL   RS+IGI+RMGE+D K F   CKQ++  E A+ K LELCS+WQ+K+K
Sbjct  483  KELISGLSDLLGP-RSNIGIKRMGELDEKPFIQACKQKYGVE-AETKGLELCSMWQDKLK  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D NWHPF+V+   ++  QIINE DEEL+ LK+E G+E+  AV  A+ E+NEYNASG YV+
Sbjct  541  DANWHPFKVVVTGEKTGQIINEHDEELAGLKQELGQEVYQAVTTALLEINEYNASGSYVV  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE +KA++ +VV  I KQ K  KR+R
Sbjct  601  SELWNNKENKKASMGDVVQHILKQWKLQKRRR  632



>ref|XP_010234409.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234410.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GLSDLL   RS+IGI+RMGE+D K F   CKQ++  E A+ K LELCS+WQ+K+K
Sbjct  482  KELISGLSDLLGP-RSNIGIKRMGELDEKPFIQACKQKYGVE-AETKGLELCSMWQDKLK  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D NWHPF+V+   ++  QIINE DEEL+ LK+E G+E+  AV  A+ E+NEYNASG YV+
Sbjct  540  DANWHPFKVVVTGEKTGQIINEHDEELAGLKQELGQEVYQAVTTALLEINEYNASGSYVV  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE +KA++ +VV  I KQ K  KR+R
Sbjct  600  SELWNNKENKKASMGDVVQHILKQWKLQKRRR  631



>gb|EMS57892.1| hypothetical protein TRIUR3_23802 [Triticum urartu]
Length=674

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DL  +GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+E++K
Sbjct  524  KKLIDGLRDL-TTGRGIIGIKRMGDLDLKSFAIACKNKMSKEDAGVTASILCSKWEEEIK  582

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SGRY +
Sbjct  583  DPEWHPFKVIVDEGKEKEILREDDEKLRELKEEYGEEVYGLVTKALLEVNEYNPSGRYPV  642

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE RKATLKE V ++ +Q +T KRKR
Sbjct  643  PELWNFKEKRKATLKEAVQYVLRQWRTQKRKR  674



>ref|XP_006416865.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
 gb|ESQ35218.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
Length=633

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+ LL +  + IG++RMGE+D   F NVCKQR+S +EA ++A  LCS WQ+ V 
Sbjct  482  KKLIAGLTGLLGAN-TDIGVKRMGELDEIPFLNVCKQRYSADEASIEAATLCSTWQKNVN  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D +W PF+      +  ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY+ 
Sbjct  541  DISWQPFKHEGTGYKATEVVDENDEKLKKLKGEWGEEVHNAVKTALEELNEYNGSGRYIT  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  601  PELWNFKVGRKATLKEVITFISNDIKTVKRKR  632



>ref|XP_002443867.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
 gb|EES13362.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
Length=626

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+DLL   RS+IGI+RMGE+D K F   CKQR+  E+A++KA E  SLWQE +K
Sbjct  477  KELITGLADLLGP-RSNIGIKRMGELDEKPFVLSCKQRYG-EDAEMKAAEFVSLWQEHLK  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+++      EQIIN++DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+
Sbjct  535  DPNWHPFKIVTTGSTTEQIINDNDEKLVGLKKQLGEEVYKAVTTALLEINEYNASGSYVV  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE RKA++ E +  + KQ K  KR+R
Sbjct  595  SELWNNKENRKASITEAIQHVLKQWKAQKRRR  626



>ref|XP_007009224.1| XH/XS domain-containing protein, putative [Theobroma cacao]
 gb|EOY18034.1| XH/XS domain-containing protein, putative [Theobroma cacao]
Length=347

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -1

Query  609  IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  430
            I GL D+LNS R+ +G++RMGEI+ KAF   C  +F  E+    + +LCS W++ V+DP 
Sbjct  197  INGLKDMLNS-RTTLGVKRMGEINQKAFEVACSLKFPNEDWQEISAKLCSSWEQNVQDPK  255

Query  429  WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  250
            WHPF+ I      ++I++EDDE+L +L+ E+GE    AV  A+ E+NEYNASGRY +PE+
Sbjct  256  WHPFKRIPFRGNLQEIVDEDDEKLKELRNEYGEAAFEAVTTALMEMNEYNASGRYAVPEI  315

Query  249  WNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            WN KEGR+A++KE++ +I KQLKTHKRKR
Sbjct  316  WNLKEGRRASMKEIIQYIIKQLKTHKRKR  344



>gb|AAF02798.1|AF195115_18 F5I10.22 gene product [Arabidopsis thaliana]
 gb|AAB62840.1| A_IG005I10.22 gene product [Arabidopsis thaliana]
 emb|CAB80796.1| AT4g00380 [Arabidopsis thaliana]
Length=662

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQGL+ LL +  S IG++RMGE+D K F +VCK R+S  EA V+A  LCS W+E +K+P
Sbjct  513  LIQGLTGLLGA-ESDIGVKRMGELDEKPFLDVCKLRYSANEARVEAATLCSTWKENLKNP  571

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +W PF+     D  E++++EDDE+L KLK EWG+E+  AV  A+ E+NEYNASGRY   E
Sbjct  572  SWQPFKREGTGDGAEEVVDEDDEQLKKLKREWGKEVHNAVKAALVEMNEYNASGRYPTSE  631

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV++FI   +K  KRKR
Sbjct  632  LWNFKEGRKATLKEVITFISTDIKNLKRKR  661



>ref|NP_001169159.1| putative XH domain family protein [Zea mays]
 ref|XP_008673152.1| PREDICTED: putative XH domain family protein isoform X1 [Zea 
mays]
 ref|XP_008673153.1| PREDICTED: putative XH domain family protein isoform X1 [Zea 
mays]
 gb|ACN31803.1| unknown [Zea mays]
 tpg|DAA53677.1| TPA: putative XH domain family protein [Zea mays]
Length=530

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G  +L   GR++IGI+RMGE+D KAF   CK+R   E+A+V +  LCS WQE+++
Sbjct  379  KELIDGFMELAVVGRANIGIKRMGELDLKAFGIACKKRLPKEDAEVISATLCSKWQEEIR  438

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W+PF+V  +  +  +I+ EDDE L +LKEE GEEI   V KA+ E+NEYN SGRY +
Sbjct  439  NPSWYPFKVKVVDGKEMEILKEDDEMLQELKEEHGEEIYGLVTKALLEINEYNPSGRYPV  498

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKE V  + +Q K+HKRKR
Sbjct  499  PELWNYKEGRKATLKEAVQHVMRQWKSHKRKR  530



>gb|EYU17877.1| hypothetical protein MIMGU_mgv1a002871mg [Erythranthe guttata]
Length=629

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL D+  S  SHIG++RMGE+D K FH+  K++++  EAD +A ELCSLW+E +K
Sbjct  477  KELVNGLKDM--SLNSHIGVKRMGELDSKPFHDAMKRKYNEAEADERATELCSLWEEYLK  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP W P +V+ I   P+ +INEDDE+L  L+E +GEE+  AV   + E+NEYN SGRYVI
Sbjct  535  DPEWDPIKVVTIDGTPKNVINEDDEKLIDLRENYGEEVYNAVKATLFEINEYNPSGRYVI  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KEGR+A LKE V+ + KQ K  KRK+
Sbjct  595  SELWNYKEGRRAYLKEGVAVLLKQWKFFKRKK  626



>gb|EMT32524.1| hypothetical protein F775_28173 [Aegilops tauschii]
Length=528

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL   + +GR++IGI+RMGE+D K+    C ++ S E+A+V A  LCS W+  +K
Sbjct  378  KKLIDGLQ-TITTGRANIGIKRMGELDLKSLAIACGRKLSKEDAEVTAAILCSKWEADIK  436

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P WHPFRV+ ++ +  ++I+EDD +L  L+EE+GEE+ + V KA+ EVNEYN  GRY +
Sbjct  437  KPEWHPFRVVMVNGKKRELISEDDAKLQTLREEYGEEVYSLVTKALLEVNEYNPHGRYAV  496

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEGRKATLKE +  + KQ +THKRKR
Sbjct  497  PELWNYKEGRKATLKEALQHVLKQWRTHKRKR  528



>dbj|BAK05532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL   + +GR++IGI+RMGE+D K+F   C ++ S E+A+V A  LCS W+ ++K+P
Sbjct  453  LIDGLQ-TITTGRANIGIKRMGELDLKSFAIACGRKLSKEDAEVTAAILCSKWEAEIKNP  511

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPFRV+ ++ +  +++ ED+E+L  LKEE GEE+   V KA+ EVNEYN  GRY +PE
Sbjct  512  EWHPFRVVMVNGKKRELVCEDNEKLQTLKEEHGEEVYGLVTKALVEVNEYNPRGRYAVPE  571

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  572  LWNYKEGRKATLKEALQYVLKQWRTHKRKR  601



>ref|XP_011091511.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Sesamum indicum]
Length=641

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL ++  +G  HIG++RMGE+D K FH+  K+++S  EAD +A ELCSLW+E ++
Sbjct  489  KELVNGLKEMSTNG--HIGVKRMGELDSKPFHDAMKRKYSEAEADERATELCSLWEEYLR  546

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHP +V++I+ + + +I EDDE+L  LKE +G+E+  AV  A+ E+NEYN SGRY+I
Sbjct  547  DPEWHPIKVVSINGKHQAVIKEDDEKLRDLKENYGDEVYNAVTAALCEINEYNPSGRYII  606

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+ EGR+ATLKE V  + KQ +  KRKR
Sbjct  607  SELWNYNEGRRATLKEGVEVLLKQWRYQKRKR  638



>emb|CDY35048.1| BnaA06g10580D [Brassica napus]
Length=598

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 117/173 (68%), Gaps = 23/173 (13%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+ LL +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS WQE +K
Sbjct  427  KKLISGLTGLLGA-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCSTWQENLK  485

Query  438  DPNWHPFR---------------------VINIHDRPEQIINeddeelsklkeEWGEEIC  322
            D +W PF+                      +N+ ++PE +++EDDE+L KLK EWGEE+ 
Sbjct  486  DSSWQPFKREGTGDKAKACSLSHCLLPLFELNMLEKPE-VVDEDDEQLKKLKGEWGEEVH  544

Query  321  AAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             AV  A+EE+NEYNASGRY   ELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  545  NAVKTALEEMNEYNASGRYTTSELWNFKVGRKATLKEVINFISNDIKTVKRKR  597



>ref|XP_008673715.1| PREDICTED: intraflagellar transport protein 74 homolog [Zea mays]
 tpg|DAA53475.1| TPA: putative XH domain family protein [Zea mays]
Length=685

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL + LN GR+ +GI+RMGE+D K F N CK+++   E  VKA EL + WQE++K
Sbjct  533  KELIKGLEEELN-GRTAVGIKRMGELDEKPFLNACKRKYGNNEYQVKAAELVTNWQEELK  591

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+W+PF++I++    ++I+ +DD +L  L  E+G+++C AV  A+ E+NEYN SGRYV+
Sbjct  592  NPSWYPFKMIHVDGEDKEILVDDDTKLKFLWIEFGDDVCNAVKTALMEINEYNPSGRYVV  651

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ ++F Q+ T  ++R
Sbjct  652  PELWNFRKGRKATMKEVLKYLFSQMDTTTKRR  683



>emb|CDY35898.1| BnaA07g00890D [Brassica napus]
Length=336

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL  +L+  R++I I+R+GE+D K F   CK+RF  EEA+V+   LCS WQE +KD 
Sbjct  182  LITGLIGMLSGDRTNIRIKRLGELDEKPFLKACKERFKGEEAEVQYAMLCSKWQESLKDS  241

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+ +   D+ +++++E+DE+L KL+EEWGE++  AV  A+EE+NEYN SGRY +P 
Sbjct  242  GWYPFKRVGTEDKMKEVVDEEDEQLKKLREEWGEQVSEAVKTALEELNEYNPSGRYSVPA  301

Query  252  LWNFKEGRKATLKEVVSFI---FKQLKTHKRKRHD  157
            LWN K+ R ATLKEV+ ++    K LK  KRKR D
Sbjct  302  LWNLKKKRNATLKEVIEYMTLQIKNLKNLKRKRKD  336



>ref|XP_002316281.2| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|EEF02452.2| XH/XS domain-containing family protein [Populus trichocarpa]
Length=749

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+HIG++RMGE+D K F    K++++ EEA+ +A E+CSLW+E +K
Sbjct  598  KELINGLKEI--SNRAHIGVKRMGELDSKPFLEAMKRKYNNEEAEDRASEICSLWEEYLK  655

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+V+ +  + ++II+E+DE+LS+L++E G+E C +V  ++ +VNEYN SGRY+I
Sbjct  656  DPDWHPFKVVMVDGKHQEIIDEEDEKLSRLRDEMGDEACMSVTTSLIQVNEYNPSGRYII  715

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KEG+KATL E VSF+  + K  KRKR
Sbjct  716  SELWNYKEGKKATLGEGVSFLLSRWKALKRKR  747



>gb|KDP44945.1| hypothetical protein JCGZ_01445 [Jatropha curcas]
Length=636

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+ IG++RMGE+D K F    K++F  +EA+V+A ELCSLW E +K
Sbjct  485  KELITGLKEI--SNRASIGVKRMGELDSKPFLEAMKKKFVEDEAEVRASELCSLWMEYLK  542

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+ + +  + +++IN++DE+L  L++E   E+  AV  A+ E+NEYN SGRY+I
Sbjct  543  DPDWHPFKFVMVDGKHKEVINDEDEKLKGLRKEMSNEVYKAVTDALMEINEYNPSGRYII  602

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KEG+KATLKE VSF+ KQ +  KRKR
Sbjct  603  SELWNYKEGKKATLKEGVSFLLKQWQVAKRKR  634



>dbj|BAJ94618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +L N GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+E++K
Sbjct  458  KKLIDGLRELTN-GRGIIGIKRMGDLDLKSFAIACKNKMSKEDAGVTASILCSKWEEEIK  516

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SGRY +
Sbjct  517  DPEWHPFKVIVDEGKEKEILCEDDEKLRELKEEYGEEVYGLVKKALLEVNEYNPSGRYPV  576

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNFKE R+ATLKE V ++ +Q +T KRKR
Sbjct  577  PELWNFKEKRRATLKEAVQYVLRQWRTQKRKR  608



>ref|NP_567176.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|F4JH53.1|FDM2_ARATH RecName: Full=Factor of DNA methylation 2; AltName: Full=Protein 
IDN2 PARALOG 2; AltName: Full=Protein IDN2-LIKE 2 [Arabidopsis 
thaliana]
 gb|AEE81871.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=635

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            +I GL+ LL +  S IG++RMGE+D K F +VCK R+S  EA V+A  LCS W+E +K+P
Sbjct  486  MIAGLTGLLGA-ESDIGVKRMGELDEKPFLDVCKLRYSANEARVEAATLCSTWKENLKNP  544

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +W PF+     D  E++++EDDE+L KLK EWG+E+  AV  A+ E+NEYNASGRY   E
Sbjct  545  SWQPFKREGTGDGAEEVVDEDDEQLKKLKREWGKEVHNAVKAALVEMNEYNASGRYPTSE  604

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKEGRKATLKEV++FI   +K  KRKR
Sbjct  605  LWNFKEGRKATLKEVITFISTDIKNLKRKR  634



>gb|EEC69939.1| hypothetical protein OsI_00386 [Oryza sativa Indica Group]
Length=442

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL  +L +GR+ IGI+RMGE+D K F   CK+++  ++ + KA +L S WQE+++
Sbjct  290  KELTMGLEKML-TGRTAIGIKRMGELDEKPFQTECKRKYGNDDYETKAADLVSSWQEEIR  348

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHP+++I +    ++++++DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+
Sbjct  349  KPSWHPYKIITVDGEDKEVVDDDDTKLRDLWIEYGDDVCNAVKTALSEVNEYNASGRYVV  408

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
            PELWNF++GRKAT+KEV+ +IF Q++T  ++R 
Sbjct  409  PELWNFRKGRKATMKEVLKYIFGQIETTSKRRR  441



>ref|XP_010690753.1| PREDICTED: factor of DNA methylation 5-like [Beta vulgaris subsp. 
vulgaris]
Length=412

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            L+ GL  +L S R+ +GI+RMGE+D K F + C ++F  EE  +K  E+CSLW++ +K+ 
Sbjct  263  LLSGLDTIL-SNRTMLGIKRMGELDTKPFLDACSKKFPKEERGIKCAEVCSLWEDHLKNS  321

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            NWHPF++ +I    + II+E DE+L +L++EWGE    AV  A+ E+NEYN SGRY +P+
Sbjct  322  NWHPFKLSSIDGNLQAIIDESDEKLEELRKEWGENAYKAVTSALLELNEYNPSGRYPVPK  381

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +WN KE RK +LKEV+ +I +QLKTHKRKR
Sbjct  382  IWNIKEERKVSLKEVIGYIIQQLKTHKRKR  411



>gb|EPS59185.1| hypothetical protein M569_15623 [Genlisea aurea]
Length=616

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            KLL++ LS   ++ R  IG++R+GEID  AF N CKQ+   EE D +A +L S+WQEK+K
Sbjct  460  KLLVESLSPTPSNSRVSIGVKRVGEIDESAFKNACKQKLPPEEVDFEAAKLTSMWQEKLK  519

Query  438  DPNWHPFRVINIHD-----RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNAS  274
            DP WHPFR++   +     R  +   ED E L +L++EWG+E   AV KA +E++EYN S
Sbjct  520  DPGWHPFRIVTDGNGDSKARYAEEFREDYESLQELRKEWGDEAYVAVAKASKEIHEYNPS  579

Query  273  GRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            G YV  ELWNFKE RKATLKEVV+FI  Q+KT KRKR
Sbjct  580  GCYVTNELWNFKEDRKATLKEVVAFIISQVKTLKRKR  616



>gb|KJB73898.1| hypothetical protein B456_011G262900 [Gossypium raimondii]
Length=350

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -1

Query  609  IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  430
            I GL+D+L S R+ + ++RMGEID KAF      +F  E+      +LCSLWQ+ V+DP 
Sbjct  199  INGLNDVLTS-RTTLVVKRMGEIDQKAFEVASSGKFPNEDWQETCAKLCSLWQQNVQDPK  257

Query  429  WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  250
            WHPF++INI    ++I++EDDE+L +L+ E+G+ +  AV  A+ E+NEYNASGRY +PE+
Sbjct  258  WHPFKMINIRGNLQEIVDEDDEKLKELRNEYGDVVYEAVSTALMEMNEYNASGRYAVPEI  317

Query  249  WNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            WN KEGRKAT+KE++ ++  QLK HKRKR
Sbjct  318  WNRKEGRKATMKEIIQYVIGQLKIHKRKR  346



>gb|EMT13639.1| hypothetical protein F775_24890 [Aegilops tauschii]
Length=591

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL    N GR++IG++RMGE+D KAF N CKQ  S E+A V ++ LCS WQ ++ 
Sbjct  442  KRLKDGLQKFTN-GRANIGVKRMGELDMKAFANACKQDLSQEDAQVDSVFLCSKWQAEIT  500

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +  WHPF+++ +  +  +I+ EDD++L KLKEE GEEIC  V  A+ E+NEYN SGRYV+
Sbjct  501  NSEWHPFKIVMVDGKEMEILLEDDDKLRKLKEEHGEEICTLVTNALLEINEYNPSGRYVV  560

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            PELWN+K+GRKATL+E + FI KQ ++HK++
Sbjct  561  PELWNYKDGRKATLEEGIEFIVKQWQSHKKR  591



>ref|XP_010940184.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=984

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  SG + IGI+RMGE+D K F N  K +F + EAD+KA ELC+ WQ++++
Sbjct  833  KALITGLKEM-QSGSTLIGIKRMGELDYKPFRNAFKGKFLSIEADIKAAELCTFWQQELQ  891

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            + +WHPF+VI I +  +Q+INEDDE+L  LK + G+E+  AV  A+ E+ EYNASG Y I
Sbjct  892  NSDWHPFKVIQIGEDYKQVINEDDEKLRDLKGQLGDEVYKAVTAALNELLEYNASGNYCI  951

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
             ELWNFKEGRKA+L EV+ +IFKQ  T+KRKR 
Sbjct  952  SELWNFKEGRKASLGEVIQYIFKQWNTNKRKRQ  984



>ref|XP_006389833.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
 gb|ESQ27119.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
Length=634

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL +LL S R++I I+R+GE+D K F   CK+RF+ EEADV+   LCS WQE +KDP
Sbjct  482  LITGLRELL-SDRTNIRIKRLGELDEKPFMKACKERFTGEEADVQHAMLCSKWQENLKDP  540

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+ +   D+ +++++E+DE++  L+EEWGE++  AV +A+EE+NE+N SGRY +P 
Sbjct  541  AWYPFKRVGTGDKMQEVVDEEDEQIRSLREEWGEDVKNAVKRALEELNEFNPSGRYSVPA  600

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNFKE RKATLKEV+ ++  Q++    KR
Sbjct  601  LWNFKEKRKATLKEVIEYMTLQIRNLNLKR  630



>emb|CDM82421.1| unnamed protein product [Triticum aestivum]
 emb|CDM82462.1| unnamed protein product [Triticum aestivum]
Length=704

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L SGR+ IGI+RMGE+D + F N CK+++  ++ + +A EL S WQE++K
Sbjct  551  KELIMGLEDIL-SGRTAIGIKRMGELDERPFQNACKRKYGNDDYETRAAELVSSWQEEIK  609

Query  438  DPNWHPFRVINIHDRPE-QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P WHP++ +   D  + +++N++D  L +L  E+G+++C AV  A+ EVNEYN SGRYV
Sbjct  610  KPAWHPYKFVKAEDGSDKEVVNDEDPRLKQLWIEYGDDVCNAVKTALSEVNEYNPSGRYV  669

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNF++ RKAT+KEV+ FIF+Q++   ++R
Sbjct  670  VSELWNFRKNRKATMKEVLRFIFQQMEVPGKRR  702



>gb|EMS64523.1| hypothetical protein TRIUR3_35150 [Triticum urartu]
Length=736

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L SGR+ IGI+RMGE+D + F N CK+++  ++ + +A EL S WQE++K
Sbjct  583  KELIMGLEDIL-SGRTAIGIKRMGELDERPFQNACKRKYGNDDHETRAAELVSSWQEEIK  641

Query  438  DPNWHPFRVINIHDRPE-QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P WHP++ +   D  + +++N++D  L +L  E+G+++C AV  A+ EVNEYN SGRYV
Sbjct  642  KPAWHPYKFVKAEDGSDKEVVNDEDPRLKQLWIEYGDDVCNAVKTALSEVNEYNPSGRYV  701

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNF++ RKAT+KEV+ FIF+Q++   ++R
Sbjct  702  VSELWNFRKNRKATMKEVLRFIFQQMEVPGKRR  734



>ref|XP_010690719.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690724.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+  S R ++G++RMGE+D   F   CK+++  + A+ KA E+CSLW E ++
Sbjct  483  KELINGLKDM--SNRGYLGVKRMGELDSSVFQEACKRKYPEDIAEDKAAEICSLWDEYLR  540

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF+V+ +H   +++I+  DE+L  LK+EWG+++  AV  A++E+NEYN SGRY+I
Sbjct  541  DPTWHPFKVVPVHGEHKEVIDVADEKLRDLKKEWGDDVYDAVTTALKEINEYNPSGRYII  600

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN +E RKATL+E VS+I  + K +K KR
Sbjct  601  TELWNNRESRKATLQEGVSYILNKWKDYKGKR  632



>ref|XP_002455202.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
 gb|EES00322.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
Length=693

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+GL + L+ G++ IGI+RMGE+D K F N CK+++   E  +KA EL + WQE++K
Sbjct  541  KELIKGLEEELD-GQTAIGIKRMGELDEKPFLNACKRKYGKGEYQIKAAELVTNWQEELK  599

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
             P+WHPF+++ ++   ++I+ +DD +L  L  E+G+++C AV  A+ E+NEYN SGRYV+
Sbjct  600  KPSWHPFKMVEVNGENKEILVDDDAKLKHLWIEYGDDVCNAVKTALMEINEYNPSGRYVV  659

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWNF++GRKAT+KEV+ ++F Q+ T  ++R
Sbjct  660  PELWNFRKGRKATMKEVLKYLFSQMDTTTKRR  691



>gb|EMT16997.1| hypothetical protein F775_14651 [Aegilops tauschii]
Length=812

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L SGR+ IGI+RMGE+D + F N CK+++  ++ + +A EL S WQE++K
Sbjct  659  KELIMGLEDIL-SGRTAIGIKRMGELDERPFQNACKRKYGNDDYETRAAELVSSWQEEIK  717

Query  438  DPNWHPFRVINIHDRPE-QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P WHP++ +   D  + +++N++D  L +L  E+G+++C AV  A+ EVNEYN SGRYV
Sbjct  718  KPAWHPYKFVKAEDGSDKEVVNDEDPRLKQLWIEYGDDVCNAVKTALSEVNEYNPSGRYV  777

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNF++ RKAT+KEV+ FIF+Q++   ++R
Sbjct  778  VSELWNFRKNRKATMKEVLRFIFQQMEVPGKRR  810



>ref|XP_008461675.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
 ref|XP_008461676.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
Length=643

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K +I    DL   GRSH+ ++RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +K
Sbjct  489  KEIINAFKDL--PGRSHLRVKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLK  546

Query  438  DPNWHPFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEY  283
            DP+WHPFRVI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEY
Sbjct  547  DPDWHPFRVIKVEAKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALMEINEY  606

Query  282  NASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  184
            N SGRY+  ELWN++EGRKATL+E V F+  +L
Sbjct  607  NPSGRYITSELWNYQEGRKATLREGVRFLLDKL  639



>ref|XP_009353657.1| PREDICTED: uncharacterized protein LOC103944909 [Pyrus x bretschneideri]
Length=699

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R+ IG++RMG++D K F    K+++S EEAD KA+E CSLW+E ++
Sbjct  548  KELINGLWD--STHRATIGVKRMGDLDQKPFQIATKEKYSNEEADEKAVEFCSLWEEYLR  605

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             PNWHPF++I   + +P++II+E+D++L  LK + GEE+  AV  A+ E+N+YN SGRY+
Sbjct  606  HPNWHPFKIITDQEGKPKEIIDENDDKLKDLKNQLGEEVYKAVTTALMELNDYNPSGRYI  665

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPELWNFKEGRKA+LKE V F+  + K  +++R
Sbjct  666  IPELWNFKEGRKASLKEGVVFMLNKWKPLRKRR  698



>ref|XP_002533154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29235.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+ IG++RMGE+D K F    K++++ EEA+V+A ELCSLW E +K
Sbjct  489  KELINGLKEI--SNRAQIGVKRMGELDSKPFLEAMKRKYTEEEAEVRASELCSLWVEYLK  546

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHPF+V  +  + +++I++ DE+L+ LK+E G+E+  AV  AV+E+N+YN SGRY+ 
Sbjct  547  DPGWHPFKVAMVDGKNKEVIDDKDEKLNGLKDELGDEVYKAVTDAVKEINDYNPSGRYIT  606

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KE +KATLKE VSF+ KQ +  KR+R
Sbjct  607  SELWNYKEEKKATLKEGVSFLLKQWQIAKRRR  638



>gb|EMS54623.1| hypothetical protein TRIUR3_33647 [Triticum urartu]
Length=693

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DLL   RS+IGIRRMG++D K F   CK ++  E AD KALE CS+WQ+ ++
Sbjct  545  KELISGLVDLLGP-RSNIGIRRMGQVDEKPFIEACKPKYGAE-ADTKALEFCSMWQDNLR  602

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D NWHPF+++   ++ EQII+E DE+L  LKEE GEE+  AV  A+ E+NEYNASG YV+
Sbjct  603  DANWHPFKIVTTGEKSEQIIDEGDEKLVGLKEELGEEVYKAVTTALVEMNEYNASGSYVV  662

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN K+ RKA++ EVV  I KQ K  KRKR
Sbjct  663  SELWNNKDNRKASMGEVVEHILKQWKA-KRKR  693



>gb|KHG08146.1| Nif-specific regulatory [Gossypium arboreum]
Length=350

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -1

Query  609  IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  430
            I GL+D+L S R+ + ++RMGEI+ KAF      +F  E+      +LCSLWQ+ V+DP 
Sbjct  199  ISGLNDVLTS-RTTLVVKRMGEINQKAFEVASSGKFPDEDWQETCAKLCSLWQQNVQDPK  257

Query  429  WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  250
            WHPF++INI    ++I++EDDE+L +L+ E+G+ +  AV  A+ E+NEYNASGRY +PE+
Sbjct  258  WHPFKMINIRGNLQEIVDEDDEKLKELRNEYGDVVYEAVRTALMEMNEYNASGRYAVPEI  317

Query  249  WNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            WN KEGRKAT+KE++ ++  QLK HKRKR
Sbjct  318  WNRKEGRKATMKEIIQYVIGQLKIHKRKR  346



>ref|NP_001168342.1| putative XH domain family protein [Zea mays]
 gb|ACN27880.1| unknown [Zea mays]
 gb|AFW57328.1| putative XH domain family protein [Zea mays]
Length=626

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL+D+L   RS+IGI+RMGE+D K F   CKQR+  ++A++KA EL SLWQE +K
Sbjct  477  KELITGLTDMLGP-RSNIGIKRMGELDEKPFVLSCKQRYG-QDAEMKAAELVSLWQEHLK  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF+++      EQII++ DE+L+ LK++ GE++  AV  A+ E+NEYNASG YV+
Sbjct  535  DPNWHPFKIVTTGSTKEQIIDDKDEKLAGLKKQLGEKVYEAVATALLEINEYNASGSYVV  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN +E RKA++ E +  + KQ K  +R+R
Sbjct  595  SELWNNRENRKASVTEAIQHVLKQWKAQRRRR  626



>emb|CDY33370.1| BnaC05g12130D [Brassica napus]
Length=1005

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 117/173 (68%), Gaps = 23/173 (13%)
 Frame = -1

Query  618   KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
             K LI GL+ LL +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS WQE +K
Sbjct  834   KKLIAGLTGLLGA-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCSTWQENLK  892

Query  438   DPNWHPFR---------------------VINIHDRPEQIINeddeelsklkeEWGEEIC  322
             D +W PF+                      +N+ ++PE +++EDDE+L KLK EWGEE+ 
Sbjct  893   DSSWQPFKREGTGDKAKACSLSHCLLPLSELNMLEKPE-VVDEDDEQLKKLKGEWGEEVH  951

Query  321   AAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
              AV  A+EE+NEYNASGRY   ELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  952   NAVKTALEEMNEYNASGRYTTSELWNFKVGRKATLKEVINFISNDIKTVKRKR  1004



>ref|XP_003569416.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=630

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  588  LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  409
            L+ G++HIGI+RMGE+D KAF + C+Q+ S EEA+V A  LCS W+ ++++P WHPFR +
Sbjct  489  LSGGQAHIGIKRMGELDLKAFSSACRQKSSKEEAEVTAAILCSKWEAEIRNPEWHPFRAV  548

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
             +  +  +II+ DD +L +LK E GEE+ A V KA+ E+NEYNA+ RY I ELWNF+E R
Sbjct  549  MVDGKETEIIDADDAKLQELKGEHGEEVYALVTKALHEINEYNATARYPIGELWNFREER  608

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KA+LKE V F+ +Q + +K+KR
Sbjct  609  KASLKEAVQFVMRQWRMNKKKR  630



>ref|XP_010678966.1| PREDICTED: factor of DNA methylation 5-like [Beta vulgaris subsp. 
vulgaris]
Length=555

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = -1

Query  609  IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  430
            I GL +     R+HIG++RMGEID  AF   CK+RF    A  KA   CSLWQ K+ D  
Sbjct  405  ITGLLETFPGNRTHIGVKRMGEIDLTAFIRECKKRFPVTVAFTKAGIECSLWQNKLLDST  464

Query  429  WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  250
            WHPF++I+IH   +++INE+DE+L  L+ +WG ++  AV  A++E+NEYN SGRYV+ +L
Sbjct  465  WHPFKIIDIHGNLKEVINEEDEKLKTLRLQWGYKVYEAVATALQELNEYNPSGRYVVNDL  524

Query  249  WNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            WN+ EGRKAT+KEVV+++F+ LK  + KR
Sbjct  525  WNYDEGRKATVKEVVNYVFQNLKKLQLKR  553



>ref|XP_007009298.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18108.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=640

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +K
Sbjct  486  KELINGLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLK  543

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +    E  ++IN++DE+L  L+ + G E+   V  A++E+NEYN SGRY
Sbjct  544  DPDWHPFKRIKLEGEEEYQEVINDEDEKLRDLRNQMGNEVYKVVTSAIKEINEYNPSGRY  603

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +I ELWN+ EGRKATL+E V ++ K   T KRKR
Sbjct  604  IISELWNYGEGRKATLQEGVIYLLKLWNTAKRKR  637



>ref|XP_007009299.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18109.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=638

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +K
Sbjct  484  KELINGLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLK  541

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +    E  ++IN++DE+L  L+ + G E+   V  A++E+NEYN SGRY
Sbjct  542  DPDWHPFKRIKLEGEEEYQEVINDEDEKLRDLRNQMGNEVYKVVTSAIKEINEYNPSGRY  601

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +I ELWN+ EGRKATL+E V ++ K   T KRKR
Sbjct  602  IISELWNYGEGRKATLQEGVIYLLKLWNTAKRKR  635



>ref|XP_009104485.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104486.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104487.1| PREDICTED: myosin-9-like [Brassica rapa]
Length=639

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GLS LL S R++I I+R+GE+D K F   CK+RF  EEA+V+   LCS WQE +KD 
Sbjct  486  LIGGLSGLL-SDRTNIRIKRLGELDEKPFLKACKKRFKGEEAEVQYAILCSKWQETLKDS  544

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+ +   D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P 
Sbjct  545  GWYPFKRVGTEDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPA  604

Query  252  LWNFKEGRKATLKEVVSFI---FKQLKTHKRKR  163
            LWNFKE RKATLKEV+ ++    K LK  KRKR
Sbjct  605  LWNFKEKRKATLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_011035877.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035879.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035880.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035881.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035882.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
Length=699

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -1

Query  582  SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-N  406
            + R+ IG++RMG++D K FH   K +F  EEAD KALELCSLW+++++DP+WHPF+VI +
Sbjct  558  TTRAFIGVKRMGDLDSKPFHEASKIKFLDEEADEKALELCSLWEDRLRDPSWHPFKVILD  617

Query  405  IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  226
                 ++IINEDDE L  LK E+G+E+C AV+ A++E+NEYN SGRY+I ELWNFKE RK
Sbjct  618  KEGNSKEIINEDDENLRSLKSEFGDEVCNAVVTALKEMNEYNPSGRYIIKELWNFKEERK  677

Query  225  ATLKEVVSFIFKQLKTHKRKR  163
            ATL E V  + KQ +  KR++
Sbjct  678  ATLSEGVMHLLKQWRQLKRRK  698



>ref|XP_006378650.1| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|ERP56447.1| XH/XS domain-containing family protein [Populus trichocarpa]
Length=676

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -1

Query  582  SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-N  406
            + R+ IG++RMG++DGK FH   K +F  EEAD KALELCSLW+++++DP+WHPF+VI +
Sbjct  535  TTRAFIGVKRMGDLDGKPFHEASKIKFLDEEADEKALELCSLWEDRLRDPSWHPFKVILD  594

Query  405  IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  226
                 ++IINEDDE L  LK E+G+E+  AV+ A++E+NEYN SGRYVI ELWNFKE RK
Sbjct  595  KEGNSKEIINEDDENLRSLKSEFGDEVFNAVVTALKEMNEYNPSGRYVIKELWNFKEERK  654

Query  225  ATLKEVVSFIFKQLKTHKRKR  163
            ATL E V  I KQ +  KR++
Sbjct  655  ATLSEGVMHILKQWRQLKRRK  675



>dbj|BAJ97190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L SGR+ IGI+RMGE+D + F N C++++   + +  A EL S WQE++K
Sbjct  551  KELIAGLEDML-SGRAAIGIKRMGELDERPFQNACRRKYGNNDYETSAAELVSSWQEEIK  609

Query  438  DPNWHPFRVINIHDRPE-QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P W P++ +   D  + +++N++D  L +L  E+G+++C AV  A+ EVNEYNASGRYV
Sbjct  610  KPTWQPYKFVKAEDGTDKEVVNDEDPRLKQLWIEYGDDVCNAVKTALSEVNEYNASGRYV  669

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNF++ RKAT+KEV+ FIF+Q++   ++R
Sbjct  670  VSELWNFRKNRKATMKEVLRFIFQQMEVPGKRR  702



>ref|XP_007206603.1| hypothetical protein PRUPE_ppa020716mg, partial [Prunus persica]
 gb|EMJ07802.1| hypothetical protein PRUPE_ppa020716mg, partial [Prunus persica]
Length=687

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  406
            +S R+ IG++ MG++D K F    K+++S EEADVKA+ELCSLWQE ++DP+W+PFR+I 
Sbjct  545  SSSRASIGVKIMGDLDEKPFQTATKKKYSEEEADVKAVELCSLWQEHLRDPSWYPFRIIT  604

Query  405  IHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
              + + ++IINE+D++L  LK E G+E+   V  A++E+NEYNASGRY IPELWNFKEGR
Sbjct  605  DKEGKTKEIINEEDDKLKALKNELGDEVYEKVTTAMKELNEYNASGRYTIPELWNFKEGR  664

Query  228  KATLKEVVSFIFKQLK-THKRKR  163
            KA+L+E V F+  + K   KRKR
Sbjct  665  KASLEEGVVFLLNKWKLLRKRKR  687



>gb|EAY85442.1| hypothetical protein OsI_06823 [Oryza sativa Indica Group]
Length=537

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE--EADVKALELCSLWQEK  445
            K LI GLS+LL   RS IG++RMGE+D K F   CK+R+ T   EA++KA E CS WQE 
Sbjct  385  KALISGLSELLGP-RSTIGLKRMGELDEKPFLAACKKRYGTADGEAEIKAAEFCSEWQEN  443

Query  444  VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            +KD NWHPF+++    + EQIINEDDE+L  LKE+ G+E+  AV  A+ E+NEYNASG Y
Sbjct  444  LKDANWHPFKIVTRGGKTEQIINEDDEKLVGLKEQLGDEVYKAVTTALLEINEYNASGSY  503

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            V+ ELWN KE RKA+++E +  + +Q K  +R+R
Sbjct  504  VVSELWNNKEDRKASMQEALQHVLEQWKLRRRRR  537



>dbj|BAD21477.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAH01332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE--EADVKALELCSLWQEK  445
            K LI GLS+LL   RS IG++RMGE+D K F   CK+R+ T   EA++KA E CS WQE 
Sbjct  476  KALISGLSELLGP-RSTIGLKRMGELDEKPFLAACKKRYGTADGEAEIKAAEFCSEWQEN  534

Query  444  VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            +KD NWHPF+++    + EQIINEDDE+L  LKE+ G+E+  AV  A+ E+NEYNASG Y
Sbjct  535  LKDANWHPFKIVTRGGKTEQIINEDDEKLVGLKEQLGDEVYKAVTTALLEINEYNASGSY  594

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            V+ ELWN KE RKA+++E +  + +Q K  +R+R
Sbjct  595  VVSELWNNKEDRKASMQEALQHVLEQWKLRRRRR  628



>ref|XP_003569414.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=628

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF N C+Q+ S E+A+V A  LCS W+ ++K
Sbjct  478  KELENGLLDL-SGGQAHIGIKRMGELDLKAFSNACRQKSSKEDAEVTAAILCSKWEAEIK  536

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPF+V+ +  +  +II+  D +L +LKEE G+EI A V KA+ E+N+YNAS RY +
Sbjct  537  NPDWHPFKVVMVDGKAMEIIDAGDAKLQELKEEHGDEIYALVTKALCELNKYNASTRYPV  596

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNF+E RKA+LKE V F+ +Q + +++KR
Sbjct  597  GELWNFREERKASLKEAVQFVLRQWRMNRKKR  628



>gb|EEE56772.1| hypothetical protein OsJ_06333 [Oryza sativa Japonica Group]
Length=720

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE--EADVKALELCSLWQEK  445
            K LI GLS+LL   RS IG++RMGE+D K F   CK+R+ T   EA++KA E CS WQE 
Sbjct  568  KALISGLSELLGP-RSTIGLKRMGELDEKPFLAACKKRYGTADGEAEIKAAEFCSEWQEN  626

Query  444  VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            +KD NWHPF+++    + EQIINEDDE+L  LKE+ G+E+  AV  A+ E+NEYNASG Y
Sbjct  627  LKDANWHPFKIVTRGGKTEQIINEDDEKLVGLKEQLGDEVYKAVTTALLEINEYNASGSY  686

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            V+ ELWN KE RKA+++E +  + +Q K  +R+R
Sbjct  687  VVSELWNNKEDRKASMQEALQHVLEQWKLRRRRR  720



>emb|CDP10823.1| unnamed protein product [Coffea canephora]
Length=738

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D     R+ I ++RMGE+D K FH+  +++FS  EA  KA+ELCSLW++ ++
Sbjct  587  KELINGLKD----SRAFIHVKRMGELDEKPFHSAAERKFSHTEAAEKAIELCSLWEDNLR  642

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHP+RVI   +  ++II+E+DE+L  L++E+G+E+  AV+KA++E+NEYN SGRY +
Sbjct  643  DPSWHPYRVIIDGENAKEIIDENDEKLKSLEDEYGDEVYQAVVKALDEMNEYNPSGRYPL  702

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN K GRKA+L+E V  I K  K +KRKR
Sbjct  703  PELWNLKAGRKASLREGVEHILKLWKVNKRKR  734



>emb|CDX67967.1| BnaA07g20070D [Brassica napus]
Length=639

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GLS LL S R++I I+R+GE+D K F   CK++F  EEA+V+   LCS WQE +KD 
Sbjct  486  LIGGLSGLL-SDRTNIRIKRLGELDEKPFLKACKKKFKGEEAEVQYAILCSKWQETLKDS  544

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+ +   D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P 
Sbjct  545  GWYPFKRVGTEDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPA  604

Query  252  LWNFKEGRKATLKEVVSFI---FKQLKTHKRKR  163
            LWNFKE RKATLKEV+ ++    K LK  KRKR
Sbjct  605  LWNFKEKRKATLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_010241796.1| PREDICTED: factor of DNA methylation 1-like [Nelumbo nucifera]
Length=538

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL + +N G S IGI+R+GE++ K F +VC Q+F +   ++K  ELCSLWQE ++
Sbjct  383  KELINGLQNFIN-GHSVIGIKRLGELNEKPFRDVCLQKFPSGGWEIKFSELCSLWQENIR  441

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D  WHPFR I+++ + ++II+  D++L++L++EWGE +C AV+ A+ E+NE N SGRY +
Sbjct  442  DSEWHPFRKISVNGKLQEIIDLSDKKLTELRDEWGEAVCEAVVTALLEINECNPSGRYAV  501

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHK  172
             ELWN+KE R+A+LKEV+ +I KQLK  K
Sbjct  502  CELWNYKEERRASLKEVIQYILKQLKNLK  530



>ref|XP_010651011.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651012.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651013.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 emb|CBI16121.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -1

Query  582  SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  403
            SGR+ I +++MG++D K F    K+++S EEA+ KALE CSLW++ + D +WHPF+VI  
Sbjct  486  SGRAFIAVKQMGDLDTKPFQKAMKRKYSEEEANEKALEWCSLWEQNLTDSSWHPFKVITD  545

Query  402  HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  223
                ++II+E+DE L  L+ E+G+E+  AV  A++E+NEYN SGRYV+ ELWNFKEGRKA
Sbjct  546  KGNCKEIIDEEDERLKDLQNEYGDEVYMAVTDALKEMNEYNPSGRYVVSELWNFKEGRKA  605

Query  222  TLKEVVSFIFKQLKTHKRKR  163
            TL+E V  I KQ + HKRKR
Sbjct  606  TLREGVEDILKQWRLHKRKR  625



>ref|XP_011027214.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Populus euphratica]
Length=749

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R+HIG++RMGE+D K F    K++++ EEA+ +A E+CSLW+E +K
Sbjct  598  KELINGLKEI--SNRAHIGVKRMGELDSKPFLEAMKRKYNNEEAEDRASEICSLWEEYLK  655

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+V+ +  + ++II+E+DE+LS+L++E G+E   +V  ++ +VNEYN SGRY+I
Sbjct  656  DPDWHPFKVVMVDGKHQEIIDEEDEKLSRLRDEMGDEAYMSVRTSLIQVNEYNPSGRYII  715

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN+KEG+KATL E VSF+  + K  KRKR
Sbjct  716  SELWNYKEGKKATLGEGVSFLLSRWKALKRKR  747



>ref|XP_008457475.1| PREDICTED: centrosomal protein of 83 kDa [Cucumis melo]
 ref|XP_008457476.1| PREDICTED: centrosomal protein of 83 kDa [Cucumis melo]
Length=739

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  409
            +S R+ I ++RMG++D K F    K +++ +EAD KALELCS W+++++D +WHPFR+I 
Sbjct  597  SSTRAFITVKRMGDLDSKPFCTATKLKYAKDEADAKALELCSKWEDQLRDSSWHPFRIIV  656

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + ++IINE+DE+L  LK E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKEGR
Sbjct  657  DDAGQAKEIINENDEKLKNLKNEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEGR  716

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKE V+ I KQ K HKR++
Sbjct  717  KATLKEGVAHILKQWKLHKRRK  738



>ref|XP_008223681.1| PREDICTED: uncharacterized protein PFB0765w [Prunus mume]
Length=685

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  406
            +S R+ IG++ MG++D K F    K+++S EEADVKA+ELCSLWQE ++DP+W+PFR+I 
Sbjct  543  SSSRASIGVKIMGDLDEKPFQTATKKKYSEEEADVKAVELCSLWQEHLRDPSWYPFRIIT  602

Query  405  IHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
              + + ++IINE+D++L  LK E G+E+   V  A++E+NEYNASGRY IPELWNFKEGR
Sbjct  603  DKEGKTKEIINEEDDKLKALKNELGDEVYEKVTTAMKELNEYNASGRYTIPELWNFKEGR  662

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KA L+E V F+  + K  +R++
Sbjct  663  KALLEEGVVFLLNKWKLLRRRK  684



>ref|XP_004969258.1| PREDICTED: uncharacterized protein LOC101768687 isoform X2 [Setaria 
italica]
Length=158

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L +G  DL  SGR+HIGI+  G++D K F N C++R S  +  + A++LCS WQE+VK
Sbjct  7    KELEKGFDDLSTSGRAHIGIKIAGQLDQKPFLNACRRRPSEGDLQLDAVKLCSKWQEEVK  66

Query  438  DPNWHPFRVINIHDR-PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            + NWHP +V+ +  + PE+II  DD +L +LK+E+G+E+  AV KA+ E++EYNASGRY 
Sbjct  67   NSNWHPIKVVEVDGKEPERIIE-DDAKLRELKQEYGQEVYEAVTKALLEMDEYNASGRYC  125

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             P +WNFK  R+A LKE V FI KQ ++ KRKR
Sbjct  126  KPVVWNFKADRRALLKEGVQFIVKQWQSRKRKR  158



>ref|XP_006602003.1| PREDICTED: microtubule-associated tumor suppressor 1 homolog 
[Glycine max]
Length=356

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -1

Query  579  GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  400
            GRS +GI+RMGE+D K F ++C Q++S E+   K+ +LCS W+E +KDP WHPF  I ++
Sbjct  217  GRSQLGIKRMGELDPKPFQHLCLQKYSDEQWQEKSAKLCSAWEENLKDPTWHPFNKIEVN  276

Query  399  DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  220
               ++ ++E+DE+L  L+ E GE +  AV  A+ E+ EYN+SGRY I E+WN+KEGRKAT
Sbjct  277  GILQETLDENDEKLKGLRSECGEAVYQAVTNALMEIEEYNSSGRYAIAEIWNWKEGRKAT  336

Query  219  LKEVVSFIFKQLKTHKRKR  163
            LKE+V  I +QL +HKRKR
Sbjct  337  LKEIVQHIIRQLNSHKRKR  355



>ref|XP_004147687.1| PREDICTED: uncharacterized protein LOC101219429 [Cucumis sativus]
Length=643

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K +I    DL   GRSH+ I+RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +K
Sbjct  489  KEIINAFKDL--PGRSHLRIKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLK  546

Query  438  DPNWHPFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEY  283
            DP+WHPF+VI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEY
Sbjct  547  DPDWHPFKVIKVEGKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALVEINEY  606

Query  282  NASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  184
            N SGRY+  ELWN++EG++ATL+E V F+  +L
Sbjct  607  NPSGRYITSELWNYQEGKRATLREGVRFLLDKL  639



>ref|XP_008384852.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
[Malus domestica]
Length=700

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D  ++ R+ IG++RMG++D K F    K+++S E AD KA+E CSLW+  ++
Sbjct  549  KELISGLWD--STHRATIGVKRMGDLDQKPFQIATKEKYSNEAADEKAVEYCSLWEAYLR  606

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DPNWHPF++I   + +P +II+E+D++L  LK + G+E+  AV  A+ E+NEYN SGRY+
Sbjct  607  DPNWHPFKIITDQEGKPTEIIDENDDKLKDLKNQLGDEVYKAVTTALMEMNEYNPSGRYI  666

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            IPELWNFKEGRKA+LKE   F+  + K  +++R
Sbjct  667  IPELWNFKEGRKASLKEGAVFLLSKWKPLRKRR  699



>dbj|BAD68892.1| X1-like [Oryza sativa Japonica Group]
Length=202

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DLL+ G+SHIGI+RMGE+D +AF   C++  S E+A++ A  LCS WQ ++K
Sbjct  53   KELENGLLDLLD-GQSHIGIKRMGELDLEAFSKACRKMSSEEDAEITAAILCSKWQAEIK  111

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFR + +  + ++II +D +     +E  GE+I   V  A+ E+NEYN SGR+ +
Sbjct  112  NPDWHPFRFVLVDGQEKEIIEDDAKLQELKEEH-GEDIYRLVRDALCEINEYNPSGRFPV  170

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFK+ RKATLKE V F+ +Q + ++RKR
Sbjct  171  GELWNFKDKRKATLKETVQFVLRQWRANRRKR  202



>ref|XP_009343557.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=646

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++  S  + IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP
Sbjct  495  LINGLKEI--SSSAQIGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDP  552

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+V  +  + +++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  E
Sbjct  553  EWHPFKVTTVDGKHKEVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSE  612

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWN+KEGR+A+LKE V+FI  Q KT KR+
Sbjct  613  LWNYKEGRRASLKEGVAFILNQWKTKKRR  641



>ref|XP_010523138.1| PREDICTED: factor of DNA methylation 4 [Tarenaya hassleriana]
Length=741

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI  L  L  + RS IG+++MGE+D K F    ++++  E+ADVKA +LCSLW+E ++
Sbjct  587  KALITALGGL--TARSRIGVKKMGELDKKPFRKAVEEKYPAEKADVKAAKLCSLWEEYLR  644

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+VI  +   E+I+NE+DE+L  LK E+G+E+  AV+KA+ E+ EYN SGRYV+
Sbjct  645  DPSWHPFKVIERNGEAEEILNEEDEKLQGLKSEFGDEVFEAVVKALREMVEYNGSGRYVV  704

Query  258  PELWNFKEGRKATLKEVVSFIFK-----QLKTHKRKR  163
            PELWN  EGRKATL+E  SF+       + K  KRKR
Sbjct  705  PELWNLVEGRKATLEEGCSFLLDMWKRVKPKPTKRKR  741



>gb|KJB83761.1| hypothetical protein B456_013G263400 [Gossypium raimondii]
Length=441

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 113/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI    D+  S R+HIG+++MGE+D K F    K+++S +EADVK+ ELC+LWQ+ ++
Sbjct  290  KELITAFKDV--STRAHIGVKKMGEVDIKPFLVAAKRKYSAKEADVKSAELCTLWQDYLR  347

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+WHPF+++   +   ++I++E+DE+L +LK E G+E   AV  A++++NEYN SGRYV
Sbjct  348  DPSWHPFKILKDKEGNCKEILDEEDEKLVELKTELGDEAYNAVTMALKQMNEYNPSGRYV  407

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
            +PELWNF EGRKATL + V  +  + K HKR+R+
Sbjct  408  VPELWNFNEGRKATLTDGVQHLLNKWKLHKRRRY  441



>ref|XP_004969257.1| PREDICTED: uncharacterized protein LOC101768687 isoform X1 [Setaria 
italica]
Length=191

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = -1

Query  603  GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  424
            G  DL  SGR+HIGI+  G++D K F N C++R S  +  + A++LCS WQE+VK+ NWH
Sbjct  45   GFDDLSTSGRAHIGIKIAGQLDQKPFLNACRRRPSEGDLQLDAVKLCSKWQEEVKNSNWH  104

Query  423  PFRVINIHDR-PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  247
            P +V+ +  + PE+II  DD +L +LK+E+G+E+  AV KA+ E++EYNASGRY  P +W
Sbjct  105  PIKVVEVDGKEPERIIE-DDAKLRELKQEYGQEVYEAVTKALLEMDEYNASGRYCKPVVW  163

Query  246  NFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            NFK  R+A LKE V FI KQ ++ KRKR
Sbjct  164  NFKADRRALLKEGVQFIVKQWQSRKRKR  191



>gb|KHG06632.1| KilA-N domain-containing protein [Gossypium arboreum]
Length=640

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 113/154 (73%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R++IG++RMGE+DGK F    K+R++ E A+ +A E+CSLW+E +K
Sbjct  486  KELINGLKEI--SRRANIGVKRMGELDGKPFLEAMKRRYNEELAEERASEMCSLWEEYLK  543

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +  R E  ++I+++DE+L  LK E G E   +V  A++E+NEYN SGRY
Sbjct  544  DPDWHPFKRIKLEGREEYQEVIDDEDEKLRDLKAEMGNEAYKSVTSAIKEINEYNPSGRY  603

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            VI ELWN++EGRKA+LKE V F+ +  +T KR+R
Sbjct  604  VISELWNYREGRKASLKEGVEFLLELWETVKRRR  637



>gb|KDP20451.1| hypothetical protein JCGZ_05296 [Jatropha curcas]
Length=710

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL +     R+ I +++MGE+DG+ FH   K++FS EEAD+KA ELCSLW   ++
Sbjct  560  KELMTGLGE---DTRAFIHVKKMGELDGRPFHTAAKRKFSDEEADMKAGELCSLWDHCLR  616

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP WHPF++I   +   E+I+NEDDE+L +LK E+G E+  AV KA++E+NEYN SGRY+
Sbjct  617  DPGWHPFKIITDKEGHSEEILNEDDEKLKELKSEYGLEVYVAVTKALKEINEYNPSGRYI  676

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + E+WN KE RKA+LKE V  + KQ K HKRK+
Sbjct  677  VREIWNSKENRKASLKEGVVHLLKQWKLHKRKK  709



>ref|XP_010429902.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
 ref|XP_010429903.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  436
            +L   L +LL S R+ I ++R+GE+D K F   CKQRF+ EEA+V+   LCS WQE +KD
Sbjct  484  VLTTELRELL-SERTIIRVKRVGELDEKPFMKACKQRFTAEEAEVQHAILCSKWQENLKD  542

Query  435  PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            P WHPF+ +   D+ +++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P
Sbjct  543  PAWHPFKHVGTGDKKKEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVP  602

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKT-HKRKR  163
             LW+ K+GRKA+LKEV+ ++ +QLK   KRKR
Sbjct  603  VLWHSKQGRKASLKEVIDYMTQQLKVLKKRKR  634



>gb|AAM22638.2|AF434195_1 X1 [Zea mays]
Length=398

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K
Sbjct  250  KELENGLLDL-SGGQTHIGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIK  307

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ I D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y +
Sbjct  308  NPDWHPFRVVTI-DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPV  366

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  367  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  398



>ref|XP_009357740.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=642

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++  S  +HIG+RRMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP
Sbjct  491  LINGLKEI--SSSAHIGVRRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDP  548

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+V  +  + +++I+ +DE+L  L +E GEE+  AV  A+ E+NEYN SGRY+  E
Sbjct  549  EWHPFKVTTVDGKHKEVISVEDEKLKDLMKELGEEVYNAVTSALTEINEYNPSGRYITSE  608

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWN+KEGR+A+LKE V+FI  Q KT KR+
Sbjct  609  LWNYKEGRRASLKEGVTFILNQWKTKKRR  637



>ref|XP_004242072.2| PREDICTED: factor of DNA methylation 4-like [Solanum lycopersicum]
 ref|XP_010322356.1| PREDICTED: factor of DNA methylation 4-like [Solanum lycopersicum]
Length=412

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 109/151 (72%), Gaps = 4/151 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +     R+ IG++RMGE+DGK FH   K++F+ +EA  KA+E+CSLW++ ++
Sbjct  264  KELIHGLRE----SRAFIGVKRMGELDGKPFHAAAKRKFNPKEAAEKAVEICSLWEDYLR  319

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHP+++I      E+II++DDE+L +LK E+G+E+  +V+ A+ E+NE+N SGRY +
Sbjct  320  DPNWHPYKIIQKGHTAEEIIDDDDEKLKELKAEYGDEVYQSVVTALNELNEHNPSGRYPV  379

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            P LW++KE R  +L E V  I KQ K HK+K
Sbjct  380  PALWHYKEKRTVSLNEGVKHIMKQWKAHKKK  410



>ref|XP_008343538.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++  S  + IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP
Sbjct  492  LINGLKEI--SSSAQIGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDP  549

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+V  +  + +++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  E
Sbjct  550  EWHPFKVTTVDGKHKEVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSE  609

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWN+KEGR+A+LK+ V+FI  Q KT KR+
Sbjct  610  LWNYKEGRRASLKDGVAFILNQWKTKKRR  638



>gb|KGN50554.1| hypothetical protein Csa_5G182100 [Cucumis sativus]
Length=781

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K +I    DL   GRSH+ I+RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +K
Sbjct  627  KEIINAFKDL--PGRSHLRIKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLK  684

Query  438  DPNWHPFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEY  283
            DP+WHPF+VI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEY
Sbjct  685  DPDWHPFKVIKVEGKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALVEINEY  744

Query  282  NASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  184
            N SGRY+  ELWN++EG++ATL+E V F+  +L
Sbjct  745  NPSGRYITSELWNYQEGKRATLREGVRFLLDKL  777



>ref|XP_008354129.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++  S  + IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP
Sbjct  492  LINGLKEI--SSSAQIGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDP  549

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+V  +  + +++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  E
Sbjct  550  EWHPFKVTTVDGKHKEVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSE  609

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWN+KEGR+A+LK+ V+FI  Q KT KR+
Sbjct  610  LWNYKEGRRASLKDGVAFILXQWKTXKRR  638



>ref|XP_008371804.1| PREDICTED: WEB family protein At4g27595, chloroplastic [Malus 
domestica]
Length=642

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI GL ++  S  +HIG+RRMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP
Sbjct  491  LINGLKEI--SSSAHIGVRRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDP  548

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+V  +  + +++I+ +DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+  E
Sbjct  549  EWHPFKVTTVDGKHKEVISVEDEKLKDLKKELGEEVSNAVTSALTEINEYNPSGRYITSE  608

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWN+KEGR+A+LKE V FI  Q KT KR+
Sbjct  609  LWNYKEGRRASLKEGVVFILNQWKTKKRR  637



>emb|CDY52860.1| BnaA09g56520D [Brassica napus]
Length=638

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDG-KAFHNVCKQRFSTEEADVKALELCSLWQEKV  442
            K LI  L+ LL +  S IG++RMGE++  + F N CK+R+S +EA V+ + LCS WQ+ +
Sbjct  486  KTLIARLTGLLGA-ESDIGVKRMGELENLEPFLNACKKRYSADEAMVEGVTLCSTWQKNI  544

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             D  W PF+     D+  ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY 
Sbjct  545  NDSTWQPFKREGTGDKAIEVVDEEDEKLKKLKGEWGEEVHNAVKTALEEMNEYNPSGRYS  604

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             PELWNF+ GRKATLKEV+SFI   +K  KRKR
Sbjct  605  TPELWNFEAGRKATLKEVISFISNDMKPVKRKR  637



>ref|XP_009117794.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117795.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117796.1| PREDICTED: myosin-11-like [Brassica rapa]
Length=638

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDG-KAFHNVCKQRFSTEEADVKALELCSLWQEKV  442
            K LI  L+ LL +  S IG++RMGE++  + F N CK+R+S +EA V+ + LCS WQ+ +
Sbjct  486  KTLIARLTGLLGA-ESDIGVKRMGELENLEPFLNACKKRYSADEAMVEGVTLCSTWQKNI  544

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             D  W PF+     D+  ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY 
Sbjct  545  NDSTWQPFKREGTGDKAIEVVDEEDEKLKKLKGEWGEEVHNAVKTALEEMNEYNPSGRYS  604

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             PELWNF+ GRKATLKEV+SFI   +K  KRKR
Sbjct  605  TPELWNFEAGRKATLKEVISFISNDMKPVKRKR  637



>gb|KDO69291.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
 gb|KDO69292.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=639

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI  L +L  SGR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +K
Sbjct  486  KELINALKEL--SGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+VI    + ++IINE+DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+ 
Sbjct  544  DPDWHPFKVITAEGKHKEIINEEDEKLKGLKKEMGEEVYIAVTTALVEINEYNPSGRYIT  603

Query  258  PELWNFKEGRKATLKEVVSFIFKQLK  181
             ELWN+KEGRKATL+E V+F+ KQ K
Sbjct  604  SELWNYKEGRKATLQEGVAFLMKQWK  629



>gb|EMT17491.1| hypothetical protein F775_14734 [Aegilops tauschii]
Length=1285

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL DLL   RS+IGIRRMG++D K F   CK ++  E AD KALE CS+WQ+ ++
Sbjct  477  KELISGLVDLLGP-RSNIGIRRMGQVDEKPFIEACKPKYGAE-ADTKALEFCSMWQDNLR  534

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D NWHPF+++   ++ EQII++ DE+L  LKEE GEE+  AV  A+ E+NEYNASG YV+
Sbjct  535  DANWHPFKIVTRGEKSEQIIDKGDEKLVGLKEELGEEVYKAVTTALVEMNEYNASGSYVV  594

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKT  178
             ELWN KE RKA++ EVV  I KQ K 
Sbjct  595  SELWNNKESRKASMGEVVEHILKQWKA  621



>gb|KJB83759.1| hypothetical protein B456_013G263400 [Gossypium raimondii]
 gb|KJB83762.1| hypothetical protein B456_013G263400 [Gossypium raimondii]
 gb|KJB83763.1| hypothetical protein B456_013G263400 [Gossypium raimondii]
Length=513

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 113/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI    D+  S R+HIG+++MGE+D K F    K+++S +EADVK+ ELC+LWQ+ ++
Sbjct  362  KELITAFKDV--STRAHIGVKKMGEVDIKPFLVAAKRKYSAKEADVKSAELCTLWQDYLR  419

Query  438  DPNWHPFRVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+WHPF+++   +   ++I++E+DE+L +LK E G+E   AV  A++++NEYN SGRYV
Sbjct  420  DPSWHPFKILKDKEGNCKEILDEEDEKLVELKTELGDEAYNAVTMALKQMNEYNPSGRYV  479

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
            +PELWNF EGRKATL + V  +  + K HKR+R+
Sbjct  480  VPELWNFNEGRKATLTDGVQHLLNKWKLHKRRRY  513



>gb|KJB83760.1| hypothetical protein B456_013G263400 [Gossypium raimondii]
Length=532

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 113/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI    D+  S R+HIG+++MGE+D K F    K+++S +EADVK+ ELC+LWQ+ ++
Sbjct  381  KELITAFKDV--STRAHIGVKKMGEVDIKPFLVAAKRKYSAKEADVKSAELCTLWQDYLR  438

Query  438  DPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            DP+WHPF+++ +     ++I++E+DE+L +LK E G+E   AV  A++++NEYN SGRYV
Sbjct  439  DPSWHPFKILKDKEGNCKEILDEEDEKLVELKTELGDEAYNAVTMALKQMNEYNPSGRYV  498

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  160
            +PELWNF EGRKATL + V  +  + K HKR+R+
Sbjct  499  VPELWNFNEGRKATLTDGVQHLLNKWKLHKRRRY  532



>ref|XP_007220898.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
 gb|EMJ22097.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
Length=641

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL ++  S R+HIG++RMGE+D K F    K++++ EEA+ KA ELCSLW+E +K
Sbjct  490  KELVNGLKEI--SNRAHIGVKRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLK  547

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPFRV  +  + ++ INE DE+L  LK++ G+E+  AV  A++E+NEYN SGRY+ 
Sbjct  548  DPDWHPFRVTTVDGQHKEFINEQDEKLKDLKKQLGDEVYNAVTSALKEINEYNPSGRYIT  607

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKRHD  157
             ELWN+ EGR+A+L+E V FI KQ K  K++  D
Sbjct  608  SELWNYAEGRRASLQEGVDFILKQWKQKKQRMED  641



>ref|XP_011461210.1| PREDICTED: factor of DNA methylation 4 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=693

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  618  KLLIQGL---SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            K L+ GL   S  +N  R +IG++RMG++D + F    K R+S EEADVK LE+CSLW+ 
Sbjct  536  KELVYGLWNASIQVNKPRVNIGVKRMGDLDVRPFQIAIKSRYSKEEADVKTLEVCSLWET  595

Query  447  KVKDPNWHPFRVINIH-DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             + DPNWHPF++I     R ++II+++DE+L+ LK E G+++  AV+ A+ E+NEYN SG
Sbjct  596  YLADPNWHPFKIITDEAGRSKEIIDDEDEKLAGLKNELGDDVYQAVVTAMMELNEYNPSG  655

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            RY + ELWN+KEGRKATLKE  S+I KQ K  K +R
Sbjct  656  RYSVNELWNYKEGRKATLKEGASYILKQWKVLKGRR  691



>ref|XP_003568833.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=700

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+L SG + IG++RMGE+D + F N C+++F  ++ +++A +L S WQE++K
Sbjct  547  KELIAGLEDML-SGHTAIGVKRMGELDERPFQNACRKKFGNDDYEMRAAQLVSSWQEEIK  605

Query  438  DPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P WHP++++ + +   +++++EDD  L +L  E+G+++C AV  A+ EVNEYN SGRY 
Sbjct  606  KPAWHPYKIVKDENGEHKEVLDEDDPRLHELWIEYGDDVCNAVKTALSEVNEYNPSGRYA  665

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWNFK+ RKAT+KEV+ +I  Q+ T  ++R
Sbjct  666  VPELWNFKKARKATMKEVLRYISLQMGTTSKRR  698



>ref|XP_008233634.1| PREDICTED: LOW QUALITY PROTEIN: CAP-Gly domain-containing linker 
protein 1 [Prunus mume]
Length=633

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL ++  S R+HIG++RMGE+D K F    K++++ EEA+ KA ELCSLW+E +K
Sbjct  482  KELVNGLKEI--SNRAHIGVKRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLK  539

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPFRV  +  + ++ INE DE+L  LK++ G+E+  AV  A++E+NEYN SGRY+ 
Sbjct  540  DPDWHPFRVTTVDGQHKEFINEQDEKLKDLKKQLGDEVYNAVTSALKEINEYNPSGRYIT  599

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKRHD  157
             ELWN+ EGR+A+L+E V FI KQ K  K++  D
Sbjct  600  SELWNYAEGRRASLQEGVDFILKQWKIKKQRMED  633



>emb|CDX79353.1| BnaC06g19500D [Brassica napus]
Length=639

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = -1

Query  582  SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  403
            S R++I I+R+GE+D K F   CK+RF  EEA+V+   LCS WQE +KD  W+PF+ +  
Sbjct  495  SDRTNIRIKRLGELDEKPFLKACKKRFKGEEAEVQYAILCSKWQETLKDSGWYPFKRVGT  554

Query  402  HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  223
             D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LWNFKE RKA
Sbjct  555  EDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPALWNFKEKRKA  614

Query  222  TLKEVVSFI---FKQLKTHKRKR  163
            TLKEV+ ++    K LK  KRKR
Sbjct  615  TLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_010108755.1| hypothetical protein L484_011413 [Morus notabilis]
 gb|EXC20169.1| hypothetical protein L484_011413 [Morus notabilis]
Length=681

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +   S R+  G++RMGE+D + F    K+++S EEA+ +A+ELCSLW E +K
Sbjct  529  KELISGLKE--TSSRATTGVKRMGELDTQPFLESMKRKYSEEEAEDRAMELCSLWDEYLK  586

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+V  +  + ++II++ DE+L  LK+E G ++  AV +A+ E+NEYN SGRY+ 
Sbjct  587  DPDWHPFKVTMVDGKHKEIIDDKDEKLKALKKEMGADVYNAVTRALIEINEYNPSGRYIT  646

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKR  169
            PELWN +EGR+ATLKE V  I  Q +T KR
Sbjct  647  PELWNCQEGRRATLKEGVEVILNQWRTKKR  676



>ref|XP_004294497.2| PREDICTED: factor of DNA methylation 4 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  618  KLLIQGL---SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            K L+ GL   S  +N  R +IG++RMG++D + F    K R+S EEADVK LE+CSLW+ 
Sbjct  565  KELVYGLWNASIQVNKPRVNIGVKRMGDLDVRPFQIAIKSRYSKEEADVKTLEVCSLWET  624

Query  447  KVKDPNWHPFRVINIH-DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             + DPNWHPF++I     R ++II+++DE+L+ LK E G+++  AV+ A+ E+NEYN SG
Sbjct  625  YLADPNWHPFKIITDEAGRSKEIIDDEDEKLAGLKNELGDDVYQAVVTAMMELNEYNPSG  684

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            RY + ELWN+KEGRKATLKE  S+I KQ K  K +R
Sbjct  685  RYSVNELWNYKEGRKATLKEGASYILKQWKVLKGRR  720



>ref|XP_011461209.1| PREDICTED: factor of DNA methylation 4 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=726

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  618  KLLIQGL---SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            K L+ GL   S  +N  R +IG++RMG++D + F    K R+S EEADVK LE+CSLW+ 
Sbjct  569  KELVYGLWNASIQVNKPRVNIGVKRMGDLDVRPFQIAIKSRYSKEEADVKTLEVCSLWET  628

Query  447  KVKDPNWHPFRVINIH-DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             + DPNWHPF++I     R ++II+++DE+L+ LK E G+++  AV+ A+ E+NEYN SG
Sbjct  629  YLADPNWHPFKIITDEAGRSKEIIDDEDEKLAGLKNELGDDVYQAVVTAMMELNEYNPSG  688

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            RY + ELWN+KEGRKATLKE  S+I KQ K  K +R
Sbjct  689  RYSVNELWNYKEGRKATLKEGASYILKQWKVLKGRR  724



>ref|XP_010429908.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=232

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEE-ADVKALELCSLWQEKV  442
            K LI+G  DL    RS IG++RMG++D K F  VCKQRF+ EE  +++   LC  WQ  V
Sbjct  79   KELIRGFRDLSCDDRSTIGVKRMGQLDKKPFIQVCKQRFTGEENIELEHDMLCWKWQRTV  138

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             DP+W+PF+ ++  ++ +++++E+D++L  L+EEWGE++  AV  A+EE+NE+N SGRY 
Sbjct  139  TDPSWYPFKRVSSGEKMKEVVDEEDDKLKTLREEWGEDVKNAVKTALEELNEFNPSGRYT  198

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            +P LWNF++GRKATLKE ++ + K++K  KR+
Sbjct  199  VPLLWNFEQGRKATLKEGIAQMTKEVKALKRQ  230



>ref|NP_001050601.2| Os03g0596400 [Oryza sativa Japonica Group]
 gb|ABF97443.1| XH domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG98077.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59448.1| hypothetical protein OsJ_11632 [Oryza sativa Japonica Group]
 dbj|BAF12515.2| Os03g0596400 [Oryza sativa Japonica Group]
Length=163

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 3/150 (2%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  436
            L +QGL  +    RS IG++RMGE+D KAF+N CK +    +  +K   +CS W++++  
Sbjct  15   LAVQGLEKMAGV-RSIIGVKRMGELDQKAFYNACKNKMPNNK--MKLALVCSKWEDEITK  71

Query  435  PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            P WHPF+VI    + ++II EDD +L  L+ ++G+E C  V+KA+ E+NEYN SG Y +P
Sbjct  72   PEWHPFKVIETAGQTKEIIKEDDGKLQALRAQYGDEACNVVVKALVEMNEYNPSGMYPVP  131

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            ELWNFK+ R A + E  S++ KQ KTHK++
Sbjct  132  ELWNFKQNRSAPMPEAASYLLKQWKTHKKR  161



>ref|XP_006435548.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 ref|XP_006486474.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Citrus sinensis]
 gb|ESR48788.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=639

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI  L +L  +GR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +K
Sbjct  486  KELINALKEL--AGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+VI    + ++IINE+DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+ 
Sbjct  544  DPDWHPFKVITAEGKHKEIINEEDEKLKGLKKEMGEEVYIAVTTALVEINEYNPSGRYIT  603

Query  258  PELWNFKEGRKATLKEVVSFIFKQLK  181
             ELWN+KEGRKATL+E V+F+ KQ K
Sbjct  604  SELWNYKEGRKATLQEGVAFLMKQWK  629



>ref|XP_002456013.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
 gb|EES01133.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
Length=629

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE+A+V A  LCS W+ ++K
Sbjct  481  KELENGLLDL-SGGQAHIGIKRMGELDLKAFSKAC-QKERTEDAEVTAAFLCSKWEAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ +  +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y +
Sbjct  539  NPDWHPFRVVTVDGKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  598  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  629



>ref|XP_006302778.1| hypothetical protein CARUB_v10020898mg [Capsella rubella]
 gb|EOA35676.1| hypothetical protein CARUB_v10020898mg [Capsella rubella]
Length=228

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQ +  L +  RS I ++ MGE+D K F   CK RF+ EEA  +   L S W + +KDP
Sbjct  77   LIQEMRKL-SGERSTIRVKCMGELDKKPFIEACKVRFTGEEAAKQHAMLRSTWLQNLKDP  135

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+ +   D  +++++E+DE++ KLK+EWGEE+  AV KA+EE+NEYNASGRYV+PE
Sbjct  136  AWHPFKHVGTGDNVKEVVDEEDEKIKKLKQEWGEEVKNAVKKALEEINEYNASGRYVVPE  195

Query  252  LWNFKEGRKATLKEVVSFIFKQL-KTHKRKRH  160
            LWNF+E RKATLKE ++ +   L KTHKRK H
Sbjct  196  LWNFREERKATLKEGIAQMKTLLIKTHKRKAH  227



>ref|XP_004240949.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Solanum lycopersicum]
Length=638

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++
Sbjct  489  KELVNGLKELPRVG--PIGVKRMGELDNRPFHEAMKRNYNESEADERATELCSLWEEYLR  546

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHP +V+ I+ +PE +I+E+DE+L  LK  +GEE+C AV  A+ EVN+YN SGRY+I
Sbjct  547  DPGWHPIKVVMINGKPENVIDEEDEKLKDLKRNYGEEVCKAVTAALMEVNDYNPSGRYII  606

Query  258  PELWNFKEGRKATLKEVVSFIF  193
             ELWN+   +KATL+E V+ + 
Sbjct  607  SELWNYAVNKKATLEEGVTVLL  628



>dbj|BAH20228.1| AT1G80790 [Arabidopsis thaliana]
Length=552

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEE-ADVKALELCSLWQEKV  442
            K LI  L +L+ S R+ I ++RMGE++ K F   C+QR + EE A V+   LCS WQEKV
Sbjct  400  KFLITELRELV-SDRNIIRVKRMGELEEKPFMTACRQRCTVEEEAQVQYAMLCSKWQEKV  458

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            KD  W PF+ +   DR +++++E+DEE+ KL+EEWGEE+  AV  A+EE+NE+N SGRY 
Sbjct  459  KDSAWQPFKHVGTGDRKKEVVDEEDEEIKKLREEWGEEVKNAVKTALEELNEFNPSGRYS  518

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWN K+GRKATLKEV+ +I +Q+KT KR+R
Sbjct  519  VPELWNSKQGRKATLKEVIDYITQQVKTLKRRR  551



>gb|EMT15579.1| hypothetical protein F775_11438 [Aegilops tauschii]
Length=632

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+  + R+ IG++RMG++D K+F   CK + S E+A+V A  LCS W+E++K
Sbjct  459  KKLIDGLRDV-TTARATIGVKRMGDLDLKSFAKACKGKMSEEDAEVTASILCSKWEEEIK  517

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHPF+VI +  R ++I+ EDDE+L +LKEE GEE+   V KA+ EVNEYN SGRY +
Sbjct  518  NPEWHPFKVIMVEGREKEILREDDEKLQELKEEHGEEVYGLVTKALLEVNEYNPSGRYSV  577

Query  258  PELWNFKEGRKATLKEVV  205
            PELWN+KE RKATLKEVV
Sbjct  578  PELWNYKENRKATLKEVV  595



>emb|CDY53226.1| BnaA02g19420D [Brassica napus]
Length=217

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+GL DL   G S I ++RMG++D K F  VCKQ+F  E  +V+   LCS WQ  + D 
Sbjct  68   LIRGLRDLSCEG-SFIRVKRMGQVDEKLFMKVCKQKFIDENVEVEYAMLCSKWQNALNDS  126

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+ +   +  +++++++DE+L  L+EEWGE++  AV  A+EE+NE+N SGRY +P 
Sbjct  127  AWHPFKRVGTGENMKEVVDDEDEKLQSLREEWGEDVKNAVKTALEEMNEFNPSGRYSVPV  186

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNF+ GRKATLKE ++ + +Q+K  KRKR
Sbjct  187  LWNFEHGRKATLKEGIAHMTQQIKNLKRKR  216



>gb|AAV69067.1| X1, partial [Zea mays subsp. mexicana]
Length=550

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K
Sbjct  402  KELENGLLDL-SGGQTHIGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIK  459

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ I D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y +
Sbjct  460  NPDWHPFRVVTI-DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPV  518

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  519  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  550



>ref|XP_006362467.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Solanum tuberosum]
Length=638

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++
Sbjct  489  KELVNGLKELPRVG--PIGVKRMGELDNRPFHEAMKRSYNESEADERATELCSLWEEYLR  546

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHP +V+ ++ +PE +I+++DE+L  LK+ +GEE+C AV  A+ EVN+YN SGRY+I
Sbjct  547  DPGWHPIKVVMVNGKPENVIDDEDEKLKDLKKNYGEEVCKAVTAALMEVNDYNPSGRYII  606

Query  258  PELWNFKEGRKATLKEVVSFIF  193
             ELWN+   +KATL+E V+ + 
Sbjct  607  SELWNYAVNKKATLEEGVTVLL  628



>ref|NP_178194.1| FACTOR OF DNA METHYLATION 5 [Arabidopsis thaliana]
 sp|Q9SAI1.1|FDM5_ARATH RecName: Full=Factor of DNA methylation 5 [Arabidopsis thaliana]
 gb|AAF14667.1|AC011713_15 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays [Arabidopsis thaliana]
 gb|AEE36451.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=634

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEE-ADVKALELCSLWQEKV  442
            K LI  L +L+ S R+ I ++RMGE++ K F   C+QR + EE A V+   LCS WQEKV
Sbjct  482  KFLITELRELV-SDRNIIRVKRMGELEEKPFMTACRQRCTVEEEAQVQYAMLCSKWQEKV  540

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            KD  W PF+ +   DR +++++E+DEE+ KL+EEWGEE+  AV  A+EE+NE+N SGRY 
Sbjct  541  KDSAWQPFKHVGTGDRKKEVVDEEDEEIKKLREEWGEEVKNAVKTALEELNEFNPSGRYS  600

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +PELWN K+GRKATLKEV+ +I +Q+KT KR+R
Sbjct  601  VPELWNSKQGRKATLKEVIDYITQQVKTLKRRR  633



>ref|NP_001146275.1| putative transcription factor [Zea mays]
 gb|AAM22636.1|AF434193_1 X1 [Zea mays]
 gb|ACL53618.1| unknown [Zea mays]
 gb|ACN27531.1| unknown [Zea mays]
 tpg|DAA58437.1| TPA: putative XH domain family protein isoform 1 [Zea mays]
 tpg|DAA58438.1| TPA: putative XH domain family protein isoform 2 [Zea mays]
 tpg|DAA58439.1| TPA: putative XH domain family protein isoform 3 [Zea mays]
Length=628

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K
Sbjct  480  KELENGLLDL-SGGQTHIGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIK  537

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ I D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y +
Sbjct  538  NPDWHPFRVVTI-DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPV  596

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  597  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  628



>gb|KJB67635.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=640

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 112/154 (73%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S R++IG++RMGE+DGK F    K+R++ E A+ +A E+CSLW+E +K
Sbjct  486  KELINGLKEI--SRRANIGVKRMGELDGKPFLEAMKRRYNEELAEERASEMCSLWEEYLK  543

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +    E  ++I+++DE+L  LK E G E   +V  A++E+NEYN SGRY
Sbjct  544  DPDWHPFKRIKLEGGEEYQEVIDDEDEKLRDLKAEMGNEAYKSVTLAIKEINEYNPSGRY  603

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            VI ELWN++EGRKA+LKE V F+ +  +T KR+R
Sbjct  604  VISELWNYREGRKASLKEGVEFLLELWETVKRRR  637



>gb|AAV69069.1| X1, partial [Zea luxurians]
Length=550

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K
Sbjct  402  KELENGLLDL-SGGQTHIGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIK  459

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ + D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y +
Sbjct  460  NPDWHPFRVVTV-DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPV  518

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  519  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  550



>ref|XP_006362466.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Solanum tuberosum]
Length=653

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L+ GL +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++
Sbjct  504  KELVNGLKELPRVG--PIGVKRMGELDNRPFHEAMKRSYNESEADERATELCSLWEEYLR  561

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP WHP +V+ ++ +PE +I+++DE+L  LK+ +GEE+C AV  A+ EVN+YN SGRY+I
Sbjct  562  DPGWHPIKVVMVNGKPENVIDDEDEKLKDLKKNYGEEVCKAVTAALMEVNDYNPSGRYII  621

Query  258  PELWNFKEGRKATLKEVVSFIF  193
             ELWN+   +KATL+E V+ + 
Sbjct  622  SELWNYAVNKKATLEEGVTVLL  643



>ref|XP_010417660.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  436
            +L   L +LL S R+ I ++R+GE+D K F   CK+RF+ EEA V+   LCS WQE +KD
Sbjct  484  VLTTELRELL-SERTIIRVKRVGELDEKPFMKACKERFTGEEAAVQHAILCSKWQENLKD  542

Query  435  PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
            P W PF+ +   D+ +++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P
Sbjct  543  PAWQPFKHVETGDKKKEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVP  602

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             LWN K+GRKA+LKEV+ ++ +QLK  K+++
Sbjct  603  VLWNSKQGRKASLKEVIDYMTQQLKILKKRK  633



>emb|CDP00105.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE-EADVKALELCSLWQEKV  442
            K LI GL +  NS  ++IGI+RMGE+D K F+   K ++  E +A+ +A ELCSLW E +
Sbjct  506  KELINGLKEYPNS--AYIGIKRMGELDNKPFYEAMKLKYKHEADAEERASELCSLWDEYL  563

Query  441  KDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
            KDP WHP +VI ++ + E++I+EDDE+L+ LKE++G E+  AV  A  E+NEYNASGRY+
Sbjct  564  KDPEWHPTKVILVNGKHEEVIDEDDEKLNDLKEKYGHEVYKAVTTAFIEINEYNASGRYI  623

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
              ELWN+ EGRKATLKE  +F+ K+ K H  K
Sbjct  624  TSELWNYAEGRKATLKEGAAFLLKKWKLHMEK  655



>emb|CDY63974.1| BnaC02g46630D [Brassica napus]
Length=226

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+G  DL   G S IG++RMGE+DGK F  VC+QRF+ E   ++   LCS WQ+ + D 
Sbjct  77   LIRGFRDLSGEG-SVIGVKRMGEVDGKPFLKVCEQRFNGENVGLQHAMLCSEWQKNINDS  135

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+++   ++ +++++++D++L KL EE GE++  AV  A+EE+N++N SGRY +P 
Sbjct  136  AWYPFKLVVTGEKMKEVVDDEDDKLKKLSEELGEDVMNAVKTALEELNDFNPSGRYSVPA  195

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNF+ GRKATL E ++ + +Q+K  KR+R
Sbjct  196  LWNFEHGRKATLSEGIAHMTQQIKNFKRQR  225



>gb|EEC69937.1| hypothetical protein OsI_00381 [Oryza sativa Indica Group]
Length=415

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+G+ ++  +  + IGI+RMGE+D + FH  CK+R   ++   KA  L S WQE++K+P
Sbjct  264  LIKGVENMTITASTTIGIKRMGELDERPFHLACKRRHRDDDPGGKAAMLISYWQEELKNP  323

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +WHPF++I +    + +++EDD +L +L +++G+ +C+AV  A+ E+NEYN  GRY + E
Sbjct  324  SWHPFKIIQVDGEDKGVVDEDDPKLRQLCKDYGDSVCSAVKAAMAELNEYNPHGRYAMNE  383

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            LWNF+EGRKAT  EVV +I  QLKT+  +
Sbjct  384  LWNFREGRKATTTEVVKYISDQLKTNSSQ  412



>gb|KJB76093.1| hypothetical protein B456_012G071000 [Gossypium raimondii]
Length=645

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 108/154 (70%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S RS IG++RMGE+D K F    K+R++ E A+ +A E+CSLW+E +K
Sbjct  491  KELINGLKEI--STRSQIGVKRMGELDSKPFLEAMKRRYNEELAEERASEVCSLWEEYLK  548

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +    E  ++I+++DE+L  L ++ G E   +V  A++E+NEYN SGRY
Sbjct  549  DPDWHPFKRIKLEGGEEYQEVIDDEDEKLRDLTDQMGIEAYKSVTSAIKEINEYNPSGRY  608

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +I ELWN+ EGRKATLKE V+F+ K     KRKR
Sbjct  609  IISELWNYGEGRKATLKEGVTFLLKLWDNAKRKR  642



>gb|AGT17258.1| X1 protein [Saccharum hybrid cultivar R570]
 gb|AGT17260.1| X1 protein [Saccharum hybrid cultivar R570]
Length=629

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+  TE+ +V A  LCS W+ ++K
Sbjct  481  KELENGLLDL-SGGQAHIGIKRMGELDLKAFSKAC-QKEHTEDTEVTAAFLCSKWEAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ +  +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y +
Sbjct  539  NPDWHPFRVVTVDGKEMEIIEDDSKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  598  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  629



>ref|XP_010106489.1| hypothetical protein L484_025247 [Morus notabilis]
 gb|EXC10665.1| hypothetical protein L484_025247 [Morus notabilis]
Length=362

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LIQG S+  N  R++IG++ +GE+D K F    K++FS EEA+ KALE  SLW   ++DP
Sbjct  207  LIQGWSE--NLSRAYIGVKTLGELDSKPFRTATKRKFSDEEAEDKALESYSLWDSYLRDP  264

Query  432  NWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
             WHPF+++ +  +  ++II+EDDE+L  LK E+G+E+  AV+ A+EE+NEYN   RY + 
Sbjct  265  RWHPFKIVPHKANYTKEIIDEDDEKLKSLKNEYGDEVYNAVVTALEELNEYNPKERYAVM  324

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            ELWNFKE RKA+LKE + F+ KQ K+ +R+
Sbjct  325  ELWNFKEDRKASLKEGIEFVLKQWKSKRRR  354



>gb|KHG15173.1| Forkhead-associated domain-containing 1 [Gossypium arboreum]
Length=645

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 109/154 (71%), Gaps = 4/154 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL ++  S RS IG++RMGE+D K F    K+R++ E A+ +A E+CSLW+E +K
Sbjct  491  KELINGLKEI--STRSQIGVKRMGELDSKPFLEAMKRRYNEELAEERASEVCSLWEEYLK  548

Query  438  DPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  265
            DP+WHPF+ I +    E  ++I+++DE+L  LK++ G E   +V  A++E+NEYN SGRY
Sbjct  549  DPDWHPFKRIKLEGGEEYQEVIDDEDEKLRDLKDQMGIEAYKSVTSAIKEINEYNPSGRY  608

Query  264  VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            +I ELWN+ EGRKATLKE V+F+ K     KRKR
Sbjct  609  IISELWNYGEGRKATLKEGVTFLLKLWDNAKRKR  642



>ref|XP_006846222.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
 gb|ERN07897.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
Length=641

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = -1

Query  579  GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  400
            GR+HIG++RMG +D + F+   K +   E+  +KA ELCSLW    +DP WHPF+ ++I 
Sbjct  502  GRAHIGVKRMGVLDEQPFYRAVKAKLPNEDWQLKASELCSLWDAHTRDPAWHPFKTVSID  561

Query  399  DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  220
             +  ++I+E+DE+  +L++E+G+E+C AV  A+ E+N+YN SGRY +P LW+FKEGR+A+
Sbjct  562  GKDREVIDENDEKFKELRDEYGDEVCKAVETAMLELNDYNPSGRYPVPALWHFKEGRQAS  621

Query  219  LKEVVSFIFKQLKTHKRKR  163
            L+EV+    KQ KT KRKR
Sbjct  622  LQEVIHHFVKQNKTKKRKR  640



>ref|XP_003557426.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228249.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228250.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228251.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=700

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L++GL D+L SG + IG++RMGE+D + F N C+++F  ++ +  A +L S WQE++K
Sbjct  547  KELMEGLEDML-SGHTAIGVKRMGELDERPFQNACRKKFGNDDYETIAAQLVSSWQEEIK  605

Query  438  DPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  262
             P WHP++ + + +   ++++N+DD  L +L  E+G+++C AV  A+ EVNEYN SGRY 
Sbjct  606  KPAWHPYKFVKDENGEDKEVVNDDDPRLRELWIEYGDDVCNAVKTALSEVNEYNPSGRYA  665

Query  261  IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            + ELWNFK+ RKAT+KEV+ +IF Q  T  ++R
Sbjct  666  VLELWNFKKARKATMKEVLRYIFLQTGTMSKRR  698



>gb|KJB67636.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=514

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            L QGL ++  S R++IG++RMGE+DGK F    K+R++ E A+ +A E+CSLW+E +KDP
Sbjct  362  LEQGLKEI--SRRANIGVKRMGELDGKPFLEAMKRRYNEELAEERASEMCSLWEEYLKDP  419

Query  432  NWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +WHPF+ I +    E  ++I+++DE+L  LK E G E   +V  A++E+NEYN SGRYVI
Sbjct  420  DWHPFKRIKLEGGEEYQEVIDDEDEKLRDLKAEMGNEAYKSVTLAIKEINEYNPSGRYVI  479

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN++EGRKA+LKE V F+ +  +T KR+R
Sbjct  480  SELWNYREGRKASLKEGVEFLLELWETVKRRR  511



>gb|EEC71144.1| hypothetical protein OsI_02969 [Oryza sativa Indica Group]
Length=629

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DLL+ G+SHIGI+RMGE+D +AF   C++  S E+A++ A  LCS WQ ++K
Sbjct  480  KELENGLLDLLD-GQSHIGIKRMGELDLEAFSKACRKMSSEEDAEITAAILCSKWQAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFR + +  + ++II +D +     +E  GE+I   V  A+ E+NEYN SGR+ +
Sbjct  539  NPDWHPFRFVLVDGQEKEIIEDDAKLQELKEEH-GEDIYRLVRDALCEINEYNPSGRFPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFK+ RKATLKE V F+ +Q + ++RKR
Sbjct  598  GELWNFKDKRKATLKETVQFVLRQWRANRRKR  629



>ref|XP_010472874.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  436
            +L   L +LL S R+ I ++R+GE+D K F   CKQRF+ EEA V+   LCS WQE +KD
Sbjct  484  VLTTELRELL-SERTIIRVKRVGELDEKPFMRACKQRFTAEEAAVQHAILCSKWQENLKD  542

Query  435  PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  256
              WHPF+ +   D+  ++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P
Sbjct  543  SAWHPFKHVGTGDKKTEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVP  602

Query  255  ELWNFKEGRKATLKEVVSFIFKQLKT-HKRKR  163
             LW+ K+GRKA+LKEV+ ++ +QLK   KRKR
Sbjct  603  VLWHSKQGRKASLKEVIDYMTQQLKILKKRKR  634



>ref|NP_001043655.1| Os01g0633200 [Oryza sativa Japonica Group]
 gb|AAF21887.1|AF101045_2 putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAB90725.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAF05569.1| Os01g0633200 [Oryza sativa Japonica Group]
 dbj|BAG91243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55041.1| hypothetical protein OsJ_02725 [Oryza sativa Japonica Group]
Length=629

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DLL+ G+SHIGI+RMGE+D +AF   C++  S E+A++ A  LCS WQ ++K
Sbjct  480  KELENGLLDLLD-GQSHIGIKRMGELDLEAFSKACRKMSSEEDAEITAAILCSKWQAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFR + +  + ++II +D +     +E  GE+I   V  A+ E+NEYN SGR+ +
Sbjct  539  NPDWHPFRFVLVDGQEKEIIEDDAKLQELKEEH-GEDIYRLVRDALCEINEYNPSGRFPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFK+ RKATLKE V F+ +Q + ++RKR
Sbjct  598  GELWNFKDKRKATLKETVQFVLRQWRANRRKR  629



>ref|XP_004145335.1| PREDICTED: uncharacterized LOC101207144 [Cucumis sativus]
Length=709

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  409
            +S R+ I ++RMG++D K F    K  ++ +EAD KAL LCS W+++++D +WHPFR+I 
Sbjct  567  SSTRAFISVKRMGDLDSKPFCTATKLNYAKDEADAKALGLCSQWEDQLRDSSWHPFRIIV  626

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + ++II+E+DE L  LK E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKE R
Sbjct  627  DDAGQAKEIIDENDEILKNLKNEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEDR  686

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKE V+ I KQ K HK+++
Sbjct  687  KATLKEGVAHILKQWKLHKKRK  708



>emb|CDM81289.1| unnamed protein product [Triticum aestivum]
Length=152

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  615  LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNV-CKQRFSTEEADVKALELCSLWQEKVK  439
            + +Q L    N G   IG++RMGE+D KAF N  C +    E+A V +  LCS WQ ++ 
Sbjct  1    MFLQELPKFTN-GAVLIGVKRMGELDLKAFANASCSKNVPQEDAQVNSAILCSQWQAEIA  59

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHPFR++ +  +  +I++EDD++L  LKEE GEEI + V KA+ E+NEYN SGRY  
Sbjct  60   NPGWHPFRIVAVDGKETEILSEDDDKLRSLKEEHGEEIYSLVTKALFEMNEYNPSGRYAE  119

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN K  RKATL+E + F+ +QL++HKRKR
Sbjct  120  RELWNRKHDRKATLEEAIQFLLRQLQSHKRKR  151



>gb|AAV69068.1| X1, partial [Zea mays subsp. parviglumis]
Length=550

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++HIGI+RMGE+D KAF   C Q+   E A+V A  LCS W+ ++K
Sbjct  402  KELENGLLDL-SGGQTHIGIKRMGELDLKAFSKAC-QKERAENAEVTAAFLCSKWEAEIK  459

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ + D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y +
Sbjct  460  NPDWHPFRVVTV-DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPV  518

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  519  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  550



>ref|XP_006644407.1| PREDICTED: intracellular protein transport protein USO1-like 
[Oryza brachyantha]
Length=629

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + GR+HIGI+RMGE+D +AF   C++  S E+  V A  LCS WQ ++K
Sbjct  480  KELENGLLDL-SDGRAHIGIKRMGELDLEAFSKACRKMSSEEDVGVTAAILCSKWQAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFR + +  + ++II +D++     +E  GEEI   V KA+ E+NEYN SGR+ +
Sbjct  539  NPDWHPFRAVLVDGQEKEIIEDDEKLQELKEEH-GEEIYKLVRKALCEINEYNPSGRFPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNF++ RKATLKE V F+ +Q + ++RKR
Sbjct  598  GELWNFRDDRKATLKETVQFVLRQWRANRRKR  629



>gb|KEH34701.1| XH/XS domain protein [Medicago truncatula]
Length=640

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI G+ D+    R HIG++RMGE+D   F    K+R++ EEA+ KA ELCSLW+E +K
Sbjct  490  KELISGIKDI--GTRVHIGVKRMGELDTGPFLEAMKKRYNEEEAEDKASELCSLWEEYLK  547

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+V+    + ++II +DDE+L+ L++E GE+  +AV+ ++ E+NEYN SGRYV 
Sbjct  548  DPDWHPFKVVMNEGKEKEIIKDDDEKLNGLRKEVGEKAYSAVVASLTEINEYNPSGRYVT  607

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKR  169
             ELWN+K GR+ATL+E V F+    K  K+
Sbjct  608  SELWNYKAGRRATLQEGVKFLLDYWKRKKK  637



>emb|CDY69135.1| BnaAnng29410D [Brassica napus]
Length=299

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+GL DL   G S I ++RMG++D K F  VCKQ+F  E  +V+   LCS WQ  + D 
Sbjct  150  LIRGLRDLSCEG-SLIRVKRMGQVDEKPFTKVCKQKFIDENVEVEYAMLCSKWQNALNDS  208

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+ +   +  +++++++DE+L  L+EEWGE++  AV  A+EE+NE+N SGRY++P 
Sbjct  209  AWHPFKRVGTGENMKEVVDDEDEKLKSLREEWGEDVKNAVKTALEEMNEFNPSGRYIVPV  268

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNF+ GRKATLKE ++ + +Q+K  KR R
Sbjct  269  LWNFEHGRKATLKEGIAHMTQQIKNLKRNR  298



>ref|XP_004154410.1| PREDICTED: uncharacterized protein LOC101207144 [Cucumis sativus]
Length=755

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  409
            +S R+ I ++RMG++D K F    K  ++ +EAD KAL LCS W+++++D +WHPFR+I 
Sbjct  613  SSTRAFISVKRMGDLDSKPFCTATKLNYAKDEADAKALGLCSQWEDQLRDSSWHPFRIIV  672

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + ++II+E+DE L  LK E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKE R
Sbjct  673  DDAGQAKEIIDENDEILKNLKNEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEDR  732

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKE V+ I KQ K HK+++
Sbjct  733  KATLKEGVAHILKQWKLHKKRK  754



>ref|XP_010690702.1| PREDICTED: factor of DNA methylation 2-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = -1

Query  609  IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVK-------ALELCSLWQ  451
            I+GL  L    R  IGI+RMGE++ K   + C + F + + D K       ++ELCSLWQ
Sbjct  57   IEGLVSL-KRPRVKIGIKRMGEVNLKPIRDACSRVFRSGKWDKKFGNWEEKSVELCSLWQ  115

Query  450  EKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
            + + DP W PF+   I+++  ++I+E+D++L +LK+EWGEE   AV++A+ EVNEYNASG
Sbjct  116  KDISDPGWQPFKQEIINEKLSEVIDENDKKLLELKQEWGEEAYKAVVEALLEVNEYNASG  175

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            RY +PELWN+KE R+ATL EV+ ++ KQ  T K+K+
Sbjct  176  RYPVPELWNYKENRQATLGEVIQYVIKQWLTQKKKK  211



>ref|XP_004165825.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228650 
[Cucumis sativus]
Length=754

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  409
            +S R+ I ++RMG++D K F    K  ++ +EAD KAL LCS W+++++D +WHPFR+I 
Sbjct  612  SSTRAFISVKRMGDLDSKPFCTATKLNYAKDEADAKALGLCSQWEDQLRDSSWHPFRIIV  671

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + ++II+E+DE L  LK E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKE R
Sbjct  672  DDAGQAKEIIDENDEILKNLKNEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEDR  731

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKE V+ I KQ K HK+++
Sbjct  732  KATLKEGVAHILKQWKLHKKRK  753



>gb|KGN65727.1| hypothetical protein Csa_1G522530 [Cucumis sativus]
Length=838

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  409
            +S R+ I ++RMG++D K F    K  ++ +EAD KAL LCS W+++++D +WHPFR+I 
Sbjct  696  SSTRAFISVKRMGDLDSKPFCTATKLNYAKDEADAKALGLCSQWEDQLRDSSWHPFRIIV  755

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + ++II+E+DE L  LK E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKE R
Sbjct  756  DDAGQAKEIIDENDEILKNLKNEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEDR  815

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KATLKE V+ I KQ K HK+++
Sbjct  816  KATLKEGVAHILKQWKLHKKRK  837



>emb|CDY68592.1| BnaAnng27750D [Brassica napus]
Length=223

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+G  DL   G S IG++RMGE+D K F  VC+QRF+ E   ++   LCS WQ+ + D 
Sbjct  74   LIRGFRDLSGEG-SVIGVKRMGEVDEKPFLKVCEQRFNGENVGLQHAMLCSEWQKNINDS  132

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             W+PF+++   ++ +++++++DE+L K+ EEWGE++  AV  A+EE+N++N SGRY +P 
Sbjct  133  AWYPFKLVVTGEKMKEVVDDEDEKLKKMSEEWGEDVKNAVTTALEELNDFNPSGRYSVPA  192

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWNF+ GRKATL E +    +Q+K  KR+R
Sbjct  193  LWNFEHGRKATLSEGIVHRTQQIKNLKRQR  222



>gb|EMT28948.1| hypothetical protein F775_22883 [Aegilops tauschii]
Length=196

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K+LI  L    N  ++HIG++RMGE+D KAF N C +  + EEA V +  LCS WQ ++ 
Sbjct  60   KMLIDELPRFANV-QAHIGVKRMGELDLKAFANACIKNVAQEEAQVNSAILCSRWQAEIA  118

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P WHP R++ +  +               + E+GEEI + V  A+ E+NEYN +GRY  
Sbjct  119  NPGWHPSRIVMVDGK---------------EMEYGEEIYSLVTTALLEMNEYNPNGRYPA  163

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN K+  KATL+E + F+ +QL++HKRKR
Sbjct  164  PELWNGKDDPKATLEEAIQFLLRQLQSHKRKR  195



>ref|XP_006488337.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Citrus sinensis]
 ref|XP_006488338.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Citrus sinensis]
Length=630

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 7/158 (4%)
 Frame = -1

Query  612  LIQGLSDLLNS-----GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            L +   +L+NS      R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E
Sbjct  473  LQEARKELINSLKEGRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEE  532

Query  447  KVKDPNWHPFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             ++DPNWHPF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SG
Sbjct  533  YLRDPNWHPFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSG  592

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTH-KRKRH  160
            RY IPELWNFKE RKATLKE    +  Q + + KRKR+
Sbjct  593  RYTIPELWNFKENRKATLKEGAIHLLNQWRVNRKRKRN  630



>gb|KDO72840.1| hypothetical protein CISIN_1g038527mg [Citrus sinensis]
Length=630

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 7/158 (4%)
 Frame = -1

Query  612  LIQGLSDLLNS-----GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            L +   +L+NS      R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E
Sbjct  473  LQEARKELINSLKEGRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEE  532

Query  447  KVKDPNWHPFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             ++DPNWHPF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SG
Sbjct  533  YLRDPNWHPFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSG  592

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTH-KRKRH  160
            RY IPELWNFKE RKATLKE    +  Q + + KRKR+
Sbjct  593  RYTIPELWNFKENRKATLKEGAIHLLNQWRVNRKRKRN  630



>ref|XP_004503147.1| PREDICTED: myosin-11-like isoform X1 [Cicer arietinum]
 ref|XP_004503148.1| PREDICTED: myosin-11-like isoform X2 [Cicer arietinum]
 ref|XP_004503149.1| PREDICTED: myosin-11-like isoform X3 [Cicer arietinum]
Length=635

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI  + ++  + R+ IG++RMGE+D   F    K+R++ EEA+ KA ELCSLW+E +K
Sbjct  486  KELINAIKEI--ATRAQIGVKRMGELDTGPFLEAMKKRYNEEEAEDKASELCSLWEEYLK  543

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DP+WHPF+V+ I  + ++ I +DDE+L+ L++E GE    AV+ A+ E+NEYN SGRYV 
Sbjct  544  DPDWHPFKVVTIDGKSKEFIKDDDEKLNGLRKEVGERAYNAVVAALNEINEYNPSGRYVT  603

Query  258  PELWNFKEGRKATLKEVVSFIF  193
             ELWN+KEGR+ATL+E V F+ 
Sbjct  604  SELWNYKEGRRATLQEGVKFLL  625



>ref|XP_011461207.1| PREDICTED: factor of DNA methylation 2-like [Fragaria vesca subsp. 
vesca]
Length=211

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  406
            ++ R+ I ++RMG ID + F   CK+++ TEE +V+A ELCSLW++ + DPNWHPF+V  
Sbjct  69   SASRAFIRLKRMGGIDCRTFQTACKRKYPTEEINVRAAELCSLWEKYIGDPNWHPFKVST  128

Query  405  IH-DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
                  ++IINE+DE+L KLK ++G E+  AV  A+ E+NEYN SGRY + ELWNFKE R
Sbjct  129  ASFGHYKEIINEEDEKLKKLKNDFGVEVHLAVSTALLELNEYNPSGRYPLNELWNFKEDR  188

Query  228  KATLKEVVSFIFKQLKTHKRKRH  160
            +A+LKE +  I KQLK  KR+ +
Sbjct  189  RASLKEAILHIMKQLKHKKRRTY  211



>gb|AGT16789.1| hypothetical protein SHCRBa_009_B01_R_10 [Saccharum hybrid cultivar 
R570]
Length=629

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++ IGI+RMGE+D KAF   C Q+  TE+A+V +  LCS W+ ++K
Sbjct  481  KELENGLLDL-SGGQALIGIKRMGELDLKAFSKAC-QKEHTEDAEVTSAFLCSKWEAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ +  +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y +
Sbjct  539  NPDWHPFRVVTVDGKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWNFKE RK TLKE V F+ +Q +T++RKR
Sbjct  598  GELWNFKENRKVTLKEAVQFVLRQWRTNRRKR  629



>gb|EMS67897.1| hypothetical protein TRIUR3_24560 [Triticum urartu]
Length=677

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 97/152 (64%), Gaps = 4/152 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +  N G +HIG++RMG++D K F   CKQ    E+A V +  LCS W+ ++ 
Sbjct  342  KTLIDGLQNFTN-GHAHIGVKRMGDLDLKEFAKACKQDLLQEDARVDSSVLCSKWEARIA  400

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHPF V    D  E+ I   D    +  EE GEEI   V KA+ E+NEYN SGRY +
Sbjct  401  DPNWHPFEVRMNDDGKEKEILLKDNANLRELEEHGEEIYTLVTKALFEINEYNPSGRYPV  460

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+K+GRKAT +E + +I   LK+ KR+R
Sbjct  461  PELWNYKDGRKATPEEAIKYI---LKSRKRRR  489



>gb|KHN33379.1| hypothetical protein glysoja_005421 [Glycine soja]
Length=508

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = -1

Query  585  NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV-I  409
            NS R+ IG++RMGE+DGK F +  K+++S +E ++KA+ELCS ++  ++DPNW PF+V I
Sbjct  367  NSSRAFIGVKRMGELDGKPFLSAAKRKYSGDEVNLKAVELCSQYEAYLRDPNWFPFKVLI  426

Query  408  NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  229
            +   + +++++E+DE+L  LK+E+G+++  AV+ A++E+NE+N SGRY + ELW+ KEGR
Sbjct  427  DREGKAKEVLDEEDEKLRTLKDEFGDDVFQAVVTALKELNEFNPSGRYPLRELWHSKEGR  486

Query  228  KATLKEVVSFIFKQLKTHKRKR  163
            KA+LKE  S+I KQ KT KRK+
Sbjct  487  KASLKEGCSYIIKQWKTLKRKK  508



>ref|XP_010658561.1| PREDICTED: factor of DNA methylation 5-like isoform X2 [Vitis 
vinifera]
Length=392

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+ NS RS +G+++MGE+D K FH+ C ++F   +  +    +CS WQ +VK
Sbjct  244  KELISGLYDMQNS-RSLLGVKKMGEVDMKPFHDACSKKFPNRDLPIIYTTMCSTWQHRVK  302

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D +WHPF++IN   +    I+EDD EL +L+ + GE    AV KA+ E+ EYN SGRY +
Sbjct  303  DSSWHPFKIINGSLQ----IDEDDGELKELRNDLGEAAYKAVTKALLELEEYNPSGRYEV  358

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEG+KA+L E + ++ KQ KT K KR
Sbjct  359  PELWNYKEGKKASLVETIEYVIKQWKTQKGKR  390



>ref|XP_006391678.1| hypothetical protein EUTSA_v10024003mg, partial [Eutrema salsugineum]
 gb|ESQ28964.1| hypothetical protein EUTSA_v10024003mg, partial [Eutrema salsugineum]
Length=267

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = -1

Query  612  LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            LI+ L +L+ S R+ I I++MGE+D + F   CK+RF+ EEADV+   L S WQE +K  
Sbjct  121  LIKELRELV-SDRTSITIKKMGELDEEPFIKACKERFTGEEADVQHAMLFSKWQENLKVA  179

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
             WHPF+ +   D+ ++++ E+D++L  L+EEWGE +  AV  A+EE+NE+NASGRY +P+
Sbjct  180  AWHPFKRVGTGDQMQEVVYEEDKQLKSLREEWGENVKNAVKTALEELNEFNASGRYPVPQ  239

Query  252  LWNFKEGRKATLKEVVSFIFKQLK--TH  175
            LWN KE R+ATLKEVV ++  Q+K  TH
Sbjct  240  LWNLKEKRRATLKEVVEYMTLQIKNLTH  267



>ref|XP_010658559.1| PREDICTED: factor of DNA methylation 5-like isoform X1 [Vitis 
vinifera]
 emb|CBI31663.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL D+ NS RS +G+++MGE+D K FH+ C ++F   +  +    +CS WQ +VK
Sbjct  245  KELISGLYDMQNS-RSLLGVKKMGEVDMKPFHDACSKKFPNRDLPIIYTTMCSTWQHRVK  303

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D +WHPF++IN   +    I+EDD EL +L+ + GE    AV KA+ E+ EYN SGRY +
Sbjct  304  DSSWHPFKIINGSLQ----IDEDDGELKELRNDLGEAAYKAVTKALLELEEYNPSGRYEV  359

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            PELWN+KEG+KA+L E + ++ KQ KT K KR
Sbjct  360  PELWNYKEGKKASLVETIEYVIKQWKTQKGKR  391



>ref|XP_006424841.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
 gb|ESR38081.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
Length=732

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 7/158 (4%)
 Frame = -1

Query  612  LIQGLSDLLNS-----GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  448
            L +   +L+NS      R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E
Sbjct  575  LQEARKELINSLKEGRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEE  634

Query  447  KVKDPNWHPFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  271
             ++DPNWHPF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SG
Sbjct  635  YLRDPNWHPFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSG  694

Query  270  RYVIPELWNFKEGRKATLKEVVSFIFKQLKTH-KRKRH  160
            RY IPELWNFKE RKATLKE    +  Q + + KRKR+
Sbjct  695  RYTIPELWNFKENRKATLKEGAIHLLNQWRVNRKRKRN  732



>emb|CDY16109.1| BnaC08g40140D [Brassica napus]
Length=708

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+ + +L  + R  I ++RMG +D K F  + K+R+  EEADV+A  LCSLW   ++
Sbjct  556  KALIKSMQEL--TLRGQISVKRMGALDEKPFQKLAKERYPAEEADVEAATLCSLWDNHLR  613

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D  WHP +VI I    ++++NE+DE+L +LK+E G+E+  AV +A+ E NEYN SGRY++
Sbjct  614  DSAWHPIKVIQIDGIHKEVLNEEDEKLQELKKELGDEVFEAVTQALMERNEYNGSGRYIV  673

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTH  175
            PELWNFKEGRKATLKE V ++ K L TH
Sbjct  674  PELWNFKEGRKATLKEGVVYLMK-LWTH  700



>ref|XP_009768237.1| PREDICTED: uncharacterized protein LOC104219279 [Nicotiana sylvestris]
Length=711

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI GL +     R+ I ++RMGE++ K FH   ++ +++EEA  KA+ELCSLW++ ++
Sbjct  563  KELINGLKE----SRAFICVKRMGELNEKPFHAAARKIYNSEEAAEKAMELCSLWEDHLR  618

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            DPNWHP++VI      E++I+EDDE+L  LK E+GEE+  AV+ A+ E+NE+N SGRY +
Sbjct  619  DPNWHPYKVIQKGLNVEEVIDEDDEKLKDLKTEYGEEVYQAVVTALNELNEHNPSGRYPV  678

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRK  166
            P+LWN KE R A+L E    I KQ K HKRK
Sbjct  679  PQLWNNKEKRTASLTEGAEHILKQWKLHKRK  709



>ref|XP_002874349.1| hypothetical protein ARALYDRAFT_910798 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50608.1| hypothetical protein ARALYDRAFT_910798 [Arabidopsis lyrata subsp. 
lyrata]
Length=131

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  552  MGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINe  373
            MGEID K F  VC+QRFS E  +++   LCS WQ+ +KDP+W+PF+ +   ++ +++++E
Sbjct  1    MGEIDEKPFLKVCRQRFSGENVELEQAMLCSKWQKTLKDPSWYPFKRVGTGEKMKEVVDE  60

Query  372  ddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIF  193
            +DE+L  L++EWGEE+  AV  A+ E+NE+N SGRY +P LWNF++ RKATLKE ++ + 
Sbjct  61   EDEKLKNLRKEWGEEVKNAVKTALVELNEFNPSGRYTVPVLWNFEQERKATLKEGIAHMI  120

Query  192  KQLKTHKRK  166
            K++KT KRK
Sbjct  121  KEIKTRKRK  129



>gb|AGT16810.1| transcription factor [Saccharum hybrid cultivar R570]
Length=629

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L  GL DL + G++ IGI+RMGE+D KAF   C Q+  TE+A+V A  LCS W+ ++K
Sbjct  481  KELENGLLDL-SGGQALIGIKRMGELDLKAFSKAC-QKEHTEDAEVTAAFLCSKWEAEIK  538

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P+WHPFRV+ +  +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y +
Sbjct  539  NPDWHPFRVVTVDGKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPV  597

Query  258  PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
             ELWN KE RK TLKE V F+ +Q +T++RKR
Sbjct  598  GELWNLKENRKVTLKEAVQFVLRQWRTNRRKR  629



>emb|CDP00108.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K L   LS+L++  R+ IG++RMGE+D K F +VC ++FS  + +V+++E  SLWQEKV 
Sbjct  360  KELTSVLSNLVD--RTTIGVKRMGEVDQKPFQDVCAKKFSRSDWEVRSVESISLWQEKVS  417

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            +P W PF+      + ++II+EDD EL +L+ +WGE+  AAV+ A+ E+NEYN SGRYV+
Sbjct  418  NPGWQPFKNTLKDGKWQEIIDEDDGELKRLRHDWGEDPYAAVVNALLELNEYNPSGRYVV  477

Query  258  PELWNFKEGRKATLKEVVSFIFKQLK  181
             ELWNFKEGRKA+L+EV+  + ++LK
Sbjct  478  QELWNFKEGRKASLQEVIQCMAQELK  503



>gb|KHN17925.1| hypothetical protein glysoja_017976 [Glycine soja]
Length=640

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  606  QGLSDLLNSGRSHIGIR--RMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            Q L D +   +SH  IR  RMGE+D + F    KQR++ E+A+ +A ELCSLW+E +KDP
Sbjct  488  QALVDAIKELQSHGNIRLKRMGELDTRPFLEAMKQRYNEEDAEERASELCSLWEEYLKDP  547

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +WHPF+VI +  + ++II +DDE+L+ LK + GE    AV++A+ E+NE+N SGRY+   
Sbjct  548  DWHPFKVIMVEGKEKEIIRDDDEKLNGLKNDLGEGAYKAVVEALLEINEHNPSGRYLTSV  607

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+K+GR+ATLKE V FI  Q K  KRK+
Sbjct  608  LWNYKQGRRATLKEGVQFISNQWKVLKRKK  637



>ref|XP_003538408.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Glycine max]
 ref|XP_006591339.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Glycine max]
 ref|XP_006591340.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X3 [Glycine max]
Length=640

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  606  QGLSDLLNSGRSHIGIR--RMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  433
            Q L D +   +SH  IR  RMGE+D + F    KQR++ E+A+ +A ELCSLW+E +KDP
Sbjct  488  QALVDAIKELQSHGNIRLKRMGELDTRPFLEAMKQRYNEEDAEERASELCSLWEEYLKDP  547

Query  432  NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  253
            +WHPF+VI +  + ++II +DDE+L+ LK + GE    AV++A+ E+NE+N SGRY+   
Sbjct  548  DWHPFKVIMVEGKEKEIIRDDDEKLNGLKNDLGEGAYKAVVEALLEINEHNPSGRYLTSV  607

Query  252  LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  163
            LWN+K+GR+ATLKE V FI  Q K  KRK+
Sbjct  608  LWNYKQGRRATLKEGVQFISNQWKVLKRKK  637



>emb|CDY26616.1| BnaA09g46610D [Brassica napus]
Length=715

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = -1

Query  618  KLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVK  439
            K LI+ + +L  + R  I ++RMG +D K F  + K+R+  EEADV+A +LCSLW   ++
Sbjct  561  KALIRSMQEL--TLRGQISVKRMGALDEKPFQKLTKERYPAEEADVEAAKLCSLWDNHLR  618

Query  438  DPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  259
            D  WHP +V+ I    ++++NE+DE+L +LK+E G+E+  AV +A+ E NEYN SGRY++
Sbjct  619  DSAWHPIKVVLIDGNHKEVLNEEDEKLQELKKELGDEVFEAVTQALMERNEYNGSGRYIV  678

Query  258  PELWNFKEGRKATLKEVVSFIFK  190
            PELWNFKEGRKATLKE V ++ K
Sbjct  679  PELWNFKEGRKATLKEGVVYLMK  701



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520