BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041G16

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771341.1|  PREDICTED: uncharacterized protein LOC104221...    183   5e-51   Nicotiana sylvestris
ref|XP_009771340.1|  PREDICTED: uncharacterized protein LOC104221...    183   6e-51   Nicotiana sylvestris
ref|XP_009592141.1|  PREDICTED: uncharacterized protein LOC104089035    181   4e-50   Nicotiana tomentosiformis
ref|XP_004251127.1|  PREDICTED: uncharacterized protein LOC101256453    181   6e-50   Solanum lycopersicum
ref|XP_006340158.1|  PREDICTED: uncharacterized protein LOC102578157    179   2e-49   Solanum tuberosum [potatoes]
emb|CDP07119.1|  unnamed protein product                                173   4e-47   Coffea canephora [robusta coffee]
ref|XP_011089894.1|  PREDICTED: uncharacterized protein LOC105170709    161   7e-43   Sesamum indicum [beniseed]
ref|XP_006424588.1|  hypothetical protein CICLE_v10028219mg             145   3e-37   Citrus clementina [clementine]
gb|KDO73243.1|  hypothetical protein CISIN_1g010219mg                   144   9e-37   Citrus sinensis [apfelsine]
ref|XP_006488111.1|  PREDICTED: uncharacterized protein LOC102606695    144   1e-36   Citrus sinensis [apfelsine]
gb|KDP44062.1|  hypothetical protein JCGZ_05529                         144   1e-36   Jatropha curcas
gb|KHN38770.1|  hypothetical protein glysoja_008319                     139   9e-35   Glycine soja [wild soybean]
ref|XP_006591142.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    139   9e-35   Glycine max [soybeans]
ref|XP_011089306.1|  PREDICTED: uncharacterized protein LOC105170...    138   1e-34   Sesamum indicum [beniseed]
ref|XP_011089303.1|  PREDICTED: uncharacterized protein LOC105170...    138   1e-34   Sesamum indicum [beniseed]
ref|XP_004505986.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    137   2e-34   Cicer arietinum [garbanzo]
gb|KHN32082.1|  hypothetical protein glysoja_028877                     137   3e-34   Glycine soja [wild soybean]
ref|XP_007132248.1|  hypothetical protein PHAVU_011G078700g             137   4e-34   Phaseolus vulgaris [French bean]
ref|XP_010043740.1|  PREDICTED: uncharacterized protein LOC104432...    137   5e-34   Eucalyptus grandis [rose gum]
ref|XP_010043741.1|  PREDICTED: uncharacterized protein LOC104432...    136   5e-34   Eucalyptus grandis [rose gum]
ref|XP_003539714.1|  PREDICTED: probable E3 ubiquitin-protein lig...    135   2e-33   Glycine max [soybeans]
gb|AFK43529.1|  unknown                                                 127   3e-33   Lotus japonicus
gb|KEH30048.1|  RING/U-box protein, putative                            126   9e-33   Medicago truncatula
ref|XP_010651156.1|  PREDICTED: uncharacterized protein LOC100257089    131   3e-32   Vitis vinifera
ref|XP_009791384.1|  PREDICTED: uncharacterized protein LOC104238...    131   4e-32   Nicotiana sylvestris
ref|XP_009791385.1|  PREDICTED: uncharacterized protein LOC104238...    131   4e-32   Nicotiana sylvestris
ref|XP_010098199.1|  hypothetical protein L484_007661                   128   3e-31   
emb|CBI16306.3|  unnamed protein product                                127   4e-31   Vitis vinifera
ref|XP_003606394.1|  hypothetical protein MTR_4g059540                  128   6e-31   
gb|AES88591.2|  RING/U-box protein                                      127   7e-31   Medicago truncatula
ref|XP_004295025.1|  PREDICTED: uncharacterized protein LOC101315129    127   9e-31   Fragaria vesca subsp. vesca
ref|XP_006378964.1|  hypothetical protein POPTR_0009s01890g             127   1e-30   
ref|XP_002314269.1|  hypothetical protein POPTR_0009s01890g             127   1e-30   
gb|KHG21185.1|  E3 ubiquitin-protein ligase MARCH7                      127   1e-30   Gossypium arboreum [tree cotton]
gb|KHG09093.1|  E3 ubiquitin-protein ligase MARCH7                      126   2e-30   Gossypium arboreum [tree cotton]
ref|XP_008225582.1|  PREDICTED: uncharacterized protein LOC103325214    126   2e-30   Prunus mume [ume]
ref|XP_007205129.1|  hypothetical protein PRUPE_ppa005009mg             126   2e-30   Prunus persica
gb|KJB26161.1|  hypothetical protein B456_004G228500                    126   2e-30   Gossypium raimondii
gb|KJB26163.1|  hypothetical protein B456_004G228500                    124   2e-30   Gossypium raimondii
ref|XP_008463891.1|  PREDICTED: uncharacterized protein LOC103501...    125   4e-30   Cucumis melo [Oriental melon]
ref|XP_008463872.1|  PREDICTED: uncharacterized protein LOC103501...    125   4e-30   Cucumis melo [Oriental melon]
ref|XP_004148772.1|  PREDICTED: uncharacterized protein LOC101213858    125   4e-30   Cucumis sativus [cucumbers]
ref|XP_008463882.1|  PREDICTED: uncharacterized protein LOC103501...    125   4e-30   
ref|XP_004166546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    125   4e-30   
ref|XP_009335079.1|  PREDICTED: uncharacterized protein LOC103927...    125   5e-30   Pyrus x bretschneideri [bai li]
gb|KJB56111.1|  hypothetical protein B456_009G106300                    125   5e-30   Gossypium raimondii
gb|KJB56109.1|  hypothetical protein B456_009G106300                    125   6e-30   Gossypium raimondii
gb|KJB56105.1|  hypothetical protein B456_009G106300                    125   7e-30   Gossypium raimondii
ref|XP_008385400.1|  PREDICTED: uncharacterized protein LOC103447955    125   8e-30   
ref|XP_004499420.1|  PREDICTED: uncharacterized protein LOC101491453    124   8e-30   Cicer arietinum [garbanzo]
ref|XP_007016720.1|  RING/U-box superfamily protein isoform 3           124   9e-30   
ref|XP_002530288.1|  protein binding protein, putative                  124   9e-30   
ref|XP_007016718.1|  RING/U-box superfamily protein isoform 1           124   1e-29   
ref|XP_007016719.1|  RING/U-box superfamily protein isoform 2           124   1e-29   
ref|XP_010253650.1|  PREDICTED: uncharacterized protein LOC104594...    124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008359119.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   2e-29   
ref|XP_009596996.1|  PREDICTED: uncharacterized protein LOC104093...    122   3e-29   Nicotiana tomentosiformis
ref|XP_009596995.1|  PREDICTED: uncharacterized protein LOC104093...    122   4e-29   Nicotiana tomentosiformis
ref|XP_009596994.1|  PREDICTED: uncharacterized protein LOC104093...    122   5e-29   Nicotiana tomentosiformis
ref|XP_011044367.1|  PREDICTED: uncharacterized protein LOC105139...    121   1e-28   Populus euphratica
ref|XP_011044368.1|  PREDICTED: uncharacterized protein LOC105139...    121   1e-28   Populus euphratica
ref|XP_006400834.1|  hypothetical protein EUTSA_v10013381mg             120   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006400833.1|  hypothetical protein EUTSA_v10013381mg             120   2e-28   
ref|XP_011044366.1|  PREDICTED: uncharacterized protein LOC105139...    121   2e-28   Populus euphratica
ref|XP_011044364.1|  PREDICTED: uncharacterized protein LOC105139...    121   2e-28   Populus euphratica
ref|XP_011044365.1|  PREDICTED: uncharacterized protein LOC105139...    121   2e-28   Populus euphratica
ref|XP_009367089.1|  PREDICTED: uncharacterized protein LOC103956...    120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009367091.1|  PREDICTED: uncharacterized protein LOC103956...    120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_002519545.1|  protein binding protein, putative                  120   2e-28   
gb|EYU18838.1|  hypothetical protein MIMGU_mgv1a005388mg                120   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_010535601.1|  PREDICTED: uncharacterized protein LOC104810853    119   6e-28   Tarenaya hassleriana [spider flower]
gb|EYU34440.1|  hypothetical protein MIMGU_mgv1a004524mg                119   8e-28   Erythranthe guttata [common monkey flower]
ref|NP_568923.1|  RING/U-box domain-containing protein                  119   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002280929.2|  PREDICTED: uncharacterized protein LOC100265...    119   1e-27   Vitis vinifera
ref|XP_010653565.1|  PREDICTED: uncharacterized protein LOC100265...    119   1e-27   
gb|KFK27585.1|  hypothetical protein AALP_AA8G403000                    118   1e-27   Arabis alpina [alpine rockcress]
gb|KFK27586.1|  hypothetical protein AALP_AA8G403000                    118   2e-27   Arabis alpina [alpine rockcress]
ref|XP_010443856.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    118   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009120590.1|  PREDICTED: uncharacterized protein LOC103845...    117   2e-27   Brassica rapa
ref|XP_009120591.1|  PREDICTED: uncharacterized protein LOC103845...    117   2e-27   Brassica rapa
ref|XP_010456560.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH7      117   2e-27   
ref|XP_010037957.1|  PREDICTED: uncharacterized protein LOC104426553    118   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010483706.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    117   2e-27   
ref|XP_010483705.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    117   2e-27   
emb|CDY31533.1|  BnaA10g13380D                                          117   2e-27   Brassica napus [oilseed rape]
ref|XP_007207622.1|  hypothetical protein PRUPE_ppa020301mg             117   3e-27   
emb|CDY67417.1|  BnaC09g53890D                                          117   4e-27   Brassica napus [oilseed rape]
ref|XP_011468102.1|  PREDICTED: uncharacterized protein LOC101308698    117   5e-27   Fragaria vesca subsp. vesca
emb|CDY09194.1|  BnaA02g06200D                                          116   6e-27   Brassica napus [oilseed rape]
ref|XP_009126594.1|  PREDICTED: uncharacterized protein LOC103851...    116   6e-27   Brassica rapa
ref|XP_009126595.1|  PREDICTED: uncharacterized protein LOC103851...    116   6e-27   Brassica rapa
gb|KGN46835.1|  hypothetical protein Csa_6G140830                       116   8e-27   Cucumis sativus [cucumbers]
ref|XP_004145807.1|  PREDICTED: uncharacterized protein LOC101210532    116   8e-27   Cucumis sativus [cucumbers]
ref|XP_009126592.1|  PREDICTED: uncharacterized protein LOC103851...    116   9e-27   Brassica rapa
ref|XP_009126593.1|  PREDICTED: uncharacterized protein LOC103851...    116   9e-27   Brassica rapa
gb|KDP29105.1|  hypothetical protein JCGZ_16494                         116   9e-27   Jatropha curcas
ref|XP_008463941.1|  PREDICTED: uncharacterized protein LOC103501...    115   1e-26   Cucumis melo [Oriental melon]
ref|XP_008463940.1|  PREDICTED: uncharacterized protein LOC103501...    115   1e-26   Cucumis melo [Oriental melon]
ref|XP_011094675.1|  PREDICTED: uncharacterized protein LOC105174...    116   1e-26   Sesamum indicum [beniseed]
ref|XP_011094674.1|  PREDICTED: uncharacterized protein LOC105174...    116   1e-26   Sesamum indicum [beniseed]
ref|XP_008243925.1|  PREDICTED: uncharacterized protein LOC103342122    115   2e-26   Prunus mume [ume]
gb|KJB20262.1|  hypothetical protein B456_003G141100                    115   2e-26   Gossypium raimondii
gb|KJB20267.1|  hypothetical protein B456_003G141100                    115   2e-26   Gossypium raimondii
gb|KJB20266.1|  hypothetical protein B456_003G141100                    115   2e-26   Gossypium raimondii
ref|XP_008387604.1|  PREDICTED: uncharacterized protein LOC103450061    112   4e-26   
ref|XP_004240679.1|  PREDICTED: uncharacterized protein LOC101265...    114   5e-26   Solanum lycopersicum
ref|XP_010321949.1|  PREDICTED: uncharacterized protein LOC101265...    114   5e-26   Solanum lycopersicum
ref|XP_010689560.1|  PREDICTED: uncharacterized protein LOC104903248    113   8e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63112.1|  hypothetical protein M569_11674                         112   1e-25   Genlisea aurea
emb|CDP06734.1|  unnamed protein product                                113   1e-25   Coffea canephora [robusta coffee]
ref|XP_002864692.1|  zinc finger family protein                         112   2e-25   
ref|XP_009342773.1|  PREDICTED: uncharacterized protein LOC103934748    112   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_006343443.1|  PREDICTED: uncharacterized protein LOC102596732    112   2e-25   Solanum tuberosum [potatoes]
ref|NP_851232.1|  RING/U-box domain-containing protein                  112   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594143.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    112   3e-25   Glycine max [soybeans]
ref|XP_006836375.1|  hypothetical protein AMTR_s00092p00120720          111   5e-25   
ref|XP_006282160.1|  hypothetical protein CARUB_v10028418mg             111   6e-25   Capsella rubella
ref|XP_008369770.1|  PREDICTED: uncharacterized protein LOC103433299    110   6e-25   
ref|XP_008369756.1|  PREDICTED: uncharacterized protein LOC103433283    111   7e-25   
ref|XP_006594984.1|  PREDICTED: uncharacterized protein LOC100815599    110   1e-24   Glycine max [soybeans]
gb|KHN21522.1|  hypothetical protein glysoja_021102                     110   1e-24   Glycine soja [wild soybean]
ref|XP_009377416.1|  PREDICTED: uncharacterized protein LOC103966027    110   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_010107550.1|  hypothetical protein L484_024404                   110   2e-24   
ref|XP_006592700.1|  PREDICTED: uncharacterized protein LOC100782610    109   2e-24   
gb|KHN11205.1|  hypothetical protein glysoja_034434                     108   3e-24   Glycine soja [wild soybean]
gb|KJB16806.1|  hypothetical protein B456_002G248600                    108   3e-24   Gossypium raimondii
ref|XP_010032003.1|  PREDICTED: uncharacterized protein LOC104421669    109   3e-24   Eucalyptus grandis [rose gum]
gb|KJB16801.1|  hypothetical protein B456_002G248600                    109   3e-24   Gossypium raimondii
gb|KHG08412.1|  putative E3 ubiquitin-protein ligase MARCH10            109   3e-24   Gossypium arboreum [tree cotton]
ref|XP_010684110.1|  PREDICTED: uncharacterized protein LOC104898704    108   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007027302.1|  Binding protein, putative isoform 1                108   5e-24   
ref|XP_007027304.1|  Binding protein, putative isoform 3                108   5e-24   
ref|XP_006854502.1|  hypothetical protein AMTR_s00175p00053490          108   6e-24   Amborella trichopoda
ref|XP_004487122.1|  PREDICTED: uncharacterized protein LOC101488...    108   7e-24   Cicer arietinum [garbanzo]
ref|XP_007145227.1|  hypothetical protein PHAVU_007G221300g             107   1e-23   Phaseolus vulgaris [French bean]
ref|XP_010246421.1|  PREDICTED: uncharacterized protein LOC104589...    107   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_003580994.1|  PREDICTED: uncharacterized protein LOC100836924    106   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_004246665.1|  PREDICTED: uncharacterized protein LOC101249200    106   5e-23   Solanum lycopersicum
ref|XP_006361814.1|  PREDICTED: uncharacterized protein LOC102593861    105   6e-23   Solanum tuberosum [potatoes]
gb|EAY92758.1|  hypothetical protein OsI_14560                          105   7e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_007150211.1|  hypothetical protein PHAVU_005G135900g             104   9e-23   Phaseolus vulgaris [French bean]
ref|XP_010558263.1|  PREDICTED: uncharacterized protein LOC104826973    105   9e-23   Tarenaya hassleriana [spider flower]
ref|NP_001052006.1|  Os04g0105100                                       104   1e-22   
ref|XP_004974977.1|  PREDICTED: uncharacterized protein LOC101774...    104   1e-22   
ref|XP_006653096.1|  PREDICTED: uncharacterized protein LOC102716494    104   1e-22   Oryza brachyantha
ref|XP_010036055.1|  PREDICTED: probable E3 ubiquitin-protein lig...    105   1e-22   Eucalyptus grandis [rose gum]
ref|XP_004974976.1|  PREDICTED: uncharacterized protein LOC101774...    104   1e-22   Setaria italica
gb|EPS59449.1|  hypothetical protein M569_15357                         103   1e-22   Genlisea aurea
ref|XP_011040643.1|  PREDICTED: uncharacterized protein LOC105136849    104   2e-22   Populus euphratica
ref|XP_011004480.1|  PREDICTED: uncharacterized protein LOC105110961    104   2e-22   Populus euphratica
ref|XP_006381467.1|  hypothetical protein POPTR_0006s13100g             104   2e-22   
gb|EYU24309.1|  hypothetical protein MIMGU_mgv1a022401mg                103   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_008229749.1|  PREDICTED: uncharacterized protein LOC103329100    104   2e-22   Prunus mume [ume]
gb|EMT19748.1|  hypothetical protein F775_12706                         103   2e-22   
gb|EYU36437.1|  hypothetical protein MIMGU_mgv1a005750mg                103   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_006407641.1|  hypothetical protein EUTSA_v10020625mg             103   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009769900.1|  PREDICTED: uncharacterized protein LOC104220...    104   2e-22   Nicotiana sylvestris
ref|XP_002522590.1|  protein binding protein, putative                  104   3e-22   Ricinus communis
ref|XP_010657095.1|  PREDICTED: uncharacterized protein LOC100243...    103   3e-22   
ref|XP_007215527.1|  hypothetical protein PRUPE_ppa003767mg             104   3e-22   Prunus persica
ref|XP_010486549.1|  PREDICTED: uncharacterized protein LOC104764...    103   3e-22   Camelina sativa [gold-of-pleasure]
gb|AES67476.2|  RING/U-box protein                                      103   3e-22   Medicago truncatula
ref|XP_010486548.1|  PREDICTED: uncharacterized protein LOC104764...    103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003597225.1|  Protein binding protein                            103   3e-22   
gb|EMS60352.1|  hypothetical protein TRIUR3_08999                       103   3e-22   Triticum urartu
ref|XP_011074285.1|  PREDICTED: uncharacterized protein LOC105159050    103   3e-22   
ref|XP_011048564.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    103   3e-22   Populus euphratica
ref|XP_009146905.1|  PREDICTED: uncharacterized protein LOC103870523    103   3e-22   Brassica rapa
ref|XP_009377929.1|  PREDICTED: uncharacterized protein LOC103966489    102   4e-22   
ref|XP_010112883.1|  putative E3 ubiquitin-protein ligase MARCH10       103   4e-22   
ref|XP_003633259.1|  PREDICTED: uncharacterized protein LOC100243...    103   4e-22   Vitis vinifera
emb|CBI22058.3|  unnamed protein product                                103   4e-22   Vitis vinifera
ref|XP_009591165.1|  PREDICTED: uncharacterized protein LOC104088228    103   4e-22   Nicotiana tomentosiformis
emb|CDY41589.1|  BnaC05g43260D                                          102   5e-22   Brassica napus [oilseed rape]
ref|XP_009630868.1|  PREDICTED: uncharacterized protein LOC104120...    103   5e-22   Nicotiana tomentosiformis
ref|XP_010920401.1|  PREDICTED: uncharacterized protein LOC105044280    103   5e-22   Elaeis guineensis
ref|XP_002323191.2|  hypothetical protein POPTR_0016s02320g             102   6e-22   
emb|CDY41588.1|  BnaC05g43250D                                          102   6e-22   Brassica napus [oilseed rape]
ref|XP_004502083.1|  PREDICTED: uncharacterized protein LOC101489964    102   7e-22   Cicer arietinum [garbanzo]
ref|XP_011008532.1|  PREDICTED: uncharacterized protein LOC105113880    102   8e-22   Populus euphratica
dbj|BAJ93226.1|  predicted protein                                      102   8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66215.1|  hypothetical protein OsJ_22354                          103   9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966202.1|  PREDICTED: uncharacterized protein LOC101763665    102   9e-22   Setaria italica
ref|XP_010464632.1|  PREDICTED: uncharacterized protein LOC104745150    102   9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010476472.1|  PREDICTED: uncharacterized protein LOC104755...    102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010476546.1|  PREDICTED: uncharacterized protein LOC104755...    102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004487121.1|  PREDICTED: uncharacterized protein LOC101488...    102   1e-21   
emb|CDY07939.1|  BnaC03g35840D                                          101   1e-21   Brassica napus [oilseed rape]
ref|XP_006480610.1|  PREDICTED: uncharacterized protein LOC102629...    101   1e-21   
gb|KDO44231.1|  hypothetical protein CISIN_1g0103781mg                  100   1e-21   Citrus sinensis [apfelsine]
gb|KFK38364.1|  hypothetical protein AALP_AA3G104500                    101   1e-21   Arabis alpina [alpine rockcress]
ref|XP_006428800.1|  hypothetical protein CICLE_v10011512mg             102   2e-21   Citrus clementina [clementine]
emb|CDY44728.1|  BnaA05g28780D                                          101   2e-21   Brassica napus [oilseed rape]
gb|KDO44228.1|  hypothetical protein CISIN_1g0103781mg                  101   2e-21   Citrus sinensis [apfelsine]
ref|XP_006481291.1|  PREDICTED: uncharacterized protein LOC102628742    101   2e-21   Citrus sinensis [apfelsine]
ref|XP_004303917.1|  PREDICTED: uncharacterized protein LOC101297754    101   2e-21   Fragaria vesca subsp. vesca
ref|XP_008380043.1|  PREDICTED: uncharacterized protein LOC103443037    102   2e-21   
ref|XP_006480608.1|  PREDICTED: uncharacterized protein LOC102629...    101   2e-21   Citrus sinensis [apfelsine]
gb|KEH35190.1|  zinc finger protein                                     100   3e-21   Medicago truncatula
gb|EEC81174.1|  hypothetical protein OsI_24153                          100   3e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001058355.2|  Os06g0677300                                       100   3e-21   
ref|XP_006656375.1|  PREDICTED: uncharacterized protein LOC102711268    100   3e-21   Oryza brachyantha
ref|XP_008342280.1|  PREDICTED: uncharacterized protein LOC103405094    100   3e-21   
ref|XP_010926931.1|  PREDICTED: uncharacterized protein LOC105049083    100   3e-21   Elaeis guineensis
gb|KJB33377.1|  hypothetical protein B456_006G008500                    100   3e-21   Gossypium raimondii
gb|KJB33376.1|  hypothetical protein B456_006G008500                    100   4e-21   Gossypium raimondii
ref|XP_002446007.1|  hypothetical protein SORBIDRAFT_06g000460          100   4e-21   Sorghum bicolor [broomcorn]
ref|XP_002437443.1|  hypothetical protein SORBIDRAFT_10g027165          100   5e-21   Sorghum bicolor [broomcorn]
gb|KHG11532.1|  putative E3 ubiquitin-protein ligase MARCH10            100   5e-21   Gossypium arboreum [tree cotton]
ref|XP_010240722.1|  PREDICTED: uncharacterized protein LOC100839...    100   5e-21   
ref|XP_009383024.1|  PREDICTED: uncharacterized protein LOC103970820    100   6e-21   
ref|XP_003563408.1|  PREDICTED: uncharacterized protein LOC100839...    100   6e-21   Brachypodium distachyon [annual false brome]
ref|XP_008643895.1|  PREDICTED: hypothetical protein isoform X1         100   6e-21   Zea mays [maize]
gb|ABF69983.1|  zinc finger (C3HC4 type RING finger) family protein   98.2    6e-21   Musa acuminata [banana]
ref|NP_001148132.1|  protein binding protein                            100   7e-21   
ref|NP_001159170.1|  hypothetical protein                             99.8    7e-21   Zea mays [maize]
ref|XP_008791531.1|  PREDICTED: uncharacterized protein LOC103708...  99.0    8e-21   
ref|XP_007048885.1|  RING/U-box superfamily protein isoform 1         99.8    8e-21   Theobroma cacao [chocolate]
gb|EMS53848.1|  hypothetical protein TRIUR3_23862                     99.8    8e-21   Triticum urartu
ref|NP_001168524.1|  protein binding protein                          99.8    8e-21   Zea mays [maize]
gb|AFW69000.1|  hypothetical protein ZEAMMB73_653206                    100   1e-20   
ref|XP_008791529.1|  PREDICTED: uncharacterized protein LOC103708...  99.4    1e-20   
ref|XP_009135042.1|  PREDICTED: uncharacterized protein LOC103859282  98.6    1e-20   Brassica rapa
ref|XP_009399240.1|  PREDICTED: uncharacterized protein LOC103983...  99.4    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002884753.1|  zinc finger family protein                       99.0    1e-20   
ref|XP_008791528.1|  PREDICTED: uncharacterized protein LOC103708...  99.0    1e-20   Phoenix dactylifera
ref|XP_006297550.1|  hypothetical protein CARUB_v10013573mg           99.0    2e-20   Capsella rubella
emb|CDP16084.1|  unnamed protein product                              94.4    2e-20   Coffea canephora [robusta coffee]
emb|CDX73994.1|  BnaA03g30530D                                        98.6    2e-20   
gb|EPS61929.1|  hypothetical protein M569_12864                       93.2    2e-20   Genlisea aurea
gb|AAF23305.1|AC016661_30  unknown protein                            95.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146902.1|  PREDICTED: probable E3 ubiquitin-protein lig...  97.8    3e-20   Brassica rapa
ref|XP_004497493.1|  PREDICTED: uncharacterized protein LOC101500530  97.8    5e-20   Cicer arietinum [garbanzo]
gb|KEH39325.1|  RING/U-box protein                                    97.4    5e-20   Medicago truncatula
gb|KJB16805.1|  hypothetical protein B456_002G248600                  96.7    1e-19   Gossypium raimondii
gb|KEH42255.1|  RING/U-box protein                                    96.7    1e-19   Medicago truncatula
ref|NP_566355.1|  RING/U-box domain-containing protein                96.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398765.1|  hypothetical protein EUTSA_v10013453mg           95.5    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006593855.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  95.1    2e-19   Glycine max [soybeans]
ref|XP_001756778.1|  predicted protein                                92.0    2e-19   
ref|XP_006287667.1|  hypothetical protein CARUB_v10000877mg           95.1    3e-19   Capsella rubella
gb|KHN41341.1|  hypothetical protein glysoja_042686                   94.7    3e-19   Glycine soja [wild soybean]
ref|XP_003545062.1|  PREDICTED: uncharacterized protein LOC100798...  94.7    5e-19   
ref|XP_010688787.1|  PREDICTED: uncharacterized protein LOC104902636  94.4    6e-19   
ref|XP_009399238.1|  PREDICTED: uncharacterized protein LOC103983...  94.4    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399241.1|  PREDICTED: uncharacterized protein LOC103983...  94.4    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006595644.1|  PREDICTED: uncharacterized protein LOC100798...  94.4    8e-19   Glycine max [soybeans]
ref|XP_009384191.1|  PREDICTED: uncharacterized protein LOC103971793  94.0    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48837.1|  E3 ubiquitin-protein ligase MARCH7                    94.0    8e-19   Glycine soja [wild soybean]
ref|XP_003556847.2|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  94.0    8e-19   Glycine max [soybeans]
ref|NP_001174771.1|  Os06g0340200                                     93.6    1e-18   
gb|EEC80543.1|  hypothetical protein OsI_22844                        93.6    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006575760.1|  PREDICTED: uncharacterized protein LOC100789...  92.4    2e-18   Glycine max [soybeans]
ref|XP_004951168.1|  PREDICTED: uncharacterized protein LOC101753...  92.4    2e-18   Setaria italica
ref|XP_002873078.1|  zinc finger family protein                       92.4    3e-18   
ref|XP_006575759.1|  PREDICTED: uncharacterized protein LOC100789...  92.4    3e-18   Glycine max [soybeans]
gb|KHN29873.1|  hypothetical protein glysoja_039549                   92.4    3e-18   Glycine soja [wild soybean]
ref|XP_007145974.1|  hypothetical protein PHAVU_006G002500g           92.4    3e-18   Phaseolus vulgaris [French bean]
ref|XP_004137969.1|  PREDICTED: uncharacterized protein LOC101213656  92.4    4e-18   Cucumis sativus [cucumbers]
gb|KFK24762.1|  hypothetical protein AALP_AA8G021800                  92.0    4e-18   Arabis alpina [alpine rockcress]
ref|XP_006575758.1|  PREDICTED: uncharacterized protein LOC100789...  92.4    4e-18   Glycine max [soybeans]
ref|XP_006656056.1|  PREDICTED: uncharacterized protein LOC102711074  92.0    4e-18   Oryza brachyantha
ref|XP_002451334.1|  hypothetical protein SORBIDRAFT_04g000220        91.7    7e-18   
ref|XP_010490786.1|  PREDICTED: uncharacterized protein LOC104768486  90.9    8e-18   Camelina sativa [gold-of-pleasure]
gb|KFK24761.1|  hypothetical protein AALP_AA8G021800                  90.9    1e-17   Arabis alpina [alpine rockcress]
ref|XP_008442673.1|  PREDICTED: uncharacterized protein LOC103486...  90.1    1e-17   Cucumis melo [Oriental melon]
dbj|BAB08378.1|  unnamed protein product                              90.5    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KGN54964.1|  hypothetical protein Csa_4G617320                     87.4    1e-17   Cucumis sativus [cucumbers]
ref|XP_008442672.1|  PREDICTED: uncharacterized protein LOC103486...  90.1    2e-17   Cucumis melo [Oriental melon]
ref|XP_003521387.1|  PREDICTED: uncharacterized protein LOC100783117  89.7    2e-17   Glycine max [soybeans]
emb|CDY69891.1|  BnaCnng65820D                                        87.0    2e-17   Brassica napus [oilseed rape]
gb|KHN09496.1|  hypothetical protein glysoja_016595                   89.4    2e-17   Glycine soja [wild soybean]
ref|NP_568111.1|  RING/U-box domain-containing protein                89.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAB86085.1|  putative protein                                     89.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190212.1|  RING/U-box domain-containing protein             89.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553548.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  88.6    6e-17   Glycine max [soybeans]
gb|KHN02345.1|  hypothetical protein glysoja_002369                   88.2    7e-17   Glycine soja [wild soybean]
ref|XP_007142556.1|  hypothetical protein PHAVU_008G290800g           87.0    1e-16   Phaseolus vulgaris [French bean]
ref|XP_010423746.1|  PREDICTED: uncharacterized protein LOC104708819  87.8    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006648345.1|  PREDICTED: uncharacterized protein LOC102716758  87.8    1e-16   
emb|CDY44346.1|  BnaC02g03310D                                        87.0    1e-16   
ref|XP_003574194.1|  PREDICTED: uncharacterized protein LOC100830535  87.0    1e-16   
ref|XP_009125484.1|  PREDICTED: uncharacterized protein LOC103850479  87.0    1e-16   
ref|XP_009771006.1|  PREDICTED: uncharacterized protein LOC104221...  87.8    2e-16   
ref|XP_009771007.1|  PREDICTED: uncharacterized protein LOC104221...  87.4    2e-16   
ref|XP_007142557.1|  hypothetical protein PHAVU_008G290800g           87.0    2e-16   
ref|XP_010452187.1|  PREDICTED: uncharacterized protein LOC104734335  87.0    2e-16   
ref|NP_001045994.1|  Os02g0165000                                     87.0    2e-16   
ref|XP_004149533.1|  PREDICTED: uncharacterized protein LOC101209559  87.4    2e-16   
ref|XP_002308834.2|  hypothetical protein POPTR_0006s02490g           87.0    3e-16   
ref|XP_008464658.1|  PREDICTED: uncharacterized protein LOC103502492  86.3    4e-16   
gb|KJB26164.1|  hypothetical protein B456_004G228500                  85.9    5e-16   
emb|CDY10402.1|  BnaCnng03030D                                        84.0    9e-16   
ref|XP_007027306.1|  RING/U-box superfamily protein, putative iso...  84.7    1e-15   
ref|XP_004243622.1|  PREDICTED: uncharacterized protein LOC101249...  85.1    1e-15   
ref|XP_008645843.1|  PREDICTED: uncharacterized protein LOC103627315  84.0    2e-15   
ref|XP_009122714.1|  PREDICTED: uncharacterized protein LOC103847388  82.0    3e-15   
emb|CDY10383.1|  BnaCnng02840D                                        82.0    3e-15   
emb|CDX70311.1|  BnaA10g26600D                                        82.0    3e-15   
ref|XP_001752363.1|  predicted protein                                79.3    9e-15   
gb|EPS71315.1|  hypothetical protein M569_03445                       81.6    1e-14   
gb|KJB56108.1|  hypothetical protein B456_009G106300                  81.6    1e-14   
ref|XP_001766551.1|  predicted protein                                77.4    7e-14   
ref|XP_006588779.1|  PREDICTED: uncharacterized protein LOC100811...  79.3    9e-14   
ref|XP_006588778.1|  PREDICTED: uncharacterized protein LOC100811...  79.0    1e-13   
ref|XP_009335077.1|  PREDICTED: uncharacterized protein LOC103927...  79.0    2e-13   
ref|XP_009335078.1|  PREDICTED: uncharacterized protein LOC103927...  79.0    2e-13   
ref|XP_009405534.1|  PREDICTED: probable E3 ubiquitin-protein lig...  78.2    2e-13   
ref|XP_006429690.1|  hypothetical protein CICLE_v10011411mg           79.0    2e-13   
gb|EYU41145.1|  hypothetical protein MIMGU_mgv1a0268412mg             73.2    2e-13   
emb|CDP05696.1|  unnamed protein product                              73.6    2e-13   
gb|KEH30051.1|  RING/U-box protein                                    76.6    7e-13   
dbj|BAJ88343.1|  predicted protein                                    76.3    1e-12   
ref|XP_006378074.1|  hypothetical protein POPTR_0010s01870g           75.5    1e-12   
ref|XP_006378076.1|  hypothetical protein POPTR_0010s01880g           75.5    2e-12   
ref|XP_006378075.1|  hypothetical protein POPTR_0010s01880g           75.5    2e-12   
ref|XP_002516851.1|  protein binding protein, putative                74.7    3e-12   
ref|XP_002963299.1|  hypothetical protein SELMODRAFT_80091            72.4    3e-12   
gb|KJB16804.1|  hypothetical protein B456_002G248600                  74.3    3e-12   
ref|XP_002974598.1|  hypothetical protein SELMODRAFT_101614           72.4    4e-12   
ref|XP_011005083.1|  PREDICTED: uncharacterized protein LOC105111...  73.9    6e-12   
ref|XP_011005085.1|  PREDICTED: uncharacterized protein LOC105111...  73.9    6e-12   
ref|XP_011005084.1|  PREDICTED: uncharacterized protein LOC105111...  73.9    6e-12   
gb|KDP40037.1|  hypothetical protein JCGZ_02035                       73.2    8e-12   
ref|XP_010938690.1|  PREDICTED: uncharacterized protein LOC105057...  72.8    9e-12   
ref|XP_010938689.1|  PREDICTED: uncharacterized protein LOC105057...  72.8    1e-11   
ref|XP_010938688.1|  PREDICTED: uncharacterized protein LOC105057...  73.2    1e-11   
ref|XP_010938682.1|  PREDICTED: uncharacterized protein LOC105057...  73.2    1e-11   
ref|XP_010938684.1|  PREDICTED: uncharacterized protein LOC105057...  73.2    1e-11   
ref|XP_010938687.1|  PREDICTED: uncharacterized protein LOC105057...  72.8    1e-11   
ref|XP_010938683.1|  PREDICTED: uncharacterized protein LOC105057...  73.2    1e-11   
ref|XP_010938685.1|  PREDICTED: uncharacterized protein LOC105057...  73.2    1e-11   
ref|XP_010938686.1|  PREDICTED: uncharacterized protein LOC105057...  72.8    1e-11   
ref|XP_002963302.1|  hypothetical protein SELMODRAFT_80471            70.5    1e-11   
ref|XP_002987453.1|  hypothetical protein SELMODRAFT_126133           70.5    2e-11   
gb|ACA35275.1|  zinc finger protein                                   72.0    2e-11   
ref|XP_002963306.1|  hypothetical protein SELMODRAFT_438472           72.4    3e-11   
ref|XP_002277762.1|  PREDICTED: uncharacterized protein LOC100259554  71.6    3e-11   
ref|XP_008796190.1|  PREDICTED: uncharacterized protein LOC103711...  70.5    6e-11   
ref|XP_008796189.1|  PREDICTED: uncharacterized protein LOC103711...  70.5    7e-11   
ref|XP_009369087.1|  PREDICTED: uncharacterized protein LOC103958...  70.1    9e-11   
ref|XP_009352190.1|  PREDICTED: uncharacterized protein LOC103943603  70.1    9e-11   
ref|XP_009369085.1|  PREDICTED: uncharacterized protein LOC103958...  70.1    1e-10   
ref|XP_008340858.1|  PREDICTED: uncharacterized protein LOC103403...  69.7    1e-10   
ref|XP_008340860.1|  PREDICTED: uncharacterized protein LOC103403...  69.3    1e-10   
ref|XP_008340861.1|  PREDICTED: uncharacterized protein LOC103403...  69.3    1e-10   
ref|XP_008340855.1|  PREDICTED: uncharacterized protein LOC103403...  69.3    2e-10   
gb|KEH36712.1|  zinc finger protein                                   68.2    2e-10   
ref|XP_011034243.1|  PREDICTED: uncharacterized protein LOC105132...  68.6    3e-10   
ref|XP_011034244.1|  PREDICTED: uncharacterized protein LOC105132...  68.6    3e-10   
ref|XP_006489184.1|  PREDICTED: uncharacterized protein LOC102619...  68.2    4e-10   
ref|XP_008390745.1|  PREDICTED: uncharacterized protein LOC103452...  68.2    4e-10   
ref|XP_006419696.1|  hypothetical protein CICLE_v10004940mg           68.2    4e-10   
ref|XP_006489181.1|  PREDICTED: uncharacterized protein LOC102619...  68.2    4e-10   
ref|XP_006419697.1|  hypothetical protein CICLE_v10004940mg           68.2    4e-10   
ref|XP_003594026.1|  E3 ubiquitin-protein ligase MARCH1               67.8    5e-10   
ref|XP_008223090.1|  PREDICTED: uncharacterized protein LOC103322...  67.8    5e-10   
gb|KDO74978.1|  hypothetical protein CISIN_1g015199mg                 67.8    5e-10   
gb|KEH36713.1|  zinc finger protein                                   67.8    6e-10   
ref|XP_007222440.1|  hypothetical protein PRUPE_ppa006131mg           67.4    7e-10   
gb|KJB12612.1|  hypothetical protein B456_002G026800                  66.6    8e-10   
ref|XP_010024521.1|  PREDICTED: uncharacterized protein LOC104414984  67.0    9e-10   
gb|KCW60973.1|  hypothetical protein EUGRSUZ_H03711                   67.0    1e-09   
ref|XP_004144971.1|  PREDICTED: uncharacterized protein LOC101219420  66.6    1e-09   
gb|KJB12611.1|  hypothetical protein B456_002G026800                  66.6    1e-09   
ref|XP_008458502.1|  PREDICTED: uncharacterized protein LOC103497...  66.6    1e-09   
ref|XP_008458500.1|  PREDICTED: uncharacterized protein LOC103497...  66.6    1e-09   
ref|XP_010323931.1|  PREDICTED: uncharacterized protein LOC101249...  66.6    2e-09   
ref|XP_010323932.1|  PREDICTED: uncharacterized protein LOC101249...  66.2    2e-09   
ref|XP_004296783.1|  PREDICTED: uncharacterized protein LOC101291421  65.9    2e-09   
ref|XP_004165428.1|  PREDICTED: uncharacterized protein LOC101229698  62.8    2e-09   
gb|KHG02622.1|  E3 ubiquitin-protein ligase MARCH8                    64.7    4e-09   
ref|XP_009787148.1|  PREDICTED: uncharacterized protein LOC104235...  64.3    8e-09   
ref|XP_009787180.1|  PREDICTED: uncharacterized protein LOC104235...  64.3    8e-09   
ref|XP_009596460.1|  PREDICTED: uncharacterized protein LOC104092...  64.3    8e-09   
ref|XP_009596457.1|  PREDICTED: uncharacterized protein LOC104092...  64.3    8e-09   
ref|XP_009596459.1|  PREDICTED: uncharacterized protein LOC104092...  63.9    1e-08   
ref|XP_009787171.1|  PREDICTED: uncharacterized protein LOC104235...  63.9    1e-08   
ref|XP_002963304.1|  hypothetical protein SELMODRAFT_80151            62.4    1e-08   
ref|XP_004486077.1|  PREDICTED: uncharacterized protein LOC101502...  63.2    1e-08   
ref|XP_010323933.1|  PREDICTED: uncharacterized protein LOC101249...  63.5    2e-08   
ref|XP_004486075.1|  PREDICTED: uncharacterized protein LOC101502...  62.8    2e-08   
ref|XP_010906568.1|  PREDICTED: uncharacterized protein LOC105033...  63.2    2e-08   
ref|XP_010906561.1|  PREDICTED: uncharacterized protein LOC105033...  63.2    2e-08   
gb|KHN33107.1|  E3 ubiquitin-protein ligase MARCH4                    62.8    2e-08   
ref|XP_003546106.1|  PREDICTED: uncharacterized protein LOC100527...  62.8    3e-08   
ref|XP_004486076.1|  PREDICTED: uncharacterized protein LOC101502...  62.8    3e-08   
ref|XP_010098321.1|  putative E3 ubiquitin-protein ligase IE1         62.8    3e-08   
ref|XP_007147851.1|  hypothetical protein PHAVU_006G160100g           62.8    3e-08   
gb|AFW57742.1|  hypothetical protein ZEAMMB73_211482                  62.8    3e-08   
gb|KEH42253.1|  RING/U-box protein                                    62.4    3e-08   
ref|XP_003541652.1|  PREDICTED: uncharacterized protein LOC100777100  62.4    4e-08   
ref|NP_001030648.2|  RING/U-box domain-containing protein             61.2    4e-08   
gb|KHN37525.1|  ERAD-associated E3 ubiquitin-protein ligase DOA10     62.4    4e-08   
ref|NP_566281.1|  RING/U-box domain-containing protein                61.6    6e-08   
gb|AAM65991.1|  unknown                                               61.6    7e-08   
ref|XP_008791532.1|  PREDICTED: uncharacterized protein LOC103708...  60.8    8e-08   
ref|XP_007035439.1|  RING/U-box superfamily protein                   61.2    9e-08   
ref|XP_008804712.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  61.2    9e-08   
ref|XP_010486138.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  60.8    1e-07   
ref|XP_010666389.1|  PREDICTED: uncharacterized protein LOC104883546  60.8    1e-07   
ref|XP_010486137.1|  PREDICTED: uncharacterized protein LOC104764...  60.8    1e-07   
ref|XP_006297692.1|  hypothetical protein CARUB_v10013722mg           60.5    1e-07   
ref|XP_010464203.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  60.5    2e-07   
ref|XP_010464202.1|  PREDICTED: uncharacterized protein LOC104744...  60.5    2e-07   
ref|XP_010438655.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  60.5    2e-07   
ref|XP_010244655.1|  PREDICTED: uncharacterized protein LOC104588...  60.5    2e-07   
ref|XP_002882464.1|  hypothetical protein ARALYDRAFT_477933           60.1    2e-07   
gb|KFK38073.1|  hypothetical protein AALP_AA3G066200                  60.1    2e-07   
gb|KFK38072.1|  hypothetical protein AALP_AA3G066200                  60.1    2e-07   
ref|XP_009129659.1|  PREDICTED: uncharacterized protein LOC103854...  59.7    3e-07   
ref|XP_009129658.1|  PREDICTED: uncharacterized protein LOC103854...  59.7    3e-07   
emb|CDY24702.1|  BnaA05g31010D                                        59.7    3e-07   
emb|CDY05254.1|  BnaC05g45490D                                        59.7    3e-07   
emb|CDO98932.1|  unnamed protein product                              59.3    4e-07   
ref|XP_010524770.1|  PREDICTED: probable E3 ubiquitin-protein lig...  59.3    4e-07   
ref|XP_006357002.1|  PREDICTED: uncharacterized protein LOC102592492  59.3    4e-07   
emb|CDX74109.1|  BnaA03g29380D                                        58.5    8e-07   
ref|XP_009124929.1|  PREDICTED: uncharacterized protein LOC103849...  58.2    9e-07   
ref|XP_009124931.1|  PREDICTED: uncharacterized protein LOC103849...  58.2    9e-07   
ref|XP_009124930.1|  PREDICTED: uncharacterized protein LOC103849...  58.2    9e-07   
ref|XP_009124927.1|  PREDICTED: uncharacterized protein LOC103849...  58.2    9e-07   
ref|XP_009124928.1|  PREDICTED: uncharacterized protein LOC103849...  58.2    1e-06   
ref|XP_009134888.1|  PREDICTED: uncharacterized protein LOC103859152  58.2    1e-06   
emb|CDY18852.1|  BnaAnng03170D                                        57.8    1e-06   
emb|CDY08057.1|  BnaC03g34660D                                        57.8    1e-06   
ref|XP_006407960.1|  hypothetical protein EUTSA_v10020737mg           57.8    1e-06   
ref|XP_006407959.1|  hypothetical protein EUTSA_v10020737mg           57.4    1e-06   
ref|XP_002878936.1|  hypothetical protein ARALYDRAFT_901340           54.7    1e-06   
ref|XP_004229192.1|  PREDICTED: probable E3 ubiquitin-protein lig...  56.2    4e-06   
ref|XP_010906552.1|  PREDICTED: uncharacterized protein LOC105033...  55.8    5e-06   
ref|XP_010906542.1|  PREDICTED: uncharacterized protein LOC105033...  55.8    6e-06   
gb|KJB72554.1|  hypothetical protein B456_011G184700                  55.5    7e-06   
gb|KJB72553.1|  hypothetical protein B456_011G184700                  54.7    1e-05   
ref|XP_008804711.1|  PREDICTED: uncharacterized protein LOC103717...  54.3    2e-05   
ref|XP_008804709.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  54.3    2e-05   
ref|XP_011090869.1|  PREDICTED: uncharacterized protein LOC105171...  53.5    3e-05   
ref|XP_010558499.1|  PREDICTED: uncharacterized protein LOC104827...  53.5    4e-05   
ref|XP_010558498.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    4e-05   
ref|XP_010558497.1|  PREDICTED: uncharacterized protein DDB_G0271...  53.1    4e-05   
ref|XP_011090868.1|  PREDICTED: uncharacterized protein LOC105171...  53.1    5e-05   
gb|KJB56110.1|  hypothetical protein B456_009G106300                  42.7    6e-05   
gb|EYU43877.1|  hypothetical protein MIMGU_mgv1a018932mg              52.4    8e-05   



>ref|XP_009771341.1| PREDICTED: uncharacterized protein LOC104221895 isoform X2 [Nicotiana 
sylvestris]
Length=485

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 6/132 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVLSILLSTFAGFG
Sbjct  358  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLSILLSTFAGFG  417

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSS+LVE+FRWRRRR+ LL +Q+N Q+ LPPG W PQ NQ       T+S+VGPQ+
Sbjct  418  VAMSGSSLLVEFFRWRRRRQALLEQQQNSQMILPPGGW-PQMNQ-----PPTSSRVGPQN  471

Query  257  HQTDIENPETFS  222
            +Q DIENPETFS
Sbjct  472  YQHDIENPETFS  483



>ref|XP_009771340.1| PREDICTED: uncharacterized protein LOC104221895 isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 6/132 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVLSILLSTFAGFG
Sbjct  385  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLSILLSTFAGFG  444

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSS+LVE+FRWRRRR+ LL +Q+N Q+ LPPG W PQ NQ       T+S+VGPQ+
Sbjct  445  VAMSGSSLLVEFFRWRRRRQALLEQQQNSQMILPPGGW-PQMNQ-----PPTSSRVGPQN  498

Query  257  HQTDIENPETFS  222
            +Q DIENPETFS
Sbjct  499  YQHDIENPETFS  510



>ref|XP_009592141.1| PREDICTED: uncharacterized protein LOC104089035 [Nicotiana tomentosiformis]
Length=505

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 113/132 (86%), Gaps = 4/132 (3%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVLSILLSTFAGFG
Sbjct  376  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLSILLSTFAGFG  435

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSS+LVE+FRWRRRR+ LL +Q+N Q+ LPPG W PQ NQ  T++      VGPQ+
Sbjct  436  VAMSGSSLLVEFFRWRRRRQALLEQQQNSQMILPPGGW-PQMNQPPTSSRV---SVGPQN  491

Query  257  HQTDIENPETFS  222
            +Q DIENPETFS
Sbjct  492  YQHDIENPETFS  503



>ref|XP_004251127.1| PREDICTED: uncharacterized protein LOC101256453 [Solanum lycopersicum]
Length=523

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 6/134 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQ VLSILLSTFAGFG
Sbjct  396  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQPVLSILLSTFAGFG  455

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMS SS+LVE+FRW+RRR  LL +Q+N  + LPPG W PQ NQ       TTS++GPQ+
Sbjct  456  VAMSASSLLVEFFRWKRRRAALLEQQQNADMVLPPGGW-PQMNQ-----PATTSRIGPQN  509

Query  257  HQTDIENPETFSGS  216
            HQ DIENPETFS S
Sbjct  510  HQHDIENPETFSWS  523



>ref|XP_006340158.1| PREDICTED: uncharacterized protein LOC102578157 [Solanum tuberosum]
Length=524

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 111/136 (82%), Gaps = 10/136 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQ VLSILLSTFAGFG
Sbjct  397  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQPVLSILLSTFAGFG  456

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP--PQPNQtvtatattTSQVGP  264
            VAMS SS+LVE+FRW+RRR  LL +Q+N ++ LPPG WP   QP         TTS+VGP
Sbjct  457  VAMSASSLLVEFFRWKRRRAALLEQQQNAEMILPPGGWPHMNQP--------ATTSRVGP  508

Query  263  QHHQTDIENPETFSGS  216
            Q+HQ DIENPETFS S
Sbjct  509  QNHQHDIENPETFSWS  524



>emb|CDP07119.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 108/134 (81%), Gaps = 7/134 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYS+VHVQAVLSILLSTFAGFG
Sbjct  408  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSVVHVQAVLSILLSTFAGFG  467

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQ-ENPQVALPPGRWPPQPNQtvtatattTSQVGPQ  261
            VAMSGSSI+VE+ RWRR+++    +Q +N QV L PGRWP Q      + + T S+V P 
Sbjct  468  VAMSGSSIVVEFLRWRRQQQAFADQQHQNSQVMLHPGRWPQQ------SQSETISRVAPN  521

Query  260  HHQTDIENPETFSG  219
              Q DIENPETFSG
Sbjct  522  LRQADIENPETFSG  535



>ref|XP_011089894.1| PREDICTED: uncharacterized protein LOC105170709 [Sesamum indicum]
Length=518

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFY+LVHVQ VLSIL+STFAGFG
Sbjct  389  SCVLGLLASMTSSTMVKRRFVWVYASVQFALVVLFAHIFYNLVHVQPVLSILISTFAGFG  448

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQE-NPQVALPPGRWPPQPNQtvtatattTSQVGPQ  261
            VAMSGSS++VE  RWRRRR  L ++ E + Q+ L P R PP P+Q     AT +S   P+
Sbjct  449  VAMSGSSVVVEVLRWRRRREALRNQNEISNQIMLNPSRRPP-PSQ----VATLSSYSSPR  503

Query  260  HHQTDIENPETFSGS  216
            HH++++ NPETFSGS
Sbjct  504  HHRSEVGNPETFSGS  518



>ref|XP_006424588.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
 gb|ESR37828.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
Length=515

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 89/134 (66%), Gaps = 20/134 (15%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYSLV VQAVLSILL+TFAGFG
Sbjct  400  SCVLGLLASMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSLVGVQAVLSILLATFAGFG  459

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG-PQ  261
            VAMSGSSILVE+         L  +Q          RW  + NQ          Q     
Sbjct  460  VAMSGSSILVEF---------LRWKQ----------RWEARSNQQHPVLFPAPLQTAHRD  500

Query  260  HHQTDIENPETFSG  219
             HQ D+ENPETFSG
Sbjct  501  RHQADVENPETFSG  514



>gb|KDO73243.1| hypothetical protein CISIN_1g010219mg [Citrus sinensis]
Length=515

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 89/134 (66%), Gaps = 20/134 (15%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYSLV VQAVLSILL+TF+GFG
Sbjct  400  SCVLGLLASMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSLVGVQAVLSILLATFSGFG  459

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG-PQ  261
            VAMSGSSILVE+         L  +Q          RW  + NQ          Q     
Sbjct  460  VAMSGSSILVEF---------LRWKQ----------RWEARSNQQHPVLFPAPLQTAHRD  500

Query  260  HHQTDIENPETFSG  219
             HQ D+ENPETFSG
Sbjct  501  RHQADVENPETFSG  514



>ref|XP_006488111.1| PREDICTED: uncharacterized protein LOC102606695 [Citrus sinensis]
Length=515

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 89/134 (66%), Gaps = 20/134 (15%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYSLV VQAVLSILL+TF+GFG
Sbjct  400  SCVLGLLASMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSLVGVQAVLSILLATFSGFG  459

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG-PQ  261
            VAMSGSSILVE+         L  +Q          RW  + NQ          Q     
Sbjct  460  VAMSGSSILVEF---------LRWKQ----------RWEARSNQQHPVLFPAPLQTAHRD  500

Query  260  HHQTDIENPETFSG  219
             HQ D+ENPETFSG
Sbjct  501  RHQADVENPETFSG  514



>gb|KDP44062.1| hypothetical protein JCGZ_05529 [Jatropha curcas]
Length=513

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 11/136 (8%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CVLGLL SM SSTMVKRRFVWVYAS+QFA VVLFAHIFYSLV++QAVLSILL+TF+GFG
Sbjct  387  ACVLGLLSSMISSTMVKRRFVWVYASIQFALVVLFAHIFYSLVNLQAVLSILLATFSGFG  446

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVAL-PPGRWPPQPNQtvtatattTSQVGPQ  261
            VAMSGSSILVE FRWRRR      +Q+   V   PPG++P   N          SQ G +
Sbjct  447  VAMSGSSILVEIFRWRRRWIAQSEQQQGSFVMTGPPGQFPRTTNS---------SQRGSR  497

Query  260  -HHQTDIENPETFSGS  216
               + D+ENPE+F+G+
Sbjct  498  DRRRNDVENPESFNGN  513



>gb|KHN38770.1| hypothetical protein glysoja_008319 [Glycine soja]
Length=524

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YASVQFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  391  SCVLGLLSSMTSSTMVKSRFIWIYASVQFALVVLFAHIFYSVVHVQAVLSILLATFAGFG  450

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPN  309
            V MSGSSILVEYFRWRRR + L  ++  PQ+    G+ P   N
Sbjct  451  VVMSGSSILVEYFRWRRRVQALSEQRHGPQLMPQAGQNPRTSN  493



>ref|XP_006591142.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Glycine max]
Length=523

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YASVQFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  390  SCVLGLLSSMTSSTMVKSRFIWIYASVQFALVVLFAHIFYSVVHVQAVLSILLATFAGFG  449

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPN  309
            V MSGSSILVEYFRWRRR + L  ++  PQ+    G+ P   N
Sbjct  450  VVMSGSSILVEYFRWRRRVQALSEQRHGPQLMPQAGQNPRTSN  492



>ref|XP_011089306.1| PREDICTED: uncharacterized protein LOC105170304 isoform X2 [Sesamum 
indicum]
 ref|XP_011089307.1| PREDICTED: uncharacterized protein LOC105170304 isoform X2 [Sesamum 
indicum]
Length=482

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSS MVKRRFVWVYAS+QFA VV+FAHIFY+LVHVQA +SILLSTFAGFG
Sbjct  354  SCVLGLLSSVTSSAMVKRRFVWVYASIQFAIVVIFAHIFYNLVHVQAFVSILLSTFAGFG  413

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALP-PGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSG+SIL+E  RWR R R + +  E      P P + PP       +   T S   P+
Sbjct  414  IAMSGTSILLEVLRWRERGRPVTNENEMSNNTRPNPSQAPP------PSLIATPSHSSPR  467

Query  260  HHQTDIENPETFSGS  216
              + D+ENPET SGS
Sbjct  468  PQRDDVENPETSSGS  482



>ref|XP_011089303.1| PREDICTED: uncharacterized protein LOC105170304 isoform X1 [Sesamum 
indicum]
 ref|XP_011089304.1| PREDICTED: uncharacterized protein LOC105170304 isoform X1 [Sesamum 
indicum]
Length=514

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSS MVKRRFVWVYAS+QFA VV+FAHIFY+LVHVQA +SILLSTFAGFG
Sbjct  386  SCVLGLLSSVTSSAMVKRRFVWVYASIQFAIVVIFAHIFYNLVHVQAFVSILLSTFAGFG  445

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALP-PGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSG+SIL+E  RWR R R + +  E      P P + PP       +   T S   P+
Sbjct  446  IAMSGTSILLEVLRWRERGRPVTNENEMSNNTRPNPSQAPP------PSLIATPSHSSPR  499

Query  260  HHQTDIENPETFSGS  216
              + D+ENPET SGS
Sbjct  500  PQRDDVENPETSSGS  514



>ref|XP_004505986.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Cicer arietinum]
 ref|XP_004505987.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Cicer arietinum]
Length=515

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YAS QFA VVLFAHIFYSLVHVQAVLS+LL+TFAGFG
Sbjct  390  SCVLGLLSSMTSSTMVKSRFIWIYASFQFAMVVLFAHIFYSLVHVQAVLSVLLATFAGFG  449

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSGSSILVE+FRWRRR + L  +Q  PQ+    G+ P
Sbjct  450  VVMSGSSILVEFFRWRRRSQALQEQQHGPQLMTQAGQQP  488



>gb|KHN32082.1| hypothetical protein glysoja_028877 [Glycine soja]
Length=509

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YAS QFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  380  SCVLGLLSSMTSSTMVKSRFIWIYASAQFALVVLFAHIFYSVVHVQAVLSILLATFAGFG  439

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPN  309
            V MSGSSILVE+FRWRRR + L  +Q  PQ+     + P  PN
Sbjct  440  VVMSGSSILVEFFRWRRRVQALQEQQHGPQLMPQAAQNPRTPN  482



>ref|XP_007132248.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 ref|XP_007132249.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 gb|ESW04242.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 gb|ESW04243.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
Length=516

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 97/137 (71%), Gaps = 10/137 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YASVQFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  387  SCVLGLLSSMTSSTMVKSRFIWIYASVQFALVVLFAHIFYSMVHVQAVLSILLATFAGFG  446

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG---  267
            V MSGSSILVE++RWR R + L  ++  PQ+        PQ  Q   ++ T  S  G   
Sbjct  447  VVMSGSSILVEFYRWRGRLQALSEQRHGPQLI-------PQTGQNPRSSNTPHSDSGSGP  499

Query  266  PQHHQTDIENPETFSGS  216
            P H Q  ++N +  + S
Sbjct  500  PNHSQAVVQNEQNSNQS  516



>ref|XP_010043740.1| PREDICTED: uncharacterized protein LOC104432868 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85731.1| hypothetical protein EUGRSUZ_B02493 [Eucalyptus grandis]
Length=513

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSSTMVK RFVWVYAS QF  VVLFAH+FYSLVH+QA+LS+L ++FAGFG
Sbjct  387  SCVLGLLASITSSTMVKSRFVWVYASFQFGLVVLFAHLFYSLVHLQAILSVLFASFAGFG  446

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSSILVE+FRW+RRRR  L +    QVA+       +P+Q    +  +  +     
Sbjct  447  VAMSGSSILVEFFRWKRRRRAHLVQSRRAQVAI-------RPSQAPRGSLESPWEGSSLT  499

Query  257  HQTDIENPETFSGS  216
            H T + NPETFSGS
Sbjct  500  HPTHVNNPETFSGS  513



>ref|XP_010043741.1| PREDICTED: uncharacterized protein LOC104432868 isoform X2 [Eucalyptus 
grandis]
Length=496

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSSTMVK RFVWVYAS QF  VVLFAH+FYSLVH+QA+LS+L ++FAGFG
Sbjct  370  SCVLGLLASITSSTMVKSRFVWVYASFQFGLVVLFAHLFYSLVHLQAILSVLFASFAGFG  429

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSSILVE+FRW+RRRR  L +    QVA+       +P+Q    +  +  +     
Sbjct  430  VAMSGSSILVEFFRWKRRRRAHLVQSRRAQVAI-------RPSQAPRGSLESPWEGSSLT  482

Query  257  HQTDIENPETFSGS  216
            H T + NPETFSGS
Sbjct  483  HPTHVNNPETFSGS  496



>ref|XP_003539714.1| PREDICTED: probable E3 ubiquitin-protein ligase MARCH10-like 
[Glycine max]
Length=514

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 87/121 (72%), Gaps = 10/121 (8%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YAS QFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  390  SCVLGLLSSMTSSTMVKSRFIWIYASAQFALVVLFAHIFYSVVHVQAVLSILLATFAGFG  449

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V MSGSSILVE+FRWRRR + L  +Q  P    P     P+P           S  GP +
Sbjct  450  VVMSGSSILVEFFRWRRRVQALQEQQHGPAAQNPRTPNTPRPG----------SGSGPSN  499

Query  257  H  255
            H
Sbjct  500  H  500



>gb|AFK43529.1| unknown [Lotus japonicus]
Length=139

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVK RF+W+YASVQFA VVLFAHIFYS+VHVQAVLSILL+TFAGFG
Sbjct  28   SCVLGLLSSMTSSTMVKSRFIWIYASVQFALVVLFAHIFYSVVHVQAVLSILLATFAGFG  87

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQE--NPQVALPP  333
            V M GSSILVE FRWRRR + L  +Q+   PQ A  P
Sbjct  88   VVMCGSSILVEVFRWRRRWQALSEQQQLHGPQTANTP  124



>gb|KEH30048.1| RING/U-box protein, putative [Medicago truncatula]
Length=138

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV  RF+W+YAS QFA VVLFAHIFYSLVHVQAVLSILL+TFAGFG
Sbjct  13   SCVLGLLSSMTSSTMVMSRFIWIYASFQFALVVLFAHIFYSLVHVQAVLSILLATFAGFG  72

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSGSS+LVE+FRWRRR +  L +Q  P      G+ P
Sbjct  73   VVMSGSSMLVEFFRWRRRWQASLEQQHGPLPMTQAGQQP  111



>ref|XP_010651156.1| PREDICTED: uncharacterized protein LOC100257089 [Vitis vinifera]
Length=522

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT+STMVKRRF+WVYAS+QFA VVLFAHIFYSLV VQAVLSILLSTFAG G
Sbjct  388  SCVLGLLASMTASTMVKRRFIWVYASIQFALVVLFAHIFYSLVRVQAVLSILLSTFAGLG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG-PQ  261
            +AMSGSSI+VE  RWR R      +Q+  Q      +   QP Q   + A +       Q
Sbjct  448  IAMSGSSIIVELLRWRLRWHAWSEQQQQQQQQRQRSQVGAQPGQAAESAAASHHANSHHQ  507

Query  260  HHQTDIENPETFSGS  216
             H T+ ENPETFS S
Sbjct  508  RHHTESENPETFSRS  522



>ref|XP_009791384.1| PREDICTED: uncharacterized protein LOC104238660 isoform X1 [Nicotiana 
sylvestris]
Length=500

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 97/134 (72%), Gaps = 16/134 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SSTMVKRRFVWVYASVQF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  383  SCVLGLLSSLASSTMVKRRFVWVYASVQFILVVFFAHMFYSLVHVQAVLSILLSTFAGLG  442

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SI+VE+ RW+RRR++LL  Q+N Q+           NQ        +S    QH
Sbjct  443  VAMGGCSIVVEFLRWKRRRQLLLDMQQNSQL-----------NQ-----TAASSHTDRQH  486

Query  257  HQTDIENPETFSGS  216
            +Q DIENP TFSGS
Sbjct  487  NQPDIENPATFSGS  500



>ref|XP_009791385.1| PREDICTED: uncharacterized protein LOC104238660 isoform X2 [Nicotiana 
sylvestris]
Length=496

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 97/134 (72%), Gaps = 16/134 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SSTMVKRRFVWVYASVQF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  379  SCVLGLLSSLASSTMVKRRFVWVYASVQFILVVFFAHMFYSLVHVQAVLSILLSTFAGLG  438

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SI+VE+ RW+RRR++LL  Q+N Q+           NQ        +S    QH
Sbjct  439  VAMGGCSIVVEFLRWKRRRQLLLDMQQNSQL-----------NQ-----TAASSHTDRQH  482

Query  257  HQTDIENPETFSGS  216
            +Q DIENP TFSGS
Sbjct  483  NQPDIENPATFSGS  496



>ref|XP_010098199.1| hypothetical protein L484_007661 [Morus notabilis]
 gb|EXB74655.1| hypothetical protein L484_007661 [Morus notabilis]
Length=502

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT+STMVKRRFVWVYAS+QFA VVLFAHIFYSL+HVQAVL ILL+TFAG G
Sbjct  410  SCVLGLLSSMTASTMVKRRFVWVYASIQFALVVLFAHIFYSLIHVQAVLCILLATFAGLG  469

Query  437  VAMSGSSILVEYF  399
            V+MSGSSI+VE+ 
Sbjct  470  VSMSGSSIIVEFL  482



>emb|CBI16306.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT+STMVKRRF+WVYAS+QFA VVLFAHIFYSLV VQAVLSILLSTFAG G
Sbjct  227  SCVLGLLASMTASTMVKRRFIWVYASIQFALVVLFAHIFYSLVRVQAVLSILLSTFAGLG  286

Query  437  VAMSGSSILVEYF  399
            +AMSGSSI+VE  
Sbjct  287  IAMSGSSIIVELL  299



>ref|XP_003606394.1| hypothetical protein MTR_4g059540 [Medicago truncatula]
Length=511

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV  RF+W+YAS QFA VVLFAHIFYSLVHVQAVLSILL+TFAGFG
Sbjct  386  SCVLGLLSSMTSSTMVMSRFIWIYASFQFALVVLFAHIFYSLVHVQAVLSILLATFAGFG  445

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSGSS+LVE+FRWRRR +  L +Q  P      G+ P
Sbjct  446  VVMSGSSMLVEFFRWRRRWQASLEQQHGPLPMTQAGQQP  484



>gb|AES88591.2| RING/U-box protein [Medicago truncatula]
Length=521

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV  RF+W+YAS QFA VVLFAHIFYSLVHVQAVLSILL+TFAGFG
Sbjct  396  SCVLGLLSSMTSSTMVMSRFIWIYASFQFALVVLFAHIFYSLVHVQAVLSILLATFAGFG  455

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSGSS+LVE+FRWRRR +  L +Q  P      G+ P
Sbjct  456  VVMSGSSMLVEFFRWRRRWQASLEQQHGPLPMTQAGQQP  494



>ref|XP_004295025.1| PREDICTED: uncharacterized protein LOC101315129 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461707.1| PREDICTED: uncharacterized protein LOC101315129 [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVL ILL+TFAG G
Sbjct  388  SCVLGLLSSMTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLCILLATFAGLG  447

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  448  VAMSGSSIIVE  458



>ref|XP_006378964.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
 gb|ERP56761.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
Length=519

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 5/134 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVL LL SM SSTMV+RRFVWVYAS+QFA +VLFAHIFY+LV+VQAVL+ILL+T +GFG
Sbjct  391  SCVLALLSSMISSTMVRRRFVWVYASIQFALIVLFAHIFYTLVNVQAVLAILLATLSGFG  450

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSSILVE+ RWRRR      +  + QV   PG     P Q    ++ ++++     
Sbjct  451  VAMSGSSILVEFLRWRRRWHAQHGQLHSSQVITGPG-----PFQRAVNSSNSSTRGHHNF  505

Query  257  HQTDIENPETFSGS  216
               ++ENPET  GS
Sbjct  506  QPNEVENPETLRGS  519



>ref|XP_002314269.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
 gb|EEE88224.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
Length=521

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 5/134 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVL LL SM SSTMV+RRFVWVYAS+QFA +VLFAHIFY+LV+VQAVL+ILL+T +GFG
Sbjct  393  SCVLALLSSMISSTMVRRRFVWVYASIQFALIVLFAHIFYTLVNVQAVLAILLATLSGFG  452

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAMSGSSILVE+ RWRRR      +  + QV   PG     P Q    ++ ++++     
Sbjct  453  VAMSGSSILVEFLRWRRRWHAQHGQLHSSQVITGPG-----PFQRAVNSSNSSTRGHHNF  507

Query  257  HQTDIENPETFSGS  216
               ++ENPET  GS
Sbjct  508  QPNEVENPETLRGS  521



>gb|KHG21185.1| E3 ubiquitin-protein ligase MARCH7 [Gossypium arboreum]
Length=512

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 94/138 (68%), Gaps = 17/138 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYAS+QFA VV FAHIFYSLV VQ++LSILL+TF+GFG
Sbjct  388  SCVLGLLSSMTSSTMVQRRFVWVYASIQFALVVFFAHIFYSLVKVQSILSILLATFSGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVAL-PPGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSGSSI+VE  RWRRR +    ++   Q    PP + P   N              PQ
Sbjct  448  IAMSGSSIIVEILRWRRRWQAWWQQRHRSQTTTHPPIQSPRAVN-------------SPQ  494

Query  260  HHQT---DIENPETFSGS  216
             H++     +N ETFSGS
Sbjct  495  THRSPNVSQQNAETFSGS  512



>gb|KHG09093.1| E3 ubiquitin-protein ligase MARCH7 [Gossypium arboreum]
Length=508

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYAS+QFA VV FAH+FYSLV VQAVLSILL+TF+GFG
Sbjct  385  SCVLGLLASMTSSTMVKRRFIWVYASIQFALVVFFAHMFYSLVKVQAVLSILLATFSGFG  444

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  445  VAMSGSSIIVE  455



>ref|XP_008225582.1| PREDICTED: uncharacterized protein LOC103325214 [Prunus mume]
Length=482

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVL ILL+TFAG G
Sbjct  394  SCVLGLLSSMTSTTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLCILLATFAGLG  453

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  454  VAMSGSSIIVE  464



>ref|XP_007205129.1| hypothetical protein PRUPE_ppa005009mg [Prunus persica]
 gb|EMJ06328.1| hypothetical protein PRUPE_ppa005009mg [Prunus persica]
Length=482

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVL ILL+TFAG G
Sbjct  394  SCVLGLLSSMTSTTMVKRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLCILLATFAGLG  453

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  454  VAMSGSSIIVE  464



>gb|KJB26161.1| hypothetical protein B456_004G228500 [Gossypium raimondii]
Length=514

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYAS+QFA VV FAH+FYSLV VQAVLSILL+TF+GFG
Sbjct  391  SCVLGLLASMTSSTMVKRRFIWVYASIQFALVVFFAHMFYSLVKVQAVLSILLATFSGFG  450

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  451  VAMSGSSIIVE  461



>gb|KJB26163.1| hypothetical protein B456_004G228500 [Gossypium raimondii]
Length=315

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYAS+QFA VV FAH+FYSLV VQAVLSILL+TF+GFG
Sbjct  192  SCVLGLLASMTSSTMVKRRFIWVYASIQFALVVFFAHMFYSLVKVQAVLSILLATFSGFG  251

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  252  VAMSGSSIIVE  262



>ref|XP_008463891.1| PREDICTED: uncharacterized protein LOC103501900 isoform X3 [Cucumis 
melo]
Length=460

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYS+V +QAVLSILL+TF GFG
Sbjct  358  SCVLGLLSSMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSVVGIQAVLSILLATFTGFG  417

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSG+SILVE+ RWRRR +  L  Q   Q+   PG++P
Sbjct  418  VVMSGTSILVEFIRWRRRWQASLE-QHQTQMITRPGQFP  455



>ref|XP_008463872.1| PREDICTED: uncharacterized protein LOC103501900 isoform X1 [Cucumis 
melo]
Length=486

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYS+V +QAVLSILL+TF GFG
Sbjct  384  SCVLGLLSSMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSVVGIQAVLSILLATFTGFG  443

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSG+SILVE+ RWRRR +  L  Q   Q+   PG++P
Sbjct  444  VVMSGTSILVEFIRWRRRWQASLE-QHQTQMITRPGQFP  481



>ref|XP_004148772.1| PREDICTED: uncharacterized protein LOC101213858 [Cucumis sativus]
 gb|KGN64734.1| hypothetical protein Csa_1G084330 [Cucumis sativus]
Length=485

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYS+V +QAVLSILL+TF GFG
Sbjct  383  SCVLGLLSSMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSVVGIQAVLSILLATFTGFG  442

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSG+SILVE+ RWRRR +  L  Q   Q+   PG++P
Sbjct  443  VVMSGTSILVEFIRWRRRWQASLE-QHQTQMITRPGQFP  480



>ref|XP_008463882.1| PREDICTED: uncharacterized protein LOC103501900 isoform X2 [Cucumis 
melo]
Length=485

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYS+V +QAVLSILL+TF GFG
Sbjct  383  SCVLGLLSSMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSVVGIQAVLSILLATFTGFG  442

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSG+SILVE+ RWRRR +  L  Q   Q+   PG++P
Sbjct  443  VVMSGTSILVEFIRWRRRWQASLE-QHQTQMITRPGQFP  480



>ref|XP_004166546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231491 
[Cucumis sativus]
Length=485

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRFVWVYAS QFA VVLFAHIFYS+V +QAVLSILL+TF GFG
Sbjct  383  SCVLGLLSSMTSSTMVKRRFVWVYASFQFALVVLFAHIFYSVVGIQAVLSILLATFTGFG  442

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSG+SILVE+ RWRRR +  L  Q   Q+   PG++P
Sbjct  443  VVMSGTSILVEFIRWRRRWQASLE-QHQTQMITRPGQFP  480



>ref|XP_009335079.1| PREDICTED: uncharacterized protein LOC103927843 isoform X3 [Pyrus 
x bretschneideri]
Length=474

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYASVQFA VVLFAHIFYSLV VQAVL ILL+TFAG G
Sbjct  386  SCVLGLLSSMTSSTMVQRRFVWVYASVQFALVVLFAHIFYSLVRVQAVLCILLATFAGLG  445

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  446  VAMSGSSIIVE  456



>gb|KJB56111.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56112.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56113.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56114.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=440

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 17/137 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYAS+QFA VV FAHIFYSLV VQ++LSILL+TF+GFG
Sbjct  316  SCVLGLLSSMTSSTMVQRRFVWVYASIQFALVVFFAHIFYSLVKVQSILSILLATFSGFG  375

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVAL-PPGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSGSSI+VE  RWRRR +    ++   Q    PP + P   N              PQ
Sbjct  376  IAMSGSSIIVEILRWRRRWQAWWQQRHRSQTTTHPPIQSPRAVN-------------SPQ  422

Query  260  HHQT---DIENPETFSG  219
             H++     +N ETF+G
Sbjct  423  THRSPNVSQQNAETFTG  439



>gb|KJB56109.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=510

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 17/137 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYAS+QFA VV FAHIFYSLV VQ++LSILL+TF+GFG
Sbjct  386  SCVLGLLSSMTSSTMVQRRFVWVYASIQFALVVFFAHIFYSLVKVQSILSILLATFSGFG  445

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVAL-PPGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSGSSI+VE  RWRRR +    ++   Q    PP + P   N              PQ
Sbjct  446  IAMSGSSIIVEILRWRRRWQAWWQQRHRSQTTTHPPIQSPRAVN-------------SPQ  492

Query  260  HHQT---DIENPETFSG  219
             H++     +N ETF+G
Sbjct  493  THRSPNVSQQNAETFTG  509



>gb|KJB56105.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=512

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 17/137 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYAS+QFA VV FAHIFYSLV VQ++LSILL+TF+GFG
Sbjct  388  SCVLGLLSSMTSSTMVQRRFVWVYASIQFALVVFFAHIFYSLVKVQSILSILLATFSGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVAL-PPGRWPPQPNQtvtatattTSQVGPQ  261
            +AMSGSSI+VE  RWRRR +    ++   Q    PP + P   N              PQ
Sbjct  448  IAMSGSSIIVEILRWRRRWQAWWQQRHRSQTTTHPPIQSPRAVN-------------SPQ  494

Query  260  HHQT---DIENPETFSG  219
             H++     +N ETF+G
Sbjct  495  THRSPNVSQQNAETFTG  511



>ref|XP_008385400.1| PREDICTED: uncharacterized protein LOC103447955 [Malus domestica]
Length=535

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+RRFVWVYASVQFA VVLFAHIFYS+V VQAVL ILL+TFAG G
Sbjct  447  SCVLGLLSSMTSSTMVQRRFVWVYASVQFALVVLFAHIFYSMVRVQAVLCILLATFAGLG  506

Query  437  VAMSGSSILVEYF  399
            VAMSGSSI++E+ 
Sbjct  507  VAMSGSSIIIEFL  519



>ref|XP_004499420.1| PREDICTED: uncharacterized protein LOC101491453 [Cicer arietinum]
Length=500

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV+ RF+W+YAS QFA VVLFAHIFYSLVH+QAVLS+LL+TFAGFG
Sbjct  375  SCVLGLLSSMTSSTMVQSRFIWIYASFQFAMVVLFAHIFYSLVHLQAVLSVLLATFAGFG  434

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWP  321
            V MSGS I VE+FRWRRR + L  +Q   Q+    G+ P
Sbjct  435  VVMSGSYIPVEFFRWRRRWQALQEQQHGAQLMTQAGQQP  473



>ref|XP_007016720.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY34339.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
Length=437

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV RRFVWVYAS+QFA VV FAHIFYSLV VQA+LSILL+TF+GFG
Sbjct  318  SCVLGLLSSMTSSTMVNRRFVWVYASIQFALVVFFAHIFYSLVKVQAILSILLATFSGFG  377

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  378  VAMSGSSIVVE  388



>ref|XP_002530288.1| protein binding protein, putative [Ricinus communis]
 gb|EEF32095.1| protein binding protein, putative [Ricinus communis]
Length=495

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM SSTMVKRRFVWVYAS QFA VVLFAHIFYSLV++QAVLS+LL+TF+GFG
Sbjct  387  SCVLGLLSSMISSTMVKRRFVWVYASSQFALVVLFAHIFYSLVNLQAVLSVLLATFSGFG  446

Query  437  VAMSGSSILVE  405
            VAMSGSSILVE
Sbjct  447  VAMSGSSILVE  457



>ref|XP_007016718.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY34337.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=508

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV RRFVWVYAS+QFA VV FAHIFYSLV VQA+LSILL+TF+GFG
Sbjct  389  SCVLGLLSSMTSSTMVNRRFVWVYASIQFALVVFFAHIFYSLVKVQAILSILLATFSGFG  448

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  449  VAMSGSSIVVE  459



>ref|XP_007016719.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY34338.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=514

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMV RRFVWVYAS+QFA VV FAHIFYSLV VQA+LSILL+TF+GFG
Sbjct  395  SCVLGLLSSMTSSTMVNRRFVWVYASIQFALVVFFAHIFYSLVKVQAILSILLATFSGFG  454

Query  437  VAMSGSSILVE  405
            VAMSGSSI+VE
Sbjct  455  VAMSGSSIVVE  465



>ref|XP_010253650.1| PREDICTED: uncharacterized protein LOC104594842 isoform X1 [Nelumbo 
nucifera]
Length=511

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTSSTMV RRFVW+YAS+QFA VV FAH+FY+L+HVQAVLSILLS F GFG
Sbjct  386  SCILGLLSSMTSSTMVMRRFVWIYASIQFALVVFFAHLFYTLLHVQAVLSILLSAFVGFG  445

Query  437  VAMSGSSILVEYF  399
            VAMSGSSI VE+ 
Sbjct  446  VAMSGSSIFVEFL  458



>ref|XP_008359119.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103422843 
[Malus domestica]
Length=476

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV VQAVL ILL+TFAG G
Sbjct  384  SCVLGLLSSVTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVXVQAVLCILLATFAGLG  443

Query  437  VAMSGSSILVEYF  399
            VA+SGSSI+VE+ 
Sbjct  444  VAISGSSIIVEFL  456



>ref|XP_009596996.1| PREDICTED: uncharacterized protein LOC104093001 isoform X3 [Nicotiana 
tomentosiformis]
Length=423

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 95/134 (71%), Gaps = 16/134 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SST+VKRRFVWVYASVQF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  306  SCVLGLLSSLASSTLVKRRFVWVYASVQFVLVVFFAHMFYSLVHVQAVLSILLSTFAGLG  365

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SILVE+ RW+RRR++LL  Q+N Q+           NQ        +S    Q 
Sbjct  366  VAMGGCSILVEFLRWKRRRQILLDMQQNSQL-----------NQ-----TAASSHTDRQQ  409

Query  257  HQTDIENPETFSGS  216
            +Q DIE P TFSGS
Sbjct  410  YQPDIEYPATFSGS  423



>ref|XP_009596995.1| PREDICTED: uncharacterized protein LOC104093001 isoform X2 [Nicotiana 
tomentosiformis]
Length=497

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 95/134 (71%), Gaps = 16/134 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SST+VKRRFVWVYASVQF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  380  SCVLGLLSSLASSTLVKRRFVWVYASVQFVLVVFFAHMFYSLVHVQAVLSILLSTFAGLG  439

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SILVE+ RW+RRR++LL  Q+N Q+           NQ        +S    Q 
Sbjct  440  VAMGGCSILVEFLRWKRRRQILLDMQQNSQL-----------NQ-----TAASSHTDRQQ  483

Query  257  HQTDIENPETFSGS  216
            +Q DIE P TFSGS
Sbjct  484  YQPDIEYPATFSGS  497



>ref|XP_009596994.1| PREDICTED: uncharacterized protein LOC104093001 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 95/134 (71%), Gaps = 16/134 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SST+VKRRFVWVYASVQF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  388  SCVLGLLSSLASSTLVKRRFVWVYASVQFVLVVFFAHMFYSLVHVQAVLSILLSTFAGLG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SILVE+ RW+RRR++LL  Q+N Q+           NQ        +S    Q 
Sbjct  448  VAMGGCSILVEFLRWKRRRQILLDMQQNSQL-----------NQ-----TAASSHTDRQQ  491

Query  257  HQTDIENPETFSGS  216
            +Q DIE P TFSGS
Sbjct  492  YQPDIEYPATFSGS  505



>ref|XP_011044367.1| PREDICTED: uncharacterized protein LOC105139582 isoform X4 [Populus 
euphratica]
Length=516

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S+ SSTMVKRRFVWV+AS+QFA VVLFAHIFYSLV+VQAVL+ILL+T +GFG
Sbjct  392  SCALGLLSSIISSTMVKRRFVWVFASIQFALVVLFAHIFYSLVNVQAVLAILLATLSGFG  451

Query  437  VAMSGSSILVEYF  399
            VAM+GSSILVE+ 
Sbjct  452  VAMTGSSILVEFL  464



>ref|XP_011044368.1| PREDICTED: uncharacterized protein LOC105139582 isoform X5 [Populus 
euphratica]
Length=512

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S+ SSTMVKRRFVWV+AS+QFA VVLFAHIFYSLV+VQAVL+ILL+T +GFG
Sbjct  388  SCALGLLSSIISSTMVKRRFVWVFASIQFALVVLFAHIFYSLVNVQAVLAILLATLSGFG  447

Query  437  VAMSGSSILVEYF  399
            VAM+GSSILVE+ 
Sbjct  448  VAMTGSSILVEFL  460



>ref|XP_006400834.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
 gb|ESQ42287.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
Length=488

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  377  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  436

Query  437  VAMSGSSILVEYF-rwrrrrRVLLHRQENPQVALPPGRWPPQP  312
            V + GSS++VE+    RR R   L +Q N    LP    PPQP
Sbjct  437  VCICGSSVMVEFVRWKRRWRARRLEQQLNRSQTLP----PPQP  475



>ref|XP_006400833.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
 gb|ESQ42286.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
Length=487

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  376  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  435

Query  437  VAMSGSSILVEYF-rwrrrrRVLLHRQENPQVALPPGRWPPQP  312
            V + GSS++VE+    RR R   L +Q N    LP    PPQP
Sbjct  436  VCICGSSVMVEFVRWKRRWRARRLEQQLNRSQTLP----PPQP  474



>ref|XP_011044366.1| PREDICTED: uncharacterized protein LOC105139582 isoform X3 [Populus 
euphratica]
Length=517

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S+ SSTMVKRRFVWV+AS+QFA VVLFAHIFYSLV+VQAVL+ILL+T +GFG
Sbjct  393  SCALGLLSSIISSTMVKRRFVWVFASIQFALVVLFAHIFYSLVNVQAVLAILLATLSGFG  452

Query  437  VAMSGSSILVEYF  399
            VAM+GSSILVE+ 
Sbjct  453  VAMTGSSILVEFL  465



>ref|XP_011044364.1| PREDICTED: uncharacterized protein LOC105139582 isoform X1 [Populus 
euphratica]
Length=521

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S+ SSTMVKRRFVWV+AS+QFA VVLFAHIFYSLV+VQAVL+ILL+T +GFG
Sbjct  397  SCALGLLSSIISSTMVKRRFVWVFASIQFALVVLFAHIFYSLVNVQAVLAILLATLSGFG  456

Query  437  VAMSGSSILVEYF  399
            VAM+GSSILVE+ 
Sbjct  457  VAMTGSSILVEFL  469



>ref|XP_011044365.1| PREDICTED: uncharacterized protein LOC105139582 isoform X2 [Populus 
euphratica]
Length=519

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S+ SSTMVKRRFVWV+AS+QFA VVLFAHIFYSLV+VQAVL+ILL+T +GFG
Sbjct  395  SCALGLLSSIISSTMVKRRFVWVFASIQFALVVLFAHIFYSLVNVQAVLAILLATLSGFG  454

Query  437  VAMSGSSILVEYF  399
            VAM+GSSILVE+ 
Sbjct  455  VAMTGSSILVEFL  467



>ref|XP_009367089.1| PREDICTED: uncharacterized protein LOC103956779 isoform X1 [Pyrus 
x bretschneideri]
Length=474

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV +QAV  ILL+TFAG G
Sbjct  386  SCVLGLLSSVTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRMQAVPCILLATFAGLG  445

Query  437  VAMSGSSILVEYF  399
            VA+SGSSI+VE+ 
Sbjct  446  VALSGSSIIVEFL  458



>ref|XP_009367091.1| PREDICTED: uncharacterized protein LOC103956779 isoform X2 [Pyrus 
x bretschneideri]
Length=472

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TSSTMVKRRFVWVYASVQFA VVLFAHIFYSLV +QAV  ILL+TFAG G
Sbjct  384  SCVLGLLSSVTSSTMVKRRFVWVYASVQFALVVLFAHIFYSLVRMQAVPCILLATFAGLG  443

Query  437  VAMSGSSILVEYF  399
            VA+SGSSI+VE+ 
Sbjct  444  VALSGSSIIVEFL  456



>ref|XP_002519545.1| protein binding protein, putative [Ricinus communis]
 gb|EEF42959.1| protein binding protein, putative [Ricinus communis]
Length=512

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 89/133 (67%), Gaps = 9/133 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC++GLL SMTS+TMV+RR+VWVYA++QF  VVL AH++YSL+H+QAVLS+LL+TF GFG
Sbjct  388  SCIIGLLASMTSTTMVRRRYVWVYATIQFGLVVLSAHLYYSLLHMQAVLSVLLATFTGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V MSGSS++ E FR +RR    ++ Q   Q A        QP+Q  T  A   ++  P H
Sbjct  448  VTMSGSSVIAEIFRCQRRWIAQVNEQHGSQGAT-------QPDQ--TLAAAHQTETNPDH  498

Query  257  HQTDIENPETFSG  219
             Q +    E+  G
Sbjct  499  QQIETGGSESIPG  511



>gb|EYU18838.1| hypothetical protein MIMGU_mgv1a005388mg [Erythranthe guttata]
Length=485

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 3/93 (3%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLG+L S+TS+TMV+RRFVW+YAS+QF  VVL AHIFY LVHVQAV+S+LLSTFAGFG
Sbjct  388  SCVLGILSSVTSATMVRRRFVWLYASIQFGLVVLCAHIFYDLVHVQAVVSVLLSTFAGFG  447

Query  437  VAMSGSSILVEYF---rwrrrrRVLLHRQENPQ  348
            VAM G+SILVE+          R + +R ENP+
Sbjct  448  VAMCGASILVEFLRWRARHGAHRAVSNRVENPE  480



>ref|XP_010535601.1| PREDICTED: uncharacterized protein LOC104810853 [Tarenaya hassleriana]
Length=475

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVWVYASVQFA VVLFAH+FYS+V +QAVLS+LL+TFAGFG
Sbjct  377  SCILGLLASMTASTMVVRRFVWVYASVQFALVVLFAHVFYSMVELQAVLSVLLATFAGFG  436

Query  437  VAMSGSSILVEY  402
            V++ GSS+LVE+
Sbjct  437  VSICGSSVLVEF  448



>gb|EYU34440.1| hypothetical protein MIMGU_mgv1a004524mg [Erythranthe guttata]
Length=522

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 85/129 (66%), Gaps = 13/129 (10%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++ W+YA++QFA VV+FAHIFYSL+HVQAVLS+LL+TFAGFG
Sbjct  399  SCILGLLASMTSTTMVRRKYAWIYATIQFALVVIFAHIFYSLLHVQAVLSVLLATFAGFG  458

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQ-  261
             AM G+SI+ E  +WRR        Q          R   QPN+      +   QV  Q 
Sbjct  459  GAMCGTSIIYEILKWRRTLNAWSTSQ----------RDSAQPNE--ALATSDAGQVDSQV  506

Query  260  HHQTDIENP  234
            HHQ +  NP
Sbjct  507  HHQGETRNP  515



>ref|NP_568923.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_851231.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB08241.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97347.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97349.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=487

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  375  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  434

Query  437  VAMSGSSILVEYF-rwrrrrRVLLHRQENPQVALPPGRWPPQP  312
            V + GSS++VE+    RR R   L +Q N  + L     PPQP
Sbjct  435  VCICGSSVMVEFVRWRRRWRARRLEQQLNHALTL---SQPPQP  474



>ref|XP_002280929.2| PREDICTED: uncharacterized protein LOC100265508 isoform X2 [Vitis 
vinifera]
 emb|CBI32724.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 88/138 (64%), Gaps = 17/138 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+T+V+RR+VWVYAS+QF  VV FAHIFYSL HVQAVLS+LL+TFAGFG
Sbjct  392  SCILGLLASMTSTTLVRRRYVWVYASIQFGLVVFFAHIFYSLFHVQAVLSVLLATFAGFG  451

Query  437  VAMSGSSILVEYFrwrrrrRVLLHR----QENPQVALPPGRWPPQPNQtvtatattTSQV  270
            V M G+S +VE+ +WRRR      +    QE  Q+   PG   P              Q 
Sbjct  452  VTMCGNSFVVEFLKWRRRWLAGSDQQHSSQEVTQMDGSPGTANP-------------PQT  498

Query  269  GPQHHQTDIENPETFSGS  216
            G  HH+T++ N     GS
Sbjct  499  GSPHHETEMGNSGNPRGS  516



>ref|XP_010653565.1| PREDICTED: uncharacterized protein LOC100265508 isoform X1 [Vitis 
vinifera]
 ref|XP_010653566.1| PREDICTED: uncharacterized protein LOC100265508 isoform X1 [Vitis 
vinifera]
Length=532

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 88/138 (64%), Gaps = 17/138 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+T+V+RR+VWVYAS+QF  VV FAHIFYSL HVQAVLS+LL+TFAGFG
Sbjct  408  SCILGLLASMTSTTLVRRRYVWVYASIQFGLVVFFAHIFYSLFHVQAVLSVLLATFAGFG  467

Query  437  VAMSGSSILVEYFrwrrrrRVLLHR----QENPQVALPPGRWPPQPNQtvtatattTSQV  270
            V M G+S +VE+ +WRRR      +    QE  Q+   PG   P              Q 
Sbjct  468  VTMCGNSFVVEFLKWRRRWLAGSDQQHSSQEVTQMDGSPGTANP-------------PQT  514

Query  269  GPQHHQTDIENPETFSGS  216
            G  HH+T++ N     GS
Sbjct  515  GSPHHETEMGNSGNPRGS  532



>gb|KFK27585.1| hypothetical protein AALP_AA8G403000 [Arabis alpina]
Length=483

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 4/104 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  373  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  432

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQ  306
            V + GSS++VE+ RWR+R +     Q+   V       PPQP  
Sbjct  433  VCICGSSVMVEFVRWRQRWQARRLEQQLNHVQT----QPPQPQD  472



>gb|KFK27586.1| hypothetical protein AALP_AA8G403000 [Arabis alpina]
Length=482

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 4/104 (4%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  372  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  431

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQ  306
            V + GSS++VE+ RWR+R +     Q+   V       PPQP  
Sbjct  432  VCICGSSVMVEFVRWRQRWQARRLEQQLNHVQT----QPPQPQD  471



>ref|XP_010443856.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
 ref|XP_010443858.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
 ref|XP_010443859.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
Length=490

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  378  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  437

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  438  VCICGSSVMVEF  449



>ref|XP_009120590.1| PREDICTED: uncharacterized protein LOC103845473 isoform X1 [Brassica 
rapa]
Length=481

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  372  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  431

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  432  VCICGSSVMVEF  443



>ref|XP_009120591.1| PREDICTED: uncharacterized protein LOC103845473 isoform X2 [Brassica 
rapa]
Length=480

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  371  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  430

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  431  VCICGSSVMVEF  442



>ref|XP_010456560.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
 ref|XP_010456567.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
 ref|XP_010456573.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
Length=492

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  380  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  439

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  440  VCICGSSVMVEF  451



>ref|XP_010037957.1| PREDICTED: uncharacterized protein LOC104426553 [Eucalyptus grandis]
 gb|KCW49743.1| hypothetical protein EUGRSUZ_K03240 [Eucalyptus grandis]
Length=514

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 89/134 (66%), Gaps = 9/134 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTSSTMV RRFVWVYA++QF  VVL AH+FYSL+H+QAVLS+LL+TFAGFG
Sbjct  390  SCILGLLASMTSSTMVHRRFVWVYATIQFGLVVLSAHLFYSLLHMQAVLSVLLATFAGFG  449

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            + M G+S LVE  +WR     L  ++ N        R   Q +QT  A     +Q  PQH
Sbjct  450  MTMCGTSFLVEISKWRVWWLALSAQRRN-------ARENSQFDQTPVAVEQNHTQ--PQH  500

Query  257  HQTDIENPETFSGS  216
             +T+  N ET  G+
Sbjct  501  QETEPGNSETSRGN  514



>ref|XP_010483706.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Camelina sativa]
 ref|XP_010483707.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Camelina sativa]
Length=490

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  378  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  437

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  438  VCICGSSVMVEF  449



>ref|XP_010483705.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Camelina sativa]
Length=491

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LLSTFAGFG
Sbjct  379  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFG  438

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  439  VCICGSSVMVEF  450



>emb|CDY31533.1| BnaA10g13380D [Brassica napus]
Length=498

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  389  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  448

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  449  VCICGSSVMVEF  460



>ref|XP_007207622.1| hypothetical protein PRUPE_ppa020301mg [Prunus persica]
 gb|EMJ08821.1| hypothetical protein PRUPE_ppa020301mg [Prunus persica]
Length=504

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R+FVWVYA+ QF  VVL AH+ YSL+H+ AVLS+LL+TF GFG
Sbjct  380  SCILGLLASMTSTTMVRRKFVWVYATTQFTLVVLSAHVLYSLLHMHAVLSVLLATFMGFG  439

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M G+SI+VE FRWR R     +RQ   Q    P + P    Q         +Q  PQ 
Sbjct  440  VTMCGNSIIVEAFRWRERWLFQSNRQRGSQEVTQPNQSPENAQQ---------AQTNPQQ  490

Query  257  HQTDIENPETFSGS  216
             + + +  E   GS
Sbjct  491  LENETQVAEAIHGS  504



>emb|CDY67417.1| BnaC09g53890D, partial [Brassica napus]
Length=511

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  402  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  461

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  462  VCICGSSVMVEF  473



>ref|XP_011468102.1| PREDICTED: uncharacterized protein LOC101308698 [Fragaria vesca 
subsp. vesca]
Length=506

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 86/134 (64%), Gaps = 13/134 (10%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV+R++VWVYA++QF  VVL AH+ YSL+H+QAVLS+LL+TF GFG
Sbjct  386  SCILGLLASMTASTMVRRKYVWVYATIQFFLVVLSAHLLYSLIHMQAVLSVLLATFTGFG  445

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M G+SI++E  RWR R     +++        P     QP Q         ++  PQH
Sbjct  446  VTMCGNSIIIEALRWRERCLSRSNQRHGTAAVTQPN----QPQQ---------TETNPQH  492

Query  257  HQTDIENPETFSGS  216
             + +IE  E   GS
Sbjct  493  LENEIEGAEAVRGS  506



>emb|CDY09194.1| BnaA02g06200D [Brassica napus]
Length=479

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  373  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  432

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  433  VCICGSSVMVEF  444



>ref|XP_009126594.1| PREDICTED: uncharacterized protein LOC103851495 isoform X3 [Brassica 
rapa]
Length=480

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  374  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  433

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  434  VCICGSSVMVEF  445



>ref|XP_009126595.1| PREDICTED: uncharacterized protein LOC103851495 isoform X4 [Brassica 
rapa]
Length=479

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  373  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  432

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  433  VCICGSSVMVEF  444



>gb|KGN46835.1| hypothetical protein Csa_6G140830 [Cucumis sativus]
Length=495

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYA+VQF  VVLF+HIFY++V VQAVL+I+L+T  GFG
Sbjct  372  SCVLGLLSSMTSSTMVKRRFIWVYATVQFGMVVLFSHIFYTVVGVQAVLAIILATLTGFG  431

Query  437  VAMSGSSILVEYF  399
            + MSGSSI+VE+ 
Sbjct  432  IIMSGSSIIVEFL  444



>ref|XP_004145807.1| PREDICTED: uncharacterized protein LOC101210532 [Cucumis sativus]
 ref|XP_004161662.1| PREDICTED: uncharacterized protein LOC101230054 [Cucumis sativus]
Length=493

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYA+VQF  VVLF+HIFY++V VQAVL+I+L+T  GFG
Sbjct  370  SCVLGLLSSMTSSTMVKRRFIWVYATVQFGMVVLFSHIFYTVVGVQAVLAIILATLTGFG  429

Query  437  VAMSGSSILVEYF  399
            + MSGSSI+VE+ 
Sbjct  430  IIMSGSSIIVEFL  442



>ref|XP_009126592.1| PREDICTED: uncharacterized protein LOC103851495 isoform X1 [Brassica 
rapa]
Length=525

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  419  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  478

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  479  VCICGSSVMVEF  490



>ref|XP_009126593.1| PREDICTED: uncharacterized protein LOC103851495 isoform X2 [Brassica 
rapa]
Length=524

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT+STMV RRFVW+YASVQFA VVLFAH+FYS+V +Q VLS+LLSTFAGFG
Sbjct  418  SCILGLLASMTASTMVMRRFVWIYASVQFALVVLFAHVFYSVVELQPVLSVLLSTFAGFG  477

Query  437  VAMSGSSILVEY  402
            V + GSS++VE+
Sbjct  478  VCICGSSVMVEF  489



>gb|KDP29105.1| hypothetical protein JCGZ_16494 [Jatropha curcas]
Length=512

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC++GLL SMTS+TMV+RR+VWVYA+VQF  VVL AH++YSL+H+QAVLS+LL+TF GFG
Sbjct  388  SCIMGLLASMTSTTMVRRRYVWVYATVQFGLVVLSAHLYYSLMHMQAVLSVLLATFTGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVG  267
            V MSGS++L E FR RRR     +     Q A  P + P   NQTVT       +VG
Sbjct  448  VTMSGSTVLGEIFRLRRRWLDRQNEHLGSQSATRPDQLPAAANQTVTNPDRIQFEVG  504



>ref|XP_008463941.1| PREDICTED: uncharacterized protein LOC103501946 isoform X2 [Cucumis 
melo]
Length=493

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYA+VQF  VVLF+HIFY++V VQAVL+I+L+T  GFG
Sbjct  370  SCVLGLLSSMTSSTMVKRRFIWVYATVQFGMVVLFSHIFYTVVGVQAVLAIILATLTGFG  429

Query  437  VAMSGSSILVEYF  399
            + MSGSSI+VE+ 
Sbjct  430  IIMSGSSIIVEFL  442



>ref|XP_008463940.1| PREDICTED: uncharacterized protein LOC103501946 isoform X1 [Cucumis 
melo]
Length=495

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTSSTMVKRRF+WVYA+VQF  VVLF+HIFY++V VQAVL+I+L+T  GFG
Sbjct  372  SCVLGLLSSMTSSTMVKRRFIWVYATVQFGMVVLFSHIFYTVVGVQAVLAIILATLTGFG  431

Query  437  VAMSGSSILVEYF  399
            + MSGSSI+VE+ 
Sbjct  432  IIMSGSSIIVEFL  444



>ref|XP_011094675.1| PREDICTED: uncharacterized protein LOC105174317 isoform X2 [Sesamum 
indicum]
Length=512

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV++R+ W+YA++QFA VVLFAHIFYS++HVQAVLS+LL+TFAGFG
Sbjct  391  SCILGLLASMTSTTMVRKRYAWIYATIQFALVVLFAHIFYSVLHVQAVLSVLLATFAGFG  450

Query  437  VAMSGSSILVE  405
             AM G+SIL E
Sbjct  451  GAMCGTSILFE  461



>ref|XP_011094674.1| PREDICTED: uncharacterized protein LOC105174317 isoform X1 [Sesamum 
indicum]
Length=514

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV++R+ W+YA++QFA VVLFAHIFYS++HVQAVLS+LL+TFAGFG
Sbjct  393  SCILGLLASMTSTTMVRKRYAWIYATIQFALVVLFAHIFYSVLHVQAVLSVLLATFAGFG  452

Query  437  VAMSGSSILVE  405
             AM G+SIL E
Sbjct  453  GAMCGTSILFE  463



>ref|XP_008243925.1| PREDICTED: uncharacterized protein LOC103342122 [Prunus mume]
Length=512

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R+FVWVYA+ QF  VVL AH+ YSL+H+ AVLS+LL+TF GFG
Sbjct  388  SCILGLLASMTSTTMVRRKFVWVYATTQFTLVVLSAHVLYSLLHMHAVLSVLLATFMGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M G+SI+VE FRWR R     +RQ          R   QPNQ  +      +Q  PQ 
Sbjct  448  VTMCGNSIIVEAFRWRERWLFQSNRQRG-------SRGVTQPNQ--SPENAQEAQTNPQQ  498

Query  257  HQTDIENPETFSGS  216
             + + +  E   GS
Sbjct  499  LENETQVAEAIHGS  512



>gb|KJB20262.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=497

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CV+GLL SMTSSTM  RRFVW+YAS+QF  VV+FAHIFYS V VQA+LS+LL+TF+GFG
Sbjct  370  ACVIGLLSSMTSSTMATRRFVWIYASIQFVLVVIFAHIFYSQVKVQAILSVLLATFSGFG  429

Query  437  VAMSGSSILVE  405
            V MSGSSI+VE
Sbjct  430  VTMSGSSIIVE  440



>gb|KJB20267.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=479

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CV+GLL SMTSSTM  RRFVW+YAS+QF  VV+FAHIFYS V VQA+LS+LL+TF+GFG
Sbjct  352  ACVIGLLSSMTSSTMATRRFVWIYASIQFVLVVIFAHIFYSQVKVQAILSVLLATFSGFG  411

Query  437  VAMSGSSILVE  405
            V MSGSSI+VE
Sbjct  412  VTMSGSSIIVE  422



>gb|KJB20266.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=502

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CV+GLL SMTSSTM  RRFVW+YAS+QF  VV+FAHIFYS V VQA+LS+LL+TF+GFG
Sbjct  375  ACVIGLLSSMTSSTMATRRFVWIYASIQFVLVVIFAHIFYSQVKVQAILSVLLATFSGFG  434

Query  437  VAMSGSSILVE  405
            V MSGSSI+VE
Sbjct  435  VTMSGSSIIVE  445



>ref|XP_008387604.1| PREDICTED: uncharacterized protein LOC103450061 [Malus domestica]
Length=283

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 20/129 (16%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTSSTMV+RR+VW YA+ QFA VV+ AH+ YSL+H+QAVL++LL+TF+GFG
Sbjct  147  SCILGLLASMTSSTMVRRRYVWSYATTQFALVVIAAHLLYSLIHMQAVLALLLATFSGFG  206

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRW-PPQPNQtvtatattTSQVGPQ  261
            + M GSSI+VE  RWR                   GRW   Q NQ   +   T     PQ
Sbjct  207  ITMCGSSIIVEALRWR-------------------GRWRSRQSNQQHGSQEVTXPNQSPQ  247

Query  260  HHQTDIENP  234
            + Q    NP
Sbjct  248  NTQQTQTNP  256



>ref|XP_004240679.1| PREDICTED: uncharacterized protein LOC101265737 isoform X1 [Solanum 
lycopersicum]
Length=504

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (70%), Gaps = 15/133 (11%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SSTMVKRRFVWVYAS+QF  VV FAH+FYSLVHVQ VLSILLSTFAG G
Sbjct  386  SCVLGLLSSLASSTMVKRRFVWVYASIQFILVVFFAHMFYSLVHVQVVLSILLSTFAGLG  445

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SIL+E+FRW+RRR+  L + +N Q+           NQT   +  +T     Q 
Sbjct  446  VAMCGCSILIEFFRWKRRRQASLDQHQNSQL-----------NQTEIPSHISTR----QD  490

Query  257  HQTDIENPETFSG  219
            +Q D+ENP T S 
Sbjct  491  YQVDLENPGTVSS  503



>ref|XP_010321949.1| PREDICTED: uncharacterized protein LOC101265737 isoform X2 [Solanum 
lycopersicum]
Length=503

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (70%), Gaps = 15/133 (11%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SSTMVKRRFVWVYAS+QF  VV FAH+FYSLVHVQ VLSILLSTFAG G
Sbjct  385  SCVLGLLSSLASSTMVKRRFVWVYASIQFILVVFFAHMFYSLVHVQVVLSILLSTFAGLG  444

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            VAM G SIL+E+FRW+RRR+  L + +N Q+           NQT   +  +T     Q 
Sbjct  445  VAMCGCSILIEFFRWKRRRQASLDQHQNSQL-----------NQTEIPSHISTR----QD  489

Query  257  HQTDIENPETFSG  219
            +Q D+ENP T S 
Sbjct  490  YQVDLENPGTVSS  502



>ref|XP_010689560.1| PREDICTED: uncharacterized protein LOC104903248 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S+TSSTMV +RF+W+YA +QFA VV+FAH+FY LVH+QA++SILL+TF G+G
Sbjct  378  SCILGLLSSVTSSTMVTQRFIWIYACMQFALVVIFAHVFYLLVHIQAIISILLATFVGYG  437

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQE  357
             +MS SSI+VEYFRWRRR      RQE
Sbjct  438  TSMSVSSIIVEYFRWRRRNTQPRARQE  464



>gb|EPS63112.1| hypothetical protein M569_11674, partial [Genlisea aurea]
Length=447

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+RR+ WVYA+VQFA VV+FA +FYSL+HVQAVLS+LL+TF GFG
Sbjct  372  SCILGLLASMTSTTMVRRRYAWVYAAVQFALVVIFARVFYSLLHVQAVLSVLLATFTGFG  431

Query  437  VAMSGSSILVEY  402
              M GSS+L+E+
Sbjct  432  APMFGSSLLLEF  443



>emb|CDP06734.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+RR+ W+YA++QF  VVLFAH+FYSL+HVQA+LS+LL+TFAGFG
Sbjct  392  SCILGLLASMTSTTMVRRRYAWMYATIQFVLVVLFAHVFYSLLHVQAILSVLLATFAGFG  451

Query  437  VAMSGSSILVE  405
             AM G+SI+ E
Sbjct  452  GAMCGTSIVFE  462



>ref|XP_002864692.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40951.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 77/107 (72%), Gaps = 7/107 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMV-------KRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILL  459
            SC+LGLL SMT+STMV        RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LL
Sbjct  375  SCILGLLASMTASTMVLEYSYAVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLL  434

Query  458  STFAGFGVAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPP  318
            STFAGFGV + GSS++VE+ RWRRR R     Q+  Q   PP    P
Sbjct  435  STFAGFGVCICGSSVMVEFVRWRRRWRARRLEQQLNQAQTPPQPLDP  481



>ref|XP_009342773.1| PREDICTED: uncharacterized protein LOC103934748 [Pyrus x bretschneideri]
Length=520

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+RR+VW+YA+ QFA VV+ AH+ YSL+H+QAVL++LL+TF+GFG
Sbjct  384  SCILGLLASMTSTTMVRRRYVWIYATTQFALVVIAAHLLYSLIHMQAVLALLLATFSGFG  443

Query  437  VAMSGSSILVEYF  399
            + M GSSI+VE  
Sbjct  444  ITMCGSSIIVEAL  456



>ref|XP_006343443.1| PREDICTED: uncharacterized protein LOC102596732 [Solanum tuberosum]
Length=508

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 94/135 (70%), Gaps = 16/135 (12%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ SSTMVKRRFVWVYAS+QF  VV FAH+FYSLVHVQAVLSILLSTFAG G
Sbjct  389  SCVLGLLSSLASSTMVKRRFVWVYASIQFILVVFFAHMFYSLVHVQAVLSILLSTFAGLG  448

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGP-Q  261
            VAM G SIL+E+FRW+RRR+ +L +Q+                 +       +S +   Q
Sbjct  449  VAMCGCSILIEFFRWKRRRQAVLDQQQ---------------QNSQLNQTEISSHISTRQ  493

Query  260  HHQTDIENPETFSGS  216
             +Q+D+ENP T SGS
Sbjct  494  DYQSDLENPGTVSGS  508



>ref|NP_851232.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001032112.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97348.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97350.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=494

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (71%), Gaps = 11/110 (10%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMV-------KRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILL  459
            SC+LGLL SMT+STMV        RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LL
Sbjct  375  SCILGLLASMTASTMVLEYSYAVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLL  434

Query  458  STFAGFGVAMSGSSILVEYF-rwrrrrRVLLHRQENPQVALPPGRWPPQP  312
            STFAGFGV + GSS++VE+    RR R   L +Q N  + L     PPQP
Sbjct  435  STFAGFGVCICGSSVMVEFVRWRRRWRARRLEQQLNHALTL---SQPPQP  481



>ref|XP_006594143.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Glycine max]
 gb|KHN48304.1| hypothetical protein glysoja_007973 [Glycine soja]
Length=503

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+R  VW+YA+VQF  VVL  H+F+SLVH+QAVL+ILL+TF GFG
Sbjct  379  SCILGLLASMTATTMVRRNHVWIYATVQFCLVVLAGHLFFSLVHMQAVLAILLATFTGFG  438

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPP  333
            V M G+SIL+E  +WR R     ++Q+  Q A+PP
Sbjct  439  VVMCGASILMEILKWRGRSLAQSNQQQGSQEAIPP  473



>ref|XP_006836375.1| hypothetical protein AMTR_s00092p00120720 [Amborella trichopoda]
 gb|ERM99228.1| hypothetical protein AMTR_s00092p00120720 [Amborella trichopoda]
Length=530

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V+A+LS+LLS+F GFG
Sbjct  374  SCVLGLLSSMIASTMVSKSYIWAYASFQFALVILFAHIFYTILKVKAILSVLLSSFTGFG  433

Query  437  VAMSGSSILVEYFr-wrrrrRVLLHRQENPQVALPP  333
            +A+S +S++VEY R   RR   L HRQ +P   +PP
Sbjct  434  IAISTNSLIVEYLRWKARRDSHLRHRQNDPVRQMPP  469



>ref|XP_006282160.1| hypothetical protein CARUB_v10028418mg [Capsella rubella]
 gb|EOA15058.1| hypothetical protein CARUB_v10028418mg [Capsella rubella]
Length=494

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 7/79 (9%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTM-------VKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILL  459
            SC+LGLL SMT+STM       V RRFVW+YASVQFA VVLFAHIFYS+V +Q VLS+LL
Sbjct  375  SCILGLLASMTASTMALEYSYAVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLL  434

Query  458  STFAGFGVAMSGSSILVEY  402
            STFAGFGV + GSS++VE+
Sbjct  435  STFAGFGVCICGSSVMVEF  453



>ref|XP_008369770.1| PREDICTED: uncharacterized protein LOC103433299 [Malus domestica]
Length=492

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 8/126 (6%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL  MTS+TMV+RR+VW+YA++QF  VVL AH+ YSL+H+QAVL++LL+TF+GFG
Sbjct  375  SCILGLLAXMTSTTMVRRRYVWIYATIQFVLVVLAAHLLYSLIHMQAVLALLLATFSGFG  434

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M GSS +VE   WR R R    +Q N Q      +   QPNQ  +   T  +Q  PQ 
Sbjct  435  VTMCGSSFIVEALGWRERWR---SQQSNQQRG---SQEVAQPNQ--SPQNTQHTQTNPQQ  486

Query  257  HQTDIE  240
             +T++E
Sbjct  487  RETELE  492



>ref|XP_008369756.1| PREDICTED: uncharacterized protein LOC103433283 [Malus domestica]
Length=501

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 8/126 (6%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL  MTS+TMV+RR+VW+YA++QF  VVL AH+ YSL+H+QAVL++LL+TF+GFG
Sbjct  384  SCILGLLAXMTSTTMVRRRYVWIYATIQFVLVVLAAHLLYSLIHMQAVLALLLATFSGFG  443

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M GSS +VE   WR R      +Q N Q      +   QPNQ  +   T  +Q  PQ 
Sbjct  444  VTMCGSSFIVEALGWRER---WRSQQSNQQRG---SQEVAQPNQ--SPQNTQHTQTNPQQ  495

Query  257  HQTDIE  240
             +T++E
Sbjct  496  RETELE  501



>ref|XP_006594984.1| PREDICTED: uncharacterized protein LOC100815599 [Glycine max]
Length=473

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CVLGLL S+TSSTMVK RF+W+YASVQF  VV+FAHIFY LV   AVL+ILL+TFAGFG
Sbjct  380  ACVLGLLSSVTSSTMVKSRFIWIYASVQFVLVVIFAHIFYPLVGKHAVLAILLATFAGFG  439

Query  437  VAMSGSSILVE  405
            V MSGSSIL+E
Sbjct  440  VVMSGSSILLE  450



>gb|KHN21522.1| hypothetical protein glysoja_021102 [Glycine soja]
Length=473

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CVLGLL S+TSSTMVK RF+W+YASVQF  VV+FAHIFY LV   AVL+ILL+TFAGFG
Sbjct  380  ACVLGLLSSVTSSTMVKSRFIWIYASVQFVLVVIFAHIFYPLVGKHAVLAILLATFAGFG  439

Query  437  VAMSGSSILVE  405
            V MSGSSIL+E
Sbjct  440  VVMSGSSILLE  450



>ref|XP_009377416.1| PREDICTED: uncharacterized protein LOC103966027 [Pyrus x bretschneideri]
Length=501

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 87/128 (68%), Gaps = 12/128 (9%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTSSTMV+RR+VW+YA++QF  VVL +H+ YSL+H+QAVL++LL+TF+GFG
Sbjct  384  SCILGLLASMTSSTMVRRRYVWIYATIQFVLVVLASHLLYSLIHMQAVLALLLATFSGFG  443

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQE--NPQVALPPGRWPPQPNQtvtatattTSQVGP  264
            V M G+SI+V+    R R R     Q+  + +VA        QPNQ  +   T  +Q  P
Sbjct  444  VTMCGNSIIVKASGLRERWRSQESNQQRGSQEVA--------QPNQ--SPQNTRRTQTDP  493

Query  263  QHHQTDIE  240
            Q  + ++E
Sbjct  494  QQRENELE  501



>ref|XP_010107550.1| hypothetical protein L484_024404 [Morus notabilis]
 gb|EXC16232.1| hypothetical protein L484_024404 [Morus notabilis]
Length=506

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCV+GLL S+T++TMV+R++VW+YASVQFA V L AH+ YSL+H+Q VLS+LL+TF GFG
Sbjct  382  SCVMGLLASITATTMVRRKYVWIYASVQFALVALSAHLLYSLLHMQGVLSVLLATFTGFG  441

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQ  306
            V M G+SILVE  +WRRR    +++    Q    P + P    Q
Sbjct  442  VTMCGNSILVEVLKWRRRCLARVNQTRGSQEGTEPNQPPANLEQ  485



>ref|XP_006592700.1| PREDICTED: uncharacterized protein LOC100782610 [Glycine max]
Length=475

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +C LGLL S+TSSTMVK RF+W+YASVQF  VV+FAHIFY LV   AVL+ILL+TFAGFG
Sbjct  375  ACALGLLSSVTSSTMVKSRFIWIYASVQFVLVVIFAHIFYPLVGKHAVLAILLATFAGFG  434

Query  437  VAMSGSSILVE  405
            V MSGSSIL+E
Sbjct  435  VVMSGSSILLE  445



>gb|KHN11205.1| hypothetical protein glysoja_034434 [Glycine soja]
Length=477

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +C LGLL S+TSSTMVK RF+W+YASVQF  VV+FAHIFY LV   AVL+ILL+TFAGFG
Sbjct  377  ACALGLLSSVTSSTMVKSRFIWIYASVQFVLVVIFAHIFYPLVGKHAVLAILLATFAGFG  436

Query  437  VAMSGSSILVE  405
            V MSGSSIL+E
Sbjct  437  VVMSGSSILLE  447



>gb|KJB16806.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=442

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA++QFA VVL AH+FYSL+HVQAVLS+LLS F GFG
Sbjct  315  SCILGLLASMTSTTMVRRKYVWLYATIQFALVVLSAHLFYSLLHVQAVLSVLLSAFVGFG  374

Query  437  VAMSGSSILVE  405
              M G+SI+ E
Sbjct  375  STMCGTSIIYE  385



>ref|XP_010032003.1| PREDICTED: uncharacterized protein LOC104421669 [Eucalyptus grandis]
 gb|KCW51394.1| hypothetical protein EUGRSUZ_J00933 [Eucalyptus grandis]
Length=514

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTSSTMVK ++VW+YAS QF+ VVLFAH+FY+LV +QA+L++L +TFAGFG
Sbjct  387  SCLLGLLSSMTSSTMVKSQYVWIYASFQFSMVVLFAHMFYTLVRLQAILAVLFATFAGFG  446

Query  437  VAMSGSSILVEYF  399
            +AMS SSI+VE+ 
Sbjct  447  IAMSVSSIIVEFL  459



>gb|KJB16801.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
 gb|KJB16802.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=514

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA++QFA VVL AH+FYSL+HVQAVLS+LLS F GFG
Sbjct  387  SCILGLLASMTSTTMVRRKYVWLYATIQFALVVLSAHLFYSLLHVQAVLSVLLSAFVGFG  446

Query  437  VAMSGSSILVE  405
              M G+SI+ E
Sbjct  447  STMCGTSIIYE  457



>gb|KHG08412.1| putative E3 ubiquitin-protein ligase MARCH10 [Gossypium arboreum]
Length=518

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA++QFA VVL AH+FYSL+HVQAVLS+LLS F GFG
Sbjct  391  SCILGLLASMTSTTMVRRKYVWLYATIQFALVVLSAHLFYSLLHVQAVLSVLLSAFVGFG  450

Query  437  VAMSGSSILVE  405
              M G+SI+ E
Sbjct  451  STMCGTSIIYE  461



>ref|XP_010684110.1| PREDICTED: uncharacterized protein LOC104898704 [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV R+F+WVYA+ QF FVVLFAHI YSL+H+QAV+S++++TF GFG
Sbjct  373  SCILGLLASMTSTTMVGRKFLWVYAAAQFTFVVLFAHISYSLLHLQAVVSVIIATFVGFG  432

Query  437  VAMSGSSILVE  405
            VAM G SIL E
Sbjct  433  VAMCGCSILYE  443



>ref|XP_007027302.1| Binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY07804.1| Binding protein, putative isoform 1 [Theobroma cacao]
Length=523

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA+VQF  VVL AH+FYSL+H+QAVLS+LLS F GFG
Sbjct  399  SCILGLLASMTSTTMVRRKYVWIYATVQFGLVVLSAHLFYSLLHIQAVLSVLLSAFVGFG  458

Query  437  VAMSGSSILVE  405
              M G+SIL E
Sbjct  459  GTMCGTSILYE  469



>ref|XP_007027304.1| Binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY07806.1| Binding protein, putative isoform 3 [Theobroma cacao]
Length=496

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA+VQF  VVL AH+FYSL+H+QAVLS+LLS F GFG
Sbjct  372  SCILGLLASMTSTTMVRRKYVWIYATVQFGLVVLSAHLFYSLLHIQAVLSVLLSAFVGFG  431

Query  437  VAMSGSSILVE  405
              M G+SIL E
Sbjct  432  GTMCGTSILYE  442



>ref|XP_006854502.1| hypothetical protein AMTR_s00175p00053490 [Amborella trichopoda]
 gb|ERN15969.1| hypothetical protein AMTR_s00175p00053490 [Amborella trichopoda]
Length=490

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT+S+MV+++++W+YAS QFA VV+FAH+FYSL+HVQ VLS+LLS F GFG
Sbjct  371  SCVLGLLASMTTSSMVRKKYIWIYASAQFALVVIFAHLFYSLLHVQVVLSVLLSAFGGFG  430

Query  437  VAMSGSSILVEYF  399
            V M+ +S+L E+ 
Sbjct  431  VTMTANSLLHEFL  443



>ref|XP_004487122.1| PREDICTED: uncharacterized protein LOC101488558 isoform X2 [Cicer 
arietinum]
Length=534

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL+ SMTS+TMV+ +F+W+YAS QFA VVLFAHIFY LV  QAVL+ILL++FAGFG
Sbjct  408  SCVLGLVSSMTSTTMVRSKFIWIYASAQFALVVLFAHIFYPLVGKQAVLAILLASFAGFG  467

Query  437  VAMSGSSILVE  405
            V MSG+S+L E
Sbjct  468  VMMSGTSVLAE  478



>ref|XP_007145227.1| hypothetical protein PHAVU_007G221300g [Phaseolus vulgaris]
 gb|ESW17221.1| hypothetical protein PHAVU_007G221300g [Phaseolus vulgaris]
Length=510

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 88/130 (68%), Gaps = 10/130 (8%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+R  VWVYA+VQF  VVL  H+F+SLVH+QAVL+ILL+T  GFG
Sbjct  388  SCILGLLASMTATTMVRRNHVWVYATVQFCLVVLAGHLFFSLVHMQAVLAILLATLTGFG  447

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQH  258
            V M G+S+L+E  +WRRR      +Q+  Q  +PP +     +Q         +Q+G + 
Sbjct  448  VVMCGTSVLMEILKWRRRSLAQSDQQQVSQETVPPDQSSRVAHQ---------TQIGSEQ  498

Query  257  HQTDI-ENPE  231
             ++++ E+PE
Sbjct  499  SESNLGESPE  508



>ref|XP_010246421.1| PREDICTED: uncharacterized protein LOC104589712 isoform X1 [Nelumbo 
nucifera]
Length=497

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 85/134 (63%), Gaps = 18/134 (13%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL +M +STMV + F+W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  373  SCVLGLLSAMIASTMVSKSFIWAYASFQFAIVILFAHIFYNILNVNAILSVLLSSFTGFG  432

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGP--  264
            +A+S +S+LVEY RW+  R +    Q+N +     G W   P +         S VGP  
Sbjct  433  IAISTNSLLVEYLRWKASRELRSAHQQNNR-----GGWQRSPAR-------EHSNVGPTD  480

Query  263  ----QHHQTDIENP  234
                Q  +T+  NP
Sbjct  481  GTRQQDSRTENTNP  494



>ref|XP_003580994.1| PREDICTED: uncharacterized protein LOC100836924 [Brachypodium 
distachyon]
Length=488

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  LSCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGF  441
             SC+LGL  S+T+++MV R++VW+YA+ QF FVV F H+FY  +H+QAV+SI+L+TFAGF
Sbjct  355  FSCILGLFSSLTTTSMVARKYVWIYAAAQFLFVVFFTHLFYRYLHLQAVISIILATFAGF  414

Query  440  GVAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGPQ  261
            GV M G+SI+VE  RWR    + + R   P+V +   +    P     +  ++ S  G  
Sbjct  415  GVGMIGNSIIVEILRWRAMPPIQVRRARRPRVGVAQQQHQQAPASGQPSGQSSASVEGQH  474

Query  260  HHQTDIENP  234
            +  +DIENP
Sbjct  475  NAGSDIENP  483



>ref|XP_004246665.1| PREDICTED: uncharacterized protein LOC101249200 [Solanum lycopersicum]
Length=515

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+RR+ WVYA  QFA VVLFAH+FYSL+ VQAVL++LL+TFAGFG
Sbjct  391  SCILGLLASMTATTMVQRRYAWVYAVSQFALVVLFAHVFYSLLRVQAVLAVLLATFAGFG  450

Query  437  VAMSGSSILVE  405
              M G+S L+E
Sbjct  451  GVMCGTSFLLE  461



>ref|XP_006361814.1| PREDICTED: uncharacterized protein LOC102593861 [Solanum tuberosum]
Length=516

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+RR+ WVYA  QFA VVLFAH+FYSL+ VQAVL++LL+TFAGFG
Sbjct  392  SCILGLLASMTATTMVQRRYAWVYAVSQFALVVLFAHVFYSLLRVQAVLAVLLATFAGFG  451

Query  437  VAMSGSSILVE  405
              M G+S L+E
Sbjct  452  GVMCGTSFLLE  462



>gb|EAY92758.1| hypothetical protein OsI_14560 [Oryza sativa Indica Group]
Length=459

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  338  SCILGLFSSLTTTSMVARRYVWIYATIQFLFVVFFTHLFYRFLHLQAVISIILATFAGFG  397

Query  437  VAMSGSSILVE  405
            V M+G+SI+VE
Sbjct  398  VGMTGNSIIVE  408



>ref|XP_007150211.1| hypothetical protein PHAVU_005G135900g [Phaseolus vulgaris]
 gb|ESW22205.1| hypothetical protein PHAVU_005G135900g [Phaseolus vulgaris]
Length=459

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+TS+TMV  +F+W+YASVQF  VV+FAHIFY LV   AVLSILL+TFAGFG
Sbjct  369  SCVLGLLSSVTSTTMVTSKFIWLYASVQFLSVVIFAHIFYPLVGKHAVLSILLATFAGFG  428

Query  437  VAMSGSSILVEY  402
            V MSGSSI++E+
Sbjct  429  VVMSGSSIVLEF  440



>ref|XP_010558263.1| PREDICTED: uncharacterized protein LOC104826973 [Tarenaya hassleriana]
Length=513

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LG+L SMTS+TMV +++VWVYA+ QF  VV+FAH+FYSLVH+Q VLSILL+T  GFG
Sbjct  386  SCILGILASMTSTTMVTKKYVWVYATAQFCLVVIFAHLFYSLVHIQPVLSILLATLVGFG  445

Query  437  VAMSGSSILVE  405
            + M+ +++L+E
Sbjct  446  ITMTSTTVLIE  456



>ref|NP_001052006.1| Os04g0105100 [Oryza sativa Japonica Group]
 emb|CAE04603.1| OSJNBb0004G23.1 [Oryza sativa Japonica Group]
 emb|CAD39346.2| OSJNBa0094O15.15 [Oryza sativa Japonica Group]
 dbj|BAF13920.1| Os04g0105100 [Oryza sativa Japonica Group]
 gb|EAZ29434.1| hypothetical protein OsJ_13508 [Oryza sativa Japonica Group]
 dbj|BAG92287.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=459

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  338  SCILGLFSSLTTTSMVARRYVWIYATIQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  397

Query  437  VAMSGSSILVE  405
            V M+G+SI+VE
Sbjct  398  VGMTGNSIIVE  408



>ref|XP_004974977.1| PREDICTED: uncharacterized protein LOC101774528 isoform X2 [Setaria 
italica]
Length=476

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA+VQF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  345  SCILGLFSSLTTTSMVARRYVWIYAAVQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  404

Query  437  VAMSGSSILVE  405
            V M+G+SI+VE
Sbjct  405  VGMTGNSIIVE  415



>ref|XP_006653096.1| PREDICTED: uncharacterized protein LOC102716494 [Oryza brachyantha]
Length=474

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  342  SCILGLFSSLTTTSMVARRYVWIYATIQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  401

Query  437  VAMSGSSILVE  405
            V M+G+SI+VE
Sbjct  402  VGMTGNSIIVE  412



>ref|XP_010036055.1| PREDICTED: probable E3 ubiquitin-protein ligase MARCH10 [Eucalyptus 
grandis]
 gb|KCW47580.1| hypothetical protein EUGRSUZ_K01329 [Eucalyptus grandis]
Length=535

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY+++ V A+LS+LLS+F GFG
Sbjct  376  SCVLGLLSSMIASTMVSRGYIWAYASFQFAIVILFAHIFYNVLSVNAILSVLLSSFTGFG  435

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  436  IAISTNSLLVEYL  448



>ref|XP_004974976.1| PREDICTED: uncharacterized protein LOC101774528 isoform X1 [Setaria 
italica]
Length=487

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA+VQF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  356  SCILGLFSSLTTTSMVARRYVWIYAAVQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  415

Query  437  VAMSGSSILVE  405
            V M+G+SI+VE
Sbjct  416  VGMTGNSIIVE  426



>gb|EPS59449.1| hypothetical protein M569_15357, partial [Genlisea aurea]
Length=419

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCV+GL+ S+TSS MVKR  VW+YAS+QF FVVLFAH+FYS+VH+  +LSI+L+  +G G
Sbjct  330  SCVIGLVASLTSSIMVKRNLVWIYASIQFGFVVLFAHVFYSVVHMCEILSIVLAVISGSG  389

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQ  348
            +AMS SSI VE+ RW  RR    +R E PQ
Sbjct  390  LAMSLSSIFVEFRRWTMRRNADGNRDERPQ  419



>ref|XP_011040643.1| PREDICTED: uncharacterized protein LOC105136849 [Populus euphratica]
Length=494

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  355  SCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYTMLNVNPILSVLLSSFTGFG  414

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  415  IAISTNSLLVEYL  427



>ref|XP_011004480.1| PREDICTED: uncharacterized protein LOC105110961 [Populus euphratica]
Length=494

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  355  SCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYTMLNVNPILSVLLSSFTGFG  414

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  415  IAISTNSLLVEYL  427



>ref|XP_006381467.1| hypothetical protein POPTR_0006s13100g [Populus trichocarpa]
 gb|ERP59264.1| hypothetical protein POPTR_0006s13100g [Populus trichocarpa]
Length=504

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+RR+VWVYA++QF  VVL AH+ YSL+H+QAVL +LL+TF GFG
Sbjct  391  SCILGLLASMTSTTMVRRRYVWVYATIQFGLVVLPAHLLYSLLHIQAVLCVLLATFTGFG  450

Query  437  VAMSGSSILVE  405
              M G  ++VE
Sbjct  451  ATMFGKYVIVE  461



>gb|EYU24309.1| hypothetical protein MIMGU_mgv1a022401mg, partial [Erythranthe 
guttata]
Length=466

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  313  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYAVLNVNAILSVLLSSFTGFG  372

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  373  IAISTNSLLVEYL  385



>ref|XP_008229749.1| PREDICTED: uncharacterized protein LOC103329100 [Prunus mume]
Length=544

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY+L++V  +LS+LLS+F GFG
Sbjct  377  SCVLGLLSSMIASTMVSRSYIWAYASFQFAIVILFAHIFYTLLNVNPILSVLLSSFTGFG  436

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  437  IAISTNSLLVEYL  449



>gb|EMT19748.1| hypothetical protein F775_12706 [Aegilops tauschii]
Length=456

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  326  SCILGLFSSLTTTSMVARRYVWIYAAIQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  385

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQEN-PQVALPPGRWPPQPNQtvtatattTSQVGPQ  261
            V M G+SI++E  RWR        R    P+VA    +  P P     +   +    G +
Sbjct  386  VGMIGNSIIIEVLRWRTMAPAQPRRAHRPPRVAQ---QQQPAPASGQPSGQPSAVGEGQR  442

Query  260  HHQTDIENP  234
                DIENP
Sbjct  443  SATVDIENP  451



>gb|EYU36437.1| hypothetical protein MIMGU_mgv1a005750mg [Erythranthe guttata]
Length=472

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  319  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYAVLNVNAILSVLLSSFTGFG  378

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  379  IAISTNSLLVEYL  391



>ref|XP_006407641.1| hypothetical protein EUTSA_v10020625mg [Eutrema salsugineum]
 gb|ESQ49094.1| hypothetical protein EUTSA_v10020625mg [Eutrema salsugineum]
Length=480

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+++VW+YA+VQF  VV+FAH F+SLV +Q V+SILL+T  GFG
Sbjct  375  SCVLGLLASMTSTTMVKKQYVWIYATVQFGLVVVFAHFFFSLVRMQPVVSILLATLVGFG  434

Query  437  VAMSGSSILVEY  402
            + MSG++ LVE+
Sbjct  435  LTMSGTTGLVEF  446



>ref|XP_009769900.1| PREDICTED: uncharacterized protein LOC104220688 isoform X1 [Nicotiana 
sylvestris]
Length=513

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV RR+ W+YA  QFA VVLFAH+FYS++ VQAVLSILL+TFAGFG
Sbjct  393  SCILGLLASMTSTTMVIRRYAWIYAVSQFALVVLFAHVFYSVLRVQAVLSILLATFAGFG  452

Query  437  VAMSGSSI  414
              M G+SI
Sbjct  453  GTMCGTSI  460



>ref|XP_002522590.1| protein binding protein, putative [Ricinus communis]
 gb|EEF39791.1| protein binding protein, putative [Ricinus communis]
Length=522

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W Y+S QFA V+LFAHIFYS++ V  VLS+LLS+F GFG
Sbjct  386  SCVLGLLSSMIASTMVSRSYIWAYSSFQFAVVILFAHIFYSVLSVNPVLSVLLSSFTGFG  445

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEYF
Sbjct  446  IAISTNSLLVEYF  458



>ref|XP_010657095.1| PREDICTED: uncharacterized protein LOC100243829 isoform X2 [Vitis 
vinifera]
Length=430

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  284  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYTILNVNPILSVLLSSFTGFG  343

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQEN  354
            +A+S +S+LVEY RWR  R+V    Q N
Sbjct  344  IAISTNSLLVEYLRWRASRQVRSSDQNN  371



>ref|XP_007215527.1| hypothetical protein PRUPE_ppa003767mg [Prunus persica]
 gb|EMJ16726.1| hypothetical protein PRUPE_ppa003767mg [Prunus persica]
Length=550

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY+L++V  +LS+LLS+F GFG
Sbjct  377  SCVLGLLSSMIASTMVSRSYIWAYASFQFAIVILFAHIFYTLLNVNPILSVLLSSFTGFG  436

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  437  IAISTNSLLVEYL  449



>ref|XP_010486549.1| PREDICTED: uncharacterized protein LOC104764671 isoform X2 [Camelina 
sativa]
Length=494

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+R+VW+YA+ QF  VVLF+HIF++LV +Q V++ILL+T  GFG
Sbjct  388  SCVLGLLASMTSTTMVKKRYVWIYATTQFGLVVLFSHIFFTLVRMQPVVAILLATLVGFG  447

Query  437  VAMSGSSILVEYF  399
            V MS ++ LVE++
Sbjct  448  VTMSATTGLVEFW  460



>gb|AES67476.2| RING/U-box protein [Medicago truncatula]
Length=498

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL+ +MTS+TMV+ +F+W+YAS QF  VVLFAH+FY LV  QAVL+ILL++FAGFG
Sbjct  371  SCVLGLVSAMTSTTMVRSKFIWLYASAQFLLVVLFAHVFYPLVGKQAVLAILLASFAGFG  430

Query  437  VAMSGSSILVE  405
            V MSGSS++ E
Sbjct  431  VMMSGSSVIAE  441



>ref|XP_010486548.1| PREDICTED: uncharacterized protein LOC104764671 isoform X1 [Camelina 
sativa]
Length=495

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+R+VW+YA+ QF  VVLF+HIF++LV +Q V++ILL+T  GFG
Sbjct  389  SCVLGLLASMTSTTMVKKRYVWIYATTQFGLVVLFSHIFFTLVRMQPVVAILLATLVGFG  448

Query  437  VAMSGSSILVEYF  399
            V MS ++ LVE++
Sbjct  449  VTMSATTGLVEFW  461



>ref|XP_003597225.1| Protein binding protein [Medicago truncatula]
Length=500

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL+ +MTS+TMV+ +F+W+YAS QF  VVLFAH+FY LV  QAVL+ILL++FAGFG
Sbjct  373  SCVLGLVSAMTSTTMVRSKFIWLYASAQFLLVVLFAHVFYPLVGKQAVLAILLASFAGFG  432

Query  437  VAMSGSSILVE  405
            V MSGSS++ E
Sbjct  433  VMMSGSSVIAE  443



>gb|EMS60352.1| hypothetical protein TRIUR3_08999 [Triticum urartu]
Length=493

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (64%), Gaps = 8/130 (6%)
 Frame = -3

Query  620  LSCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGF  441
             SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGF
Sbjct  366  FSCILGLFSSLTTTSMVARRYVWIYAAIQFLFVVFFTHLFYRYLHLQAVISIILATFAGF  425

Query  440  GVAMSGSSILVEYFrwrrrrRV-LLHRQENPQVALPPGRWPPQPNQtvtatattTSQVGP  264
            GV M G+SI++E  RWR        H +  P+VA        Q      ++  + ++ G 
Sbjct  426  GVGMIGNSIIIEVLRWRTMAPAHQRHARRPPRVAQ-------QQQPAPASSQPSAAEEGQ  478

Query  263  QHHQTDIENP  234
            +    D+ENP
Sbjct  479  RSATVDVENP  488



>ref|XP_011074285.1| PREDICTED: uncharacterized protein LOC105159050 [Sesamum indicum]
Length=521

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  370  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYAVLNVNAILSVLLSSFTGFG  429

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  430  IAISTNSLLVEYL  442



>ref|XP_011048564.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Populus euphratica]
Length=501

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+RR+VWVYA++QF  VVL AH+ YSL+H+QAVL +LL+TF GFG
Sbjct  388  SCILGLLASMTSTTMVRRRYVWVYATIQFGLVVLPAHLLYSLLHLQAVLCVLLATFTGFG  447

Query  437  VAMSGSSILVE  405
              M G+ ++VE
Sbjct  448  ATMFGNYVIVE  458



>ref|XP_009146905.1| PREDICTED: uncharacterized protein LOC103870523 [Brassica rapa]
Length=457

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV++++VWVY +VQF F+V F+HIF+ LVH+Q V+SI+L+T  GFG
Sbjct  354  SCILGLLASMTSTTMVEKQYVWVYGTVQFGFIVCFSHIFFELVHMQPVVSIVLATLVGFG  413

Query  437  VAMSGSSILVEYF  399
            + MSG++ LVE+ 
Sbjct  414  LTMSGTTGLVEFL  426



>ref|XP_009377929.1| PREDICTED: uncharacterized protein LOC103966489 [Pyrus x bretschneideri]
Length=369

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY++++V  VLS+LLS+F GFG
Sbjct  190  SCVLGLLSSMIASTMVSRSYIWAYASFQFAIVILFAHIFYTVLNVNPVLSVLLSSFTGFG  249

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  250  IAISTNSLLVEYL  262



>ref|XP_010112883.1| putative E3 ubiquitin-protein ligase MARCH10 [Morus notabilis]
 gb|EXC35018.1| putative E3 ubiquitin-protein ligase MARCH10 [Morus notabilis]
Length=497

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLG+L SM +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  350  SCVLGILSSMIASTMVSRSYIWAYASFQFAIVILFAHIFYTILNVNPILSVLLSSFTGFG  409

Query  437  VAMSGSSILVEYF  399
            +A+S +++LVEY 
Sbjct  410  IAISTNTLLVEYL  422



>ref|XP_003633259.1| PREDICTED: uncharacterized protein LOC100243829 isoform X1 [Vitis 
vinifera]
Length=522

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  376  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYTILNVNPILSVLLSSFTGFG  435

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQEN  354
            +A+S +S+LVEY RWR  R+V    Q N
Sbjct  436  IAISTNSLLVEYLRWRASRQVRSSDQNN  463



>emb|CBI22058.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  375  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYTILNVNPILSVLLSSFTGFG  434

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQEN  354
            +A+S +S+LVEY RWR  R+V    Q N
Sbjct  435  IAISTNSLLVEYLRWRASRQVRSSDQNN  462



>ref|XP_009591165.1| PREDICTED: uncharacterized protein LOC104088228 [Nicotiana tomentosiformis]
 ref|XP_009591166.1| PREDICTED: uncharacterized protein LOC104088228 [Nicotiana tomentosiformis]
 ref|XP_009591167.1| PREDICTED: uncharacterized protein LOC104088228 [Nicotiana tomentosiformis]
Length=518

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  372  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYAVLNVSAILSVLLSSFTGFG  431

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  432  IAISTNSLLVEYL  444



>emb|CDY41589.1| BnaC05g43260D [Brassica napus]
Length=455

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV++++VW+Y +VQF F+V F+HIF+ LVH+Q V+SI+L+T  GFG
Sbjct  352  SCILGLLASMTSTTMVEKQYVWIYGTVQFGFIVCFSHIFFELVHMQPVVSIVLATLVGFG  411

Query  437  VAMSGSSILVEYF  399
            + MSG++ LVE+ 
Sbjct  412  LTMSGTTGLVEFL  424



>ref|XP_009630868.1| PREDICTED: uncharacterized protein LOC104120747 isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV RR+ W+YA +QF  VVLFAH+FYS++ VQAVLSILL+TFAGFG
Sbjct  393  SCILGLLASMTSTTMVIRRYAWIYAVIQFGLVVLFAHVFYSVLRVQAVLSILLATFAGFG  452

Query  437  VAMSGSSI  414
              M G+S+
Sbjct  453  GTMCGTSV  460



>ref|XP_010920401.1| PREDICTED: uncharacterized protein LOC105044280 [Elaeis guineensis]
Length=497

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+TSSTMV +R++WVYA+VQF  VV FAH+FYS  H+Q V+SI+L+TFAGFG
Sbjct  374  SCILGLFASLTSSTMVMKRYIWVYAAVQFLLVVFFAHLFYSYFHMQTVISIILATFAGFG  433

Query  437  VAMSGSSILVE  405
            VAMS SS++VE
Sbjct  434  VAMSVSSLVVE  444



>ref|XP_002323191.2| hypothetical protein POPTR_0016s02320g [Populus trichocarpa]
 gb|EEF04952.2| hypothetical protein POPTR_0016s02320g [Populus trichocarpa]
Length=494

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM ++TMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  355  SCVLGLLSSMIATTMVNRSYIWAYASFQFAVVILFAHIFYTVLNVNPILSVLLSSFTGFG  414

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  415  IAISTNSLLVEYL  427



>emb|CDY41588.1| BnaC05g43250D [Brassica napus]
Length=483

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCV GLL SMTS+TMVK+++VW+Y ++QF  VV F+HIF+SLVH+Q VLSILL+T  GFG
Sbjct  383  SCVFGLLASMTSTTMVKKQYVWIYGTIQFGLVVFFSHIFFSLVHMQPVLSILLATVVGFG  442

Query  437  VAMSGSSILVEY  402
            + MSG++ +VE+
Sbjct  443  LTMSGATGIVEF  454



>ref|XP_004502083.1| PREDICTED: uncharacterized protein LOC101489964 [Cicer arietinum]
Length=475

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SM +STMV R ++W YA  QFAFV+LFAH+FYS+++V A+ S+LLSTF GFG
Sbjct  363  SCILGLLSSMIASTMVSRSYIWAYACFQFAFVILFAHVFYSILNVNAIFSVLLSTFTGFG  422

Query  437  VAMSGSSILVEYF  399
            +++S +S+L+EY 
Sbjct  423  ISISMNSLLMEYI  435



>ref|XP_011008532.1| PREDICTED: uncharacterized protein LOC105113880 [Populus euphratica]
 ref|XP_011010103.1| PREDICTED: uncharacterized protein LOC105115035 [Populus euphratica]
Length=494

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM ++TMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  355  SCVLGLLSSMIATTMVSRSYIWAYASFQFAVVILFAHIFYTVLNVNPILSVLLSSFTGFG  414

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  415  IAISTNSLLVEYL  427



>dbj|BAJ93226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA++QF FVV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  382  SCILGLFSSLTTTSMVARRYVWIYAAIQFLFVVFFTHLFYRYLHLQAVISIILATFAGFG  441

Query  437  VAMSGSSILVE  405
            V M G+SI++E
Sbjct  442  VGMIGNSIIIE  452



>gb|EEE66215.1| hypothetical protein OsJ_22354 [Oryza sativa Japonica Group]
Length=791

 Score =   103 bits (258),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  620  LSCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGF  441
             SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GF
Sbjct  363  FSCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGF  422

Query  440  GVAMSGSSILVEYF  399
            G+A+S +S+LVEY 
Sbjct  423  GIAISANSMLVEYL  436



>ref|XP_004966202.1| PREDICTED: uncharacterized protein LOC101763665 [Setaria italica]
Length=483

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V AVL++LLS+F GFG
Sbjct  363  SCVLGLLSSMIASTMVSKSYLWAYASFQFAIVILFAHIFYNVLRVNAVLAVLLSSFTGFG  422

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  423  IAISTNSLLVEYM  435



>ref|XP_010464632.1| PREDICTED: uncharacterized protein LOC104745150 [Camelina sativa]
Length=497

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+R+VW+YA+ QF  VVLF+HIF++LV +Q V++ILL+T  GFG
Sbjct  391  SCVLGLLASMTSTTMVKKRYVWIYATTQFGLVVLFSHIFFTLVRMQPVVAILLATLVGFG  450

Query  437  VAMSGSSILVEYF  399
            + MS ++ LVE++
Sbjct  451  LTMSATTGLVEFW  463



>ref|XP_010476472.1| PREDICTED: uncharacterized protein LOC104755692 isoform X1 [Camelina 
sativa]
Length=496

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+R+VW+YA+ QF  VVLF+HIF++LV +Q V++ILL+T  GFG
Sbjct  390  SCVLGLLASMTSTTMVKKRYVWIYATTQFGLVVLFSHIFFTLVRMQPVVAILLATLVGFG  449

Query  437  VAMSGSSILVEYF  399
            + MS ++ LVE++
Sbjct  450  LTMSATTGLVEFW  462



>ref|XP_010476546.1| PREDICTED: uncharacterized protein LOC104755692 isoform X2 [Camelina 
sativa]
Length=495

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+R+VW+YA+ QF  VVLF+HIF++LV +Q V++ILL+T  GFG
Sbjct  389  SCVLGLLASMTSTTMVKKRYVWIYATTQFGLVVLFSHIFFTLVRMQPVVAILLATLVGFG  448

Query  437  VAMSGSSILVEYF  399
            + MS ++ LVE++
Sbjct  449  LTMSATTGLVEFW  461



>ref|XP_004487121.1| PREDICTED: uncharacterized protein LOC101488558 isoform X1 [Cicer 
arietinum]
Length=539

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 5/76 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSL-----VHVQAVLSILLST  453
            SCVLGL+ SMTS+TMV+ +F+W+YAS QFA VVLFAHIFY L     V  QAVL+ILL++
Sbjct  408  SCVLGLVSSMTSTTMVRSKFIWIYASAQFALVVLFAHIFYPLLGNLQVGKQAVLAILLAS  467

Query  452  FAGFGVAMSGSSILVE  405
            FAGFGV MSG+S+L E
Sbjct  468  FAGFGVMMSGTSVLAE  483



>emb|CDY07939.1| BnaC03g35840D [Brassica napus]
Length=450

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT++TMVK++++W+YA+VQF  VV F+HIF+SLVH++ V+SILL+T  GFG
Sbjct  357  SCVLGLLASMTTTTMVKKQYIWIYATVQFGLVVFFSHIFFSLVHMKPVVSILLATLVGFG  416

Query  437  VAMSGSSILVEY  402
            + MSG + + E+
Sbjct  417  LTMSGQTGIAEF  428



>ref|XP_006480610.1| PREDICTED: uncharacterized protein LOC102629301 isoform X3 [Citrus 
sinensis]
 ref|XP_006480611.1| PREDICTED: uncharacterized protein LOC102629301 isoform X4 [Citrus 
sinensis]
Length=441

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S T++TMV++ F+W+YA +QF  VVL AH+FYSL+H+QAV+ +LLSTFAGFG
Sbjct  318  SCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFG  377

Query  437  VAMSGSSILVE  405
            + M+G+SIL +
Sbjct  378  ITMAGTSILTD  388



>gb|KDO44231.1| hypothetical protein CISIN_1g0103781mg [Citrus sinensis]
Length=350

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S T++TMV++ F+W+YA +QF  VVL AH+FYSL+H+QAV+ +LLSTFAGFG
Sbjct  227  SCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFG  286

Query  437  VAMSGSSILVE  405
            + M+G+SIL +
Sbjct  287  ITMAGTSILTD  297



>gb|KFK38364.1| hypothetical protein AALP_AA3G104500 [Arabis alpina]
Length=483

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMVK++FVWVYA++QF  VV F+H+F+SLVH+Q V++ILL+   GFG
Sbjct  377  SCILGLLASMTSTTMVKKQFVWVYATLQFGLVVFFSHVFFSLVHMQPVVAILLAILVGFG  436

Query  437  VAMSGSSILVEY  402
            + MSG++ +VE+
Sbjct  437  ITMSGTTGVVEF  448



>ref|XP_006428800.1| hypothetical protein CICLE_v10011512mg [Citrus clementina]
 gb|ESR42040.1| hypothetical protein CICLE_v10011512mg [Citrus clementina]
Length=512

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S T++TMV++ F+W+YA +QF  VVL AH+FYSL+H+QAV+ +LLSTFAGFG
Sbjct  389  SCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFG  448

Query  437  VAMSGSSILVE  405
            + M+G+SIL +
Sbjct  449  ITMAGTSILTD  459



>emb|CDY44728.1| BnaA05g28780D [Brassica napus]
Length=469

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCV GLL SMTS+TMVK+++VW+Y ++QF  VV F+HIF+SLVH+Q V+SILL+T  GFG
Sbjct  369  SCVFGLLASMTSTTMVKKQYVWIYGTIQFGLVVFFSHIFFSLVHMQPVVSILLATVVGFG  428

Query  437  VAMSGSSILVEY  402
            + MSG++ +VE+
Sbjct  429  LTMSGATGIVEF  440



>gb|KDO44228.1| hypothetical protein CISIN_1g0103781mg, partial [Citrus sinensis]
Length=483

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S T++TMV++ F+W+YA +QF  VVL AH+FYSL+H+QAV+ +LLSTFAGFG
Sbjct  360  SCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFG  419

Query  437  VAMSGSSILVE  405
            + M+G+SIL +
Sbjct  420  ITMAGTSILTD  430



>ref|XP_006481291.1| PREDICTED: uncharacterized protein LOC102628742 [Citrus sinensis]
 gb|KDO64249.1| hypothetical protein CISIN_1g010537mg [Citrus sinensis]
Length=508

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFYS+++V  +L++LLS+F GFG
Sbjct  379  SCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFG  438

Query  437  VAMSGSSILVEYF  399
            +A+S +S++VEY 
Sbjct  439  IAISTNSLIVEYL  451



>ref|XP_004303917.1| PREDICTED: uncharacterized protein LOC101297754 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS++LS F GFG
Sbjct  371  SCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYTILNVNPILSVILSAFTGFG  430

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  431  IAISTNSLLVEYL  443



>ref|XP_008380043.1| PREDICTED: uncharacterized protein LOC103443037 [Malus domestica]
 ref|XP_008380044.1| PREDICTED: uncharacterized protein LOC103443037 [Malus domestica]
 ref|XP_008380045.1| PREDICTED: uncharacterized protein LOC103443037 [Malus domestica]
Length=550

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  377  SCVLGLLSSMIASTMVSRSYLWAYASFQFAIVILFAHIFYTVLNVNPILSVLLSSFTGFG  436

Query  437  VAMSGSSILVEY  402
            +A+S +S+LVEY
Sbjct  437  IAISTNSLLVEY  448



>ref|XP_006480608.1| PREDICTED: uncharacterized protein LOC102629301 isoform X1 [Citrus 
sinensis]
Length=538

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S T++TMV++ F+W+YA +QF  VVL AH+FYSL+H+QAV+ +LLSTFAGFG
Sbjct  415  SCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFG  474

Query  437  VAMSGSSILVE  405
            + M+G+SIL +
Sbjct  475  ITMAGTSILTD  485



>gb|KEH35190.1| zinc finger protein [Medicago truncatula]
Length=476

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL S+ +STMV R ++W YA  QFAFV+LFAHIFYS+++V A+ S+LL+TF GFG
Sbjct  364  SCILGLLSSIIASTMVSRSYIWAYACFQFAFVILFAHIFYSILNVSAIFSVLLATFTGFG  423

Query  437  VAMSGSSILVEYF  399
            +A+S +S+L+EY 
Sbjct  424  IAISMNSLLMEYI  436



>gb|EEC81174.1| hypothetical protein OsI_24153 [Oryza sativa Indica Group]
Length=490

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  364  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  423

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  424  IAISANSMLVEYL  436



>ref|NP_001058355.2| Os06g0677300 [Oryza sativa Japonica Group]
 dbj|BAD45521.1| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa 
Japonica Group]
 dbj|BAD45918.1| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa 
Japonica Group]
 dbj|BAG94603.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF20269.2| Os06g0677300 [Oryza sativa Japonica Group]
Length=483

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  364  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  423

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  424  IAISANSMLVEYL  436



>ref|XP_006656375.1| PREDICTED: uncharacterized protein LOC102711268 [Oryza brachyantha]
Length=482

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  363  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  422

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  423  IAISANSMLVEYL  435



>ref|XP_008342280.1| PREDICTED: uncharacterized protein LOC103405094 [Malus domestica]
Length=507

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL S+ +STMV R ++W YAS QFA V+LFAHIFY++++V  +LS+LLS+F GFG
Sbjct  378  SCVLGLLSSVIASTMVSRSYIWAYASFQFAIVILFAHIFYTVLNVNPILSVLLSSFTGFG  437

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  438  IAISTNSLLVEYL  450



>ref|XP_010926931.1| PREDICTED: uncharacterized protein LOC105049083 [Elaeis guineensis]
Length=507

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V AVLS+LLS+F GFG
Sbjct  373  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYNVLRVAAVLSVLLSSFTGFG  432

Query  437  VAMSGSSILVEYF  399
            +A+S +S+L EY 
Sbjct  433  IAISTNSLLGEYL  445



>gb|KJB33377.1| hypothetical protein B456_006G008500 [Gossypium raimondii]
Length=490

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL SM +STMV R ++W YAS QFA V+LFAHIFY+++ V  +LS+LLS+F GFG
Sbjct  397  SCALGLLSSMIASTMVSRSYIWAYASFQFAMVILFAHIFYTVLAVNPILSVLLSSFTGFG  456

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  457  IAISTNSVLVEYL  469



>gb|KJB33376.1| hypothetical protein B456_006G008500 [Gossypium raimondii]
Length=487

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL SM +STMV R ++W YAS QFA V+LFAHIFY+++ V  +LS+LLS+F GFG
Sbjct  394  SCALGLLSSMIASTMVSRSYIWAYASFQFAMVILFAHIFYTVLAVNPILSVLLSSFTGFG  453

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  454  IAISTNSVLVEYL  466



>ref|XP_002446007.1| hypothetical protein SORBIDRAFT_06g000460 [Sorghum bicolor]
 gb|EES10335.1| hypothetical protein SORBIDRAFT_06g000460 [Sorghum bicolor]
Length=518

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA+VQF  VV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  370  SCILGLFSSLTTTSMVARRYVWIYAAVQFLLVVFFTHLFYRYLHLQAVISIILATFAGFG  429

Query  437  VAMSGSSILVE  405
            V M+G+SI +E
Sbjct  430  VGMTGNSIAIE  440



>ref|XP_002437443.1| hypothetical protein SORBIDRAFT_10g027165 [Sorghum bicolor]
 gb|EER88810.1| hypothetical protein SORBIDRAFT_10g027165 [Sorghum bicolor]
Length=483

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  363  SCVLGLLSSMIASTMVSKSYLWAYASFQFAIVILFAHIFYNVLRVNPVLAVLLSSFTGFG  422

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  423  IAISTNSLLVEYL  435



>gb|KHG11532.1| putative E3 ubiquitin-protein ligase MARCH10 [Gossypium arboreum]
Length=490

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL SM +STMV R ++W YAS QFA V+LFAHIFY+++ V  +LS+LLS+F GFG
Sbjct  397  SCALGLLSSMIASTMVSRSYIWAYASFQFAMVILFAHIFYTVLAVSPILSVLLSSFTGFG  456

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  457  IAISTNSVLVEYL  469



>ref|XP_010240722.1| PREDICTED: uncharacterized protein LOC100839069 isoform X2 [Brachypodium 
distachyon]
Length=477

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  358  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLRVNPVLAVLLSSFTGFG  417

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  418  IAISTNSLLVEYL  430



>ref|XP_009383024.1| PREDICTED: uncharacterized protein LOC103970820 [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LG+  S+T+STMV +RFVW+YA+VQF  VV FAH+FYS +H+Q ++SI+L+ FAGFG
Sbjct  369  SCILGVFASLTASTMVMKRFVWIYATVQFMLVVFFAHLFYSYLHMQVIISIVLAMFAGFG  428

Query  437  VAMSGSSILVE  405
            VAMSG++I +E
Sbjct  429  VAMSGNTIAIE  439



>ref|XP_003563408.1| PREDICTED: uncharacterized protein LOC100839069 isoform X1 [Brachypodium 
distachyon]
Length=483

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  364  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLRVNPVLAVLLSSFTGFG  423

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  424  IAISTNSLLVEYL  436



>ref|XP_008643895.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=483

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  364  SCVLGLLSSMIASTMVSKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  423

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  424  IAISTNSLLVEYL  436



>gb|ABF69983.1| zinc finger (C3HC4 type RING finger) family protein [Musa acuminata]
Length=297

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VLS+LLS+F GFG
Sbjct  172  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYNVLRVSPVLSVLLSSFTGFG  231

Query  437  VAMSGSSILVEYF  399
            +A+S ++ LVEY 
Sbjct  232  IAISTNASLVEYL  244



>ref|NP_001148132.1| protein binding protein [Zea mays]
 gb|ACG29838.1| protein binding protein [Zea mays]
Length=526

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VWVYA+ QF  VV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  379  SCILGLFSSLTTTSMVARRYVWVYAAAQFLLVVFFTHLFYRYLHLQAVISIILATFAGFG  438

Query  437  VAMSGSSILVE  405
            V M+G+SI +E
Sbjct  439  VGMTGNSIAIE  449



>ref|NP_001159170.1| hypothetical protein [Zea mays]
 gb|ACN25303.1| unknown [Zea mays]
 gb|AFW69001.1| hypothetical protein ZEAMMB73_653206 [Zea mays]
Length=482

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  363  SCVLGLLSSMIASTMVSKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  422

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  423  IAISTNSLLVEYL  435



>ref|XP_008791531.1| PREDICTED: uncharacterized protein LOC103708403 isoform X3 [Phoenix 
dactylifera]
Length=435

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+TSST+VK+R +WVYA VQF  +V FAH+F S  H+Q V+SI+L+TFAGFG
Sbjct  312  SCILGLFASLTSSTLVKKRCIWVYAIVQFLLIVFFAHLFNSYFHMQKVISIILATFAGFG  371

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGR  327
            VAMS  SI+VE  RWRRRR V        Q  LP  R
Sbjct  372  VAMSMRSIVVELLRWRRRRLVGSENHRRSQGTLPTTR  408



>ref|XP_007048885.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX93042.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=490

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LGLL S  +STMV R ++W Y+S QFA V+LFAHIFY+++ V A+LS+LLS+F GFG
Sbjct  380  SCALGLLSSTIASTMVSRSYIWAYSSFQFAMVILFAHIFYTVLDVNAILSVLLSSFTGFG  439

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  440  IAISTNSLLVEYL  452



>gb|EMS53848.1| hypothetical protein TRIUR3_23862 [Triticum urartu]
Length=484

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V AVL++LLS+F GFG
Sbjct  359  SCVLGLLSSMIASTMVTKSYLWAYASFQFAIVILFAHIFYNVLRVNAVLAVLLSSFTGFG  418

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVA  342
            +A+S +S+LVE  RWR RRR  L  Q +PQ A
Sbjct  419  IAISTNSLLVECMRWRSRRRSQLLAQAHPQPA  450



>ref|NP_001168524.1| protein binding protein [Zea mays]
 gb|ACN28521.1| unknown [Zea mays]
 gb|AFW57743.1| protein binding protein [Zea mays]
Length=517

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+T+++MV RR+VW+YA+ QF  VV F H+FY  +H+QAV+SI+L+TFAGFG
Sbjct  368  SCILGLFSSLTTTSMVARRYVWIYAAAQFLLVVFFTHLFYRYLHLQAVISIILATFAGFG  427

Query  437  VAMSGSSILVE  405
            V M+G+SI +E
Sbjct  428  VGMTGNSIAIE  438



>gb|AFW69000.1| hypothetical protein ZEAMMB73_653206 [Zea mays]
Length=549

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VL++LLS+F GFG
Sbjct  430  SCVLGLLSSMIASTMVSKSYLWAYASFQFAIVILFAHIFYNVLKVNPVLAVLLSSFTGFG  489

Query  437  VAMSGSSILVEYF  399
            +A+S +S+LVEY 
Sbjct  490  IAISTNSLLVEYL  502



>ref|XP_008791529.1| PREDICTED: uncharacterized protein LOC103708403 isoform X2 [Phoenix 
dactylifera]
Length=482

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+TSST+VK+R +WVYA VQF  +V FAH+F S  H+Q V+SI+L+TFAGFG
Sbjct  359  SCILGLFASLTSSTLVKKRCIWVYAIVQFLLIVFFAHLFNSYFHMQKVISIILATFAGFG  418

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGR  327
            VAMS  SI+VE  RWRRRR V        Q  LP  R
Sbjct  419  VAMSMRSIVVELLRWRRRRLVGSENHRRSQGTLPTTR  455



>ref|XP_009135042.1| PREDICTED: uncharacterized protein LOC103859282 [Brassica rapa]
Length=451

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT++TMV ++++W+YA+VQF  VV F+HIF++LVH++ V+SILL+T  GFG
Sbjct  353  SCVLGLLASMTTTTMVTKQYIWIYATVQFGLVVFFSHIFFTLVHMKPVVSILLATLVGFG  412

Query  437  VAMSGSSILVEY  402
            + MSG + L E+
Sbjct  413  LTMSGQTGLAEF  424



>ref|XP_009399240.1| PREDICTED: uncharacterized protein LOC103983694 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=505

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV + ++W YAS QFA V+LFAHIFY+++ V  VLS+LLS+F GFG
Sbjct  380  SCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYNVLRVSPVLSVLLSSFTGFG  439

Query  437  VAMSGSSILVEYF  399
            +A+S ++ LVEY 
Sbjct  440  IAISTNASLVEYL  452



>ref|XP_002884753.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61012.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL  SMTS+TMV++R+VW+YA+ QF  VV F+H+F++LV +Q V++ILL+T  GFG
Sbjct  382  SCVLGLFASMTSTTMVQKRYVWIYATTQFGLVVFFSHVFFTLVRMQPVVAILLATIVGFG  441

Query  437  VAMSGSSILVEY  402
            + MSG++ LVE+
Sbjct  442  LTMSGTTGLVEF  453



>ref|XP_008791528.1| PREDICTED: uncharacterized protein LOC103708403 isoform X1 [Phoenix 
dactylifera]
Length=492

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGL  S+TSST+VK+R +WVYA VQF  +V FAH+F S  H+Q V+SI+L+TFAGFG
Sbjct  369  SCILGLFASLTSSTLVKKRCIWVYAIVQFLLIVFFAHLFNSYFHMQKVISIILATFAGFG  428

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGR  327
            VAMS  SI+VE  RWRRRR V        Q  LP  R
Sbjct  429  VAMSMRSIVVELLRWRRRRLVGSENHRRSQGTLPTTR  465



>ref|XP_006297550.1| hypothetical protein CARUB_v10013573mg [Capsella rubella]
 gb|EOA30448.1| hypothetical protein CARUB_v10013573mg [Capsella rubella]
Length=483

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMTS+TMVK+ +VW+YA+ QF  VV F+HIF++LV +Q V+SILL+T  GFG
Sbjct  377  SCVLGLLASMTSTTMVKKSYVWIYATTQFGLVVFFSHIFFTLVRMQPVVSILLATLVGFG  436

Query  437  VAMSGSSILVEY  402
            + MS ++ LVE+
Sbjct  437  LTMSATTGLVEF  448



>emb|CDP16084.1| unnamed protein product [Coffea canephora]
Length=156

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC LG + +M +STMV + ++W YAS QFA V+LFAHIFY++++V A+LS+LLS+F GFG
Sbjct  57   SCALGFISTMIASTMVGKSYMWAYASFQFAIVILFAHIFYTVLNVNAILSVLLSSFTGFG  116

Query  437  VAMSGSSILVEY  402
            +A+S +S+LVEY
Sbjct  117  IAISTNSLLVEY  128



>emb|CDX73994.1| BnaA03g30530D [Brassica napus]
Length=477

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SMT++TMV ++++W+YA+VQF  VV F+HIF++LVH++ V+SILL+T  GFG
Sbjct  379  SCVLGLLASMTTTTMVTKQYIWIYATVQFGLVVFFSHIFFTLVHMKPVVSILLATLVGFG  438

Query  437  VAMSGSSILVEY  402
            + MSG + L E+
Sbjct  439  LTMSGQTGLAEF  450



>gb|EPS61929.1| hypothetical protein M569_12864, partial [Genlisea aurea]
Length=121

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  581  STMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFGVAMSGSSILVEY  402
            +T VKR+ VW+YASVQFA VVLFAHIFYSLVHV+ V SILLSTFAGFGVAM+G++++VE+
Sbjct  53   ATAVKRQLVWLYASVQFALVVLFAHIFYSLVHVRPVPSILLSTFAGFGVAMAGATVVVEF  112

Query  401  F  399
            F
Sbjct  113  F  113



>gb|AAF23305.1|AC016661_30 unknown protein [Arabidopsis thaliana]
Length=208

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 9/102 (9%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL  SMT++TMV +R+VW+YA+ QF  VV F+HIF++LV +Q V++ILL+T  GFG
Sbjct  102  SCVLGLFASMTATTMVPKRYVWIYATTQFGLVVFFSHIFFTLVRMQPVVAILLATIVGFG  161

Query  437  VAMSGSSILVEYFrwrrrrRVLLHRQENPQVALPPGRWPPQP  312
            + MSG++ +VE+ +          R+ N    LP      QP
Sbjct  162  LTMSGTTGIVEFSK---------WRRSNRTAELPSSSQVDQP  194



>ref|XP_009146902.1| PREDICTED: probable E3 ubiquitin-protein ligase MARCH10 isoform 
X2 [Brassica rapa]
Length=459

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCV GLL SMTS+TMVK+++VW+Y ++QF  VV F+HIF+SLVH+Q V+SILL+T  GFG
Sbjct  359  SCVFGLLASMTSTTMVKKQYVWIYGTIQFGLVVFFSHIFFSLVHMQPVVSILLATVFGFG  418

Query  437  VAMSGSSILVEY  402
            + MS ++ +VE+
Sbjct  419  LTMSSATGIVEF  430



>ref|XP_004497493.1| PREDICTED: uncharacterized protein LOC101500530 [Cicer arietinum]
Length=503

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+R  VW+Y +VQ   VV+  H+ YS+ H++AVL+ILL+TFAGFG
Sbjct  382  SCILGLLASMTATTMVRRNHVWIYGTVQLGLVVVDGHLLYSVAHMEAVLAILLATFAGFG  441

Query  437  VAMSGSSILVE  405
              M G+SIL+E
Sbjct  442  TVMCGTSILME  452



>gb|KEH39325.1| RING/U-box protein [Medicago truncatula]
Length=503

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 5/76 (7%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSL-----VHVQAVLSILLST  453
            SCVLGL+ +MTS+TMV+ +F+W+YAS QF  VVLFAH+FY L     V  QAVL+ILL++
Sbjct  371  SCVLGLVSAMTSTTMVRSKFIWLYASAQFLLVVLFAHVFYPLFGNLQVGKQAVLAILLAS  430

Query  452  FAGFGVAMSGSSILVE  405
            FAGFGV MSGSS++ E
Sbjct  431  FAGFGVMMSGSSVIAE  446



>gb|KJB16805.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=510

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 4/71 (6%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMTS+TMV+R++VW+YA++QFA VVL AH+FYSL    AVLS+LLS F GFG
Sbjct  387  SCILGLLASMTSTTMVRRKYVWLYATIQFALVVLSAHLFYSL----AVLSVLLSAFVGFG  442

Query  437  VAMSGSSILVE  405
              M G+SI+ E
Sbjct  443  STMCGTSIIYE  453



>gb|KEH42255.1| RING/U-box protein [Medicago truncatula]
Length=504

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC+LGLL SMT++TMV+R  VW+Y ++QF  VVL  H+F+ L  + AVL+ILL+TFAGFG
Sbjct  380  SCILGLLASMTATTMVRRNHVWIYGTMQFCLVVLCGHLFFKLTKMGAVLAILLATFAGFG  439

Query  437  VAMSGSSILVE  405
            V M G+ IL+E
Sbjct  440  VVMCGTCILIE  450



>ref|NP_566355.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAL06891.1| At3g09760/F8A24.19 [Arabidopsis thaliana]
 gb|AAM47479.1| At3g09760/F8A24.19 [Arabidopsis thaliana]
 gb|AAY57598.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE74809.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=491

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGL  SMT++TMV +R+VW+YA+ QF  VV F+HIF++LV +Q V++ILL+T  GFG
Sbjct  385  SCVLGLFASMTATTMVPKRYVWIYATTQFGLVVFFSHIFFTLVRMQPVVAILLATIVGFG  444

Query  437  VAMSGSSILVEY  402
            + MSG++ +VE+
Sbjct  445  LTMSGTTGIVEF  456



>ref|XP_006398765.1| hypothetical protein EUTSA_v10013453mg [Eutrema salsugineum]
 gb|ESQ40218.1| hypothetical protein EUTSA_v10013453mg [Eutrema salsugineum]
Length=469

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC++GLL SMTS+TMVK+ +VW++A++QF FVVLFAH+FYS V  Q V+ I+L+T  GFG
Sbjct  377  SCIIGLLASMTSTTMVKKNYVWIFATIQFGFVVLFAHLFYSFVK-QPVMCIVLATMIGFG  435

Query  437  VAMSGSSILVEYF  399
            + MSG++ + EY 
Sbjct  436  LTMSGTTAINEYM  448



>ref|XP_006593855.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Glycine max]
Length=429

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV   ++W YA  QFA V+LFAH+FY++++V A+LS+LLS+F GFG
Sbjct  343  SCVLGLLSSMIASTMVSGSYMWAYACFQFAIVILFAHVFYTILNVNAILSVLLSSFTGFG  402

Query  437  VAMSGSSILVEY  402
            +A+S +++L+EY
Sbjct  403  IAISLNTLLMEY  414



>ref|XP_001756778.1| predicted protein [Physcomitrella patens]
 gb|EDQ78375.1| predicted protein, partial [Physcomitrella patens]
Length=186

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL ++T+S +V++R+VW+YA  Q A VV FAHIFY +V V++VLSILLS F GFG
Sbjct  106  SCVLGLLAAITASNLVEKRYVWLYAICQLALVVCFAHIFYDVVGVESVLSILLSAFVGFG  165

Query  437  VAMSGSSILVE  405
            +AM  S++++E
Sbjct  166  IAMLTSTLIIE  176



>ref|XP_006287667.1| hypothetical protein CARUB_v10000877mg [Capsella rubella]
 gb|EOA20565.1| hypothetical protein CARUB_v10000877mg [Capsella rubella]
Length=472

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SC++GLL SMTS+TMVK+ +VW+YA++QF  VVLFAH+FYS+V  Q V+ I+L+T  GFG
Sbjct  385  SCIIGLLASMTSTTMVKKNYVWIYATIQFCLVVLFAHLFYSVVK-QPVMCIVLATMIGFG  443

Query  437  VAMSGSSILVEYF  399
            + M+G++ + EY 
Sbjct  444  LTMTGTTAINEYM  456



>gb|KHN41341.1| hypothetical protein glysoja_042686 [Glycine soja]
Length=467

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV   ++W YA  QFA V+LFAH+FY++++V A+LS+LLS+F GFG
Sbjct  381  SCVLGLLSSMIASTMVSGSYMWAYACFQFAIVILFAHVFYTILNVNAILSVLLSSFTGFG  440

Query  437  VAMSGSSILVEY  402
            +A+S +++L+EY
Sbjct  441  IAISLNTLLMEY  452



>ref|XP_003545062.1| PREDICTED: uncharacterized protein LOC100798208 isoform X1 [Glycine 
max]
 gb|KHN46877.1| hypothetical protein glysoja_031177 [Glycine soja]
Length=503

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R FVW YA  QFA ++L AH+FY++++  A+LSILLSTF GFG
Sbjct  378  SCVLGLLSSMIASTMVSRSFVWAYACFQFATLILLAHVFYTILNFNAILSILLSTFTGFG  437

Query  437  VAMSGSSILVEYF  399
            +A+S +S+++E+ 
Sbjct  438  IAISMNSLVMEFI  450



>ref|XP_010688787.1| PREDICTED: uncharacterized protein LOC104902636 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688788.1| PREDICTED: uncharacterized protein LOC104902636 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            +CVLGLL SM +ST+V + ++W YAS QFA V+LFAH+FY++++V A+LS+LLS+F GFG
Sbjct  371  ACVLGLLSSMIASTIVSKGYIWAYASFQFAIVLLFAHVFYTVLNVAALLSVLLSSFTGFG  430

Query  437  VAMSGSSILVEYF  399
            +A+S ++++VEY 
Sbjct  431  IAISTNALIVEYL  443



>ref|XP_009399238.1| PREDICTED: uncharacterized protein LOC103983694 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399239.1| PREDICTED: uncharacterized protein LOC103983694 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=507

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMV--KRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAG  444
            SCVLGLL SM +STMV   + ++W YAS QFA V+LFAHIFY+++ V  VLS+LLS+F G
Sbjct  380  SCVLGLLSSMIASTMVTVSKSYIWAYASFQFAIVILFAHIFYNVLRVSPVLSVLLSSFTG  439

Query  443  FGVAMSGSSILVEYF  399
            FG+A+S ++ LVEY 
Sbjct  440  FGIAISTNASLVEYL  454



>ref|XP_009399241.1| PREDICTED: uncharacterized protein LOC103983694 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=503

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMV--KRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAG  444
            SCVLGLL SM +STMV   + ++W YAS QFA V+LFAHIFY+++ V  VLS+LLS+F G
Sbjct  376  SCVLGLLSSMIASTMVTVSKSYIWAYASFQFAIVILFAHIFYNVLRVSPVLSVLLSSFTG  435

Query  443  FGVAMSGSSILVEYF  399
            FG+A+S ++ LVEY 
Sbjct  436  FGIAISTNASLVEYL  450



>ref|XP_006595644.1| PREDICTED: uncharacterized protein LOC100798208 isoform X2 [Glycine 
max]
Length=518

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV R FVW YA  QFA ++L AH+FY++++  A+LSILLSTF GFG
Sbjct  393  SCVLGLLSSMIASTMVSRSFVWAYACFQFATLILLAHVFYTILNFNAILSILLSTFTGFG  452

Query  437  VAMSGSSILVEYF  399
            +A+S +S+++E+ 
Sbjct  453  IAISMNSLVMEFI  465



>ref|XP_009384191.1| PREDICTED: uncharacterized protein LOC103971793 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +S MV + ++W YAS QFA V+LFAHIFY+++ V  V+S+LLS+F GFG
Sbjct  373  SCVLGLLSSMIASIMVTKSYIWAYASFQFAIVILFAHIFYNVLRVSPVISVLLSSFTGFG  432

Query  437  VAMSGSSILVEYF  399
            +A+S  S++VE+ 
Sbjct  433  IAISMKSLIVEFL  445



>gb|KHN48837.1| E3 ubiquitin-protein ligase MARCH7 [Glycine soja]
Length=476

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV   ++W YA  QF+ V+LFAH+FY++++V A+LS+LLS+F GFG
Sbjct  381  SCVLGLLSSMIASTMVSGSYMWAYACFQFSIVILFAHVFYTILNVNAILSVLLSSFTGFG  440

Query  437  VAMSGSSILVEY  402
            +A+S +++L EY
Sbjct  441  IAISLNTLLTEY  452



>ref|XP_003556847.2| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Glycine max]
 ref|XP_006605678.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Glycine max]
Length=475

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  617  SCVLGLLGSMTSSTMVKRRFVWVYASVQFAFVVLFAHIFYSLVHVQAVLSILLSTFAGFG  438
            SCVLGLL SM +STMV   ++W YA  QF+ V+LFAH+FY++++V A+LS+LLS+F GFG
Sbjct  380  SCVLGLLSSMIASTMVSGSYMWAYACFQFSIVILFAHVFYTILNVNAILSVLLSSFTGFG  439

Query  437  VAMSGSSILVEY  402
            +A+S +++L EY
Sbjct  440  IAISLNTLLTEY  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500