BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041G02

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     169   5e-45   Fragaria vesca subsp. vesca
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    165   6e-44   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    163   8e-43   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    163   1e-42   
gb|KHG15193.1|  Endoplasmin                                             161   2e-42   Gossypium arboreum [tree cotton]
gb|KJB63505.1|  hypothetical protein B456_010G0030001                   158   5e-42   Gossypium raimondii
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     160   7e-42   Prunus mume [ume]
gb|KJB63503.1|  hypothetical protein B456_010G0030001                   158   8e-42   Gossypium raimondii
gb|AAF64453.1|AF239931_1  putative heat-shock protein 90                154   9e-42   Euphorbia esula [wolf's milk]
ref|XP_010109992.1|  Endoplasmin-like protein                           161   1e-41   
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   158   3e-41   Gossypium raimondii
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             159   3e-41   Prunus persica
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   158   4e-41   Gossypium raimondii
gb|KJB14397.1|  hypothetical protein B456_002G122800                    158   4e-41   Gossypium raimondii
ref|XP_002510550.1|  endoplasmin, putative                              156   2e-40   Ricinus communis
gb|KHG17445.1|  Endoplasmin                                             155   4e-40   Gossypium arboreum [tree cotton]
dbj|BAL42333.1|  Heat shock protein 90                                  155   6e-40   Nicotiana tabacum [American tobacco]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     155   6e-40   Nicotiana tomentosiformis
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     155   7e-40   Pyrus x bretschneideri [bai li]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     154   8e-40   Solanum tuberosum [potatoes]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     154   9e-40   Solanum lycopersicum
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    154   1e-39   
gb|AAB63606.1|  HSP90 isolog                                            149   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         154   1e-39   Jatropha curcas
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     154   2e-39   
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     154   2e-39   Tarenaya hassleriana [spider flower]
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    154   2e-39   Catharanthus roseus [chatas]
dbj|BAL42332.1|  Heat shock protein 90                                  152   5e-39   Nicotiana tabacum [American tobacco]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     152   5e-39   Nicotiana sylvestris
ref|XP_003589505.1|  Endoplasmin-like protein                           152   5e-39   Medicago truncatula
gb|KDO84885.1|  hypothetical protein CISIN_1g003458mg                   151   5e-39   Citrus sinensis [apfelsine]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     152   9e-39   Phoenix dactylifera
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                152   1e-38   Erythranthe guttata [common monkey flower]
gb|ACN26939.1|  unknown                                                 140   1e-38   Zea mays [maize]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             152   1e-38   Phaseolus vulgaris [French bean]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     151   1e-38   Nelumbo nucifera [Indian lotus]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   151   1e-38   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             151   1e-38   Citrus clementina [clementine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     151   1e-38   Citrus sinensis [apfelsine]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          151   2e-38   Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          151   2e-38   Glycine max [soybeans]
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     150   3e-38   Elaeis guineensis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     150   4e-38   Nicotiana sylvestris
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          150   4e-38   Cicer arietinum [garbanzo]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          150   4e-38   Cicer arietinum [garbanzo]
emb|CDP07384.1|  unnamed protein product                                150   4e-38   Coffea canephora [robusta coffee]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     150   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          150   4e-38   Glycine max [soybeans]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          150   5e-38   
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     150   5e-38   Eucalyptus grandis [rose gum]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     149   8e-38   Vitis vinifera
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     149   1e-37   Phoenix dactylifera
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          149   1e-37   Amborella trichopoda
gb|AAN34791.1|  Grp94                                                   149   1e-37   Xerophyta viscosa
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     148   2e-37   Cucumis sativus [cucumbers]
ref|NP_974606.1|  HSP90-like protein GRP94                              148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194150.1|  HSP90-like protein GRP94                              148   2e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92620.1|  BnaC07g38780D                                          148   2e-37   
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     148   2e-37   Sesamum indicum [beniseed]
emb|CDY34264.1|  BnaA01g13670D                                          148   2e-37   Brassica napus [oilseed rape]
emb|CDY03477.1|  BnaC01g16050D                                          148   2e-37   
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     148   2e-37   Brassica rapa
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     148   2e-37   Elaeis guineensis
emb|CDY10992.1|  BnaA03g46510D                                          148   2e-37   Brassica napus [oilseed rape]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     149   2e-37   Vitis vinifera
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     147   3e-37   Cucumis melo [Oriental melon]
gb|ABK24228.1|  unknown                                                 144   4e-37   Picea sitchensis
gb|AIZ68158.1|  heat shock protein 90                                   147   5e-37   Ornithogalum longebracteatum [sea-onion]
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     147   6e-37   Oryza brachyantha
ref|NP_001151475.1|  endoplasmin precursor                              147   6e-37   Zea mays [maize]
dbj|BAB86368.1|  SHEPHERD                                               146   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|ABK92622.1|  unknown                                                 138   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     146   1e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001058590.1|  Os06g0716700                                       145   1e-36   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        145   1e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          145   2e-36   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          145   2e-36   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89816.1|  predicted protein                                      143   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             145   2e-36   Capsella rubella
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                145   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     145   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     145   3e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             144   5e-36   Eutrema salsugineum [saltwater cress]
emb|CDY08910.1|  BnaC08g11400D                                          144   5e-36   Brassica napus [oilseed rape]
gb|AFK40768.1|  unknown                                                 132   7e-36   Lotus japonicus
gb|AFW75769.1|  hypothetical protein ZEAMMB73_790349                    140   7e-36   
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     144   7e-36   Setaria italica
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    144   8e-36   Hordeum vulgare [barley]
gb|EMS56078.1|  Endoplasmin-like protein                                144   9e-36   Triticum urartu
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     143   9e-36   Brachypodium distachyon [annual false brome]
dbj|BAA90487.1|  heat shock protein 90                                  143   1e-35   Oryza sativa [red rice]
gb|ABV82432.1|  Hsp90-like protein                                      142   2e-35   Dactylis glomerata [cocksfoot]
gb|EMT19498.1|  Endoplasmin-like protein                                143   3e-35   
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          142   3e-35   
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             142   4e-35   Arabidopsis lyrata subsp. lyrata
gb|AFW75768.1|  hypothetical protein ZEAMMB73_790349                    140   4e-35   
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     141   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     141   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW75767.1|  endoplasmin                                             140   8e-35   
gb|EPS69355.1|  hypothetical protein M569_05408                         140   1e-34   Genlisea aurea
emb|CDY24830.1|  BnaA08g14800D                                          139   2e-34   Brassica napus [oilseed rape]
gb|ABV21762.1|  GRP94                                                   139   3e-34   Pinus taeda
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             138   8e-34   Populus trichocarpa [western balsam poplar]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    137   1e-33   Arabis alpina [alpine rockcress]
ref|NP_001146348.1|  shepherd-like1                                     136   2e-33   
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               136   4e-33   
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     136   4e-33   Populus euphratica
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    136   6e-33   
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     129   1e-30   
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             129   1e-30   Selaginella moellendorffii
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             129   1e-30   Selaginella moellendorffii
ref|XP_001770511.1|  predicted protein                                  126   1e-29   
gb|ABY26951.1|  endoplasmic heat shock protein 90                       100   7e-24   Capsicum annuum
ref|XP_002508627.1|  predicted protein                                95.9    3e-19   Micromonas commoda
ref|XP_003063917.1|  predicted protein                                94.7    1e-18   Micromonas pusilla CCMP1545
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum     90.1    4e-17   Ostreococcus lucimarinus CCE9901
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                 88.2    2e-16   Citrus sinensis [apfelsine]
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain     86.3    6e-16   Ostreococcus tauri
ref|XP_003083767.1|  heat shock protein 90 (ISS)                      86.3    6e-16   
ref|XP_001753222.1|  predicted protein                                85.1    1e-15   
ref|XP_005842771.1|  hypothetical protein CHLNCDRAFT_59468            82.4    2e-15   Chlorella variabilis
gb|ACO58576.1|  heat shock protein 90                                 80.5    2e-15   Apis mellifera [bee]
gb|KJB14398.1|  hypothetical protein B456_002G122800                  84.7    2e-15   Gossypium raimondii
gb|EWM29604.1|  heat shock protein 90                                 84.3    3e-15   Nannochloropsis gaditana
emb|CAU15484.1|  heat shock protein 90                                84.3    3e-15   Meloidogyne artiellia
emb|CAG01829.1|  unnamed protein product                              80.9    3e-15   Tetraodon nigroviridis
ref|XP_005651682.1|  heat shock protein Hsp90                         84.0    4e-15   Coccomyxa subellipsoidea C-169
gb|AAA30132.1|  heat shock protein 90                                 83.6    5e-15   Theileria parva
ref|XP_764810.1|  heat shock protein 90                               83.6    5e-15   Theileria parva strain Muguga
gb|ADD10372.1|  heat shock protein 90                                 83.2    7e-15   Meloidogyne incognita
gb|ACR57215.1|  Hsp90                                                 82.8    9e-15   Heterodera glycines
gb|AAO14563.2|AF461150_1  Hsp90                                       82.8    9e-15   Heterodera glycines
ref|XP_009606992.1|  PREDICTED: endoplasmin homolog                   76.3    1e-14   Nicotiana tomentosiformis
ref|XP_952473.1|  heat shock protein 90                               82.4    1e-14   Theileria annulata
ref|XP_006220022.1|  PREDICTED: heat shock protein 90-like            78.6    1e-14   Vicugna pacos
ref|XP_005538149.1|  heat shock protein of Hsp90 family               82.0    1e-14   Cyanidioschyzon merolae strain 10D
ref|XP_010928209.1|  PREDICTED: heat shock protein 90-2-like          77.4    2e-14   
gb|ACR57216.1|  Hsp90                                                 82.0    2e-14   Heterodera glycines
ref|XP_005855339.1|  molecular chaperone HtpG                         81.6    2e-14   Nannochloropsis gaditana CCMP526
gb|ADZ13510.1|  HSP90-1                                               81.6    2e-14   Ditylenchus destructor
ref|XP_001740319.1|  heat shock protein                               77.8    3e-14   Entamoeba dispar SAW760
gb|ABF61871.1|  chaperone                                             77.4    3e-14   Agave tequilana
ref|XP_007515443.1|  predicted protein                                81.3    3e-14   Bathycoccus prasinos
emb|CDP96098.1|  Protein BM-DAF-21, isoform a                         80.9    4e-14   
sp|O61998.2|HSP90_BRUPA  RecName: Full=Heat shock protein 90          80.9    4e-14   Brugia pahangi
gb|EJW88125.1|  heat shock protein 90                                 80.9    4e-14   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_005843734.1|  hypothetical protein CHLNCDRAFT_140066           80.5    4e-14   Chlorella variabilis
emb|CAA06694.1|  heat shock protein 90                                80.9    4e-14   Brugia pahangi
gb|AIL52741.1|  heat shock protein 90                                 80.9    4e-14   Phenacoccus solenopsis
ref|XP_001901767.1|  heat shock protein 90                            80.9    4e-14   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003135662.1|  heat shock protein 90                            80.9    4e-14   
gb|ACO55133.1|  heat shock protein 90                                 80.9    4e-14   Litomosoides sigmodontis
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like  76.6    4e-14   
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900            80.5    4e-14   Batrachochytrium dendrobatidis JAM81
ref|XP_009690258.1|  heat shock protein 90                            80.5    4e-14   Theileria orientalis strain Shintoku
gb|EMT27103.1|  Heat shock protein 83                                 80.5    5e-14   
emb|CDS03201.1|  Putative Heat shock protein 90-1                     80.5    6e-14   Lichtheimia ramosa
gb|ADF31756.1|  heat shock protein 90                                 80.5    6e-14   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31775.1|  heat shock protein 90                                 80.5    6e-14   Aegilops tauschii
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like          80.1    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDS03376.1|  Putative Heat shock protein 90-1                     80.1    6e-14   Lichtheimia ramosa
ref|XP_007512535.1|  predicted protein                                80.5    7e-14   Bathycoccus prasinos
dbj|BAN64175.1|  hsp90 protein                                        77.0    7e-14   Babesia bovis
emb|CDJ91963.1|  ATP-binding region and Heat shock protein Hsp90 ...  80.1    7e-14   Haemonchus contortus [red stomach worm]
emb|CDH60666.1|  heat shock protein 90                                80.1    7e-14   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH57487.1|  heat shock protein 90                                80.1    7e-14   Lichtheimia corymbifera JMRC:FSU:9682
gb|EKF32566.1|  heat shock protein 85, putative                       77.8    7e-14   Trypanosoma cruzi marinkellei
dbj|BAK08743.1|  heat shock protein 90                                80.1    7e-14   Chara braunii
gb|KHJ75602.1|  Hsp90 protein                                         76.6    8e-14   Oesophagostomum dentatum [nodule worm]
gb|EXX78198.1|  Hsp90 family chaperone HSC82                          78.2    8e-14   Rhizophagus irregularis DAOM 197198w
gb|ABA06421.1|  83 kDa heat shock protein                             75.1    9e-14   Leishmania chagasi
gb|KGG50896.1|  molecular chaperone HtpG                              79.7    9e-14   Mitosporidium daphniae
ref|XP_010928210.1|  PREDICTED: heat shock protein 90-2-like          75.1    9e-14   
gb|ADM83426.1|  heat shock protein 90                                 79.7    9e-14   Panonychus citri [citrus fruit mite]
ref|NP_571403.1|  heat shock protein HSP 90-alpha 1                   79.7    9e-14   Danio rerio [leopard danio]
gb|AFZ62631.1|  HSP90-1                                               79.7    9e-14   Ditylenchus destructor
gb|AAN77149.1|  fiber protein Fb9                                     75.9    9e-14   Gossypium barbadense [Egyptian cotton]
ref|XP_003102316.1|  CRE-DAF-21 protein                               79.7    1e-13   Caenorhabditis remanei
dbj|BAE90429.1|  unnamed protein product                              74.7    1e-13   Macaca fascicularis [crab eating macaque]
gb|KDE07091.1|  heat shock protein 90-1                               79.3    1e-13   Microbotryum lychnidis-dioicae p1A1 Lamole
dbj|BAJ85535.1|  predicted protein                                    79.3    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAH75757.1|  Hsp90a.1 protein                                      79.3    1e-13   Danio rerio [leopard danio]
ref|XP_002968038.1|  hypothetical protein SELMODRAFT_88538            79.3    1e-13   
ref|XP_002992602.1|  hypothetical protein SELMODRAFT_448838           79.3    1e-13   
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like          79.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q90474.3|H90A1_DANRE  RecName: Full=Heat shock protein HSP 90-...  79.3    1e-13   Danio rerio [leopard danio]
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1               79.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDS02719.1|  Putative Heat shock protein 90-1                     79.3    1e-13   Lichtheimia ramosa
ref|XP_010902983.1|  PREDICTED: heat shock protein HSP 90-alpha 1     79.3    1e-13   
gb|EKG06682.1|  heat shock protein 85, putative                       77.4    1e-13   Trypanosoma cruzi
dbj|BAA13431.1|  heat shock protein 90                                75.1    1e-13   Homo sapiens [man]
gb|ACV71144.1|  heat shock protein 90                                 79.0    2e-13   Babesia sp. Tianzhu
gb|ACV04849.1|  heat shock protein 90                                 79.0    2e-13   Babesia sp. BQ1/Lintan
gb|KGB79019.1|  hsp90-like protein                                    79.0    2e-13   Cryptococcus gattii VGII R265
gb|ACV71146.1|  heat shock protein 90                                 79.0    2e-13   Babesia sp. BQ1/Lintan
gb|KJE05047.1|  hsp90-like protein                                    79.0    2e-13   Cryptococcus gattii NT-10
ref|XP_009616710.1|  PREDICTED: endoplasmin homolog                   75.1    2e-13   Nicotiana tomentosiformis
gb|AAN76524.1|AF384807_1  heat-shock protein 90                       79.0    2e-13   Cryptococcus gattii VGI
ref|XP_003197339.1|  cytoplasmic chaperone (Hsp90 family); Hsp82p     79.0    2e-13   Cryptococcus gattii WM276
gb|EGT39214.1|  CBN-DAF-21 protein                                    79.0    2e-13   Caenorhabditis brenneri
gb|KIR45891.1|  hsp90-like protein                                    79.0    2e-13   Cryptococcus gattii CA1280
gb|ACV71143.1|  heat shock protein 90                                 78.6    2e-13   Babesia sp. Hebei
gb|KIR84754.1|  hsp90-like protein                                    79.0    2e-13   Cryptococcus gattii VGIV IND107
ref|XP_003971591.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  79.0    2e-13   Takifugu rubripes [tiger puffer]
emb|CDH51743.1|  heat shock protein 90                                79.0    2e-13   Lichtheimia corymbifera JMRC:FSU:9682
gb|AAB23704.1|  HSP90                                                 75.5    2e-13   Mus sp. [mice]
gb|KDP25390.1|  hypothetical protein JCGZ_20546                       79.0    2e-13   Jatropha curcas
gb|KHN76289.1|  Heat shock protein HSP 90-alpha                       78.6    2e-13   Toxocara canis
gb|AFR98377.1|  hsp90-like protein                                    78.6    2e-13   Cryptococcus neoformans var. grubii H99
emb|CDQ81678.1|  unnamed protein product                              78.6    2e-13   Oncorhynchus mykiss
gb|ESL09761.1|  heat shock protein 85                                 77.0    2e-13   Trypanosoma rangeli SC58
gb|ACO55135.1|  heat shock protein 90                                 78.6    2e-13   Toxocara cati [feline roundworm]
gb|AAN76525.1|AF384808_1  heat-shock protein 90                       78.6    2e-13   Cryptococcus neoformans var. grubii
gb|AGT57167.1|  heat shock protein 90-alpha 3                         78.6    2e-13   Salmo salar
emb|CBN74418.1|  Heat shock protein 90                                78.6    2e-13   Ectocarpus siliculosus
ref|XP_005643869.1|  heat shock protein Hsp90                         78.6    2e-13   Coccomyxa subellipsoidea C-169
gb|AAF31705.1|AF221856_1  heat-shock protein 80                       76.3    3e-13   Euphorbia esula [wolf's milk]
gb|AEM37757.1|  heat shock protein 90 beta                            73.9    3e-13   Epinephelus bruneus
emb|CAK22426.1|  heat shock protein 83                                76.6    3e-13   Beta vulgaris [beet]
ref|XP_005333421.1|  PREDICTED: heat shock protein HSP 90-alpha-l...  78.6    3e-13   Ictidomys tridecemlineatus
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                       75.1    3e-13   Platichthys flesus
gb|EYD92886.1|  hsp90 family protein                                  75.9    3e-13   Escherichia coli 1-176-05_S1_C1
gb|ACO58580.1|  heat shock protein 90                                 76.6    3e-13   Apis mellifera [bee]
ref|XP_010103960.1|  Heat shock cognate protein 80                    78.2    3e-13   
gb|AAB49983.1|  heat shock protein hsp90                              78.2    3e-13   Oncorhynchus tshawytscha [king salmon]
ref|XP_006632301.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  78.2    3e-13   
emb|CDQ59969.1|  unnamed protein product                              78.2    3e-13   Oncorhynchus mykiss
ref|XP_005333422.1|  PREDICTED: heat shock protein HSP 90-alpha-l...  78.2    3e-13   
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                   78.2    3e-13   Ancylostoma ceylanicum
ref|XP_006632300.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  78.2    3e-13   Lepisosteus oculatus
gb|KIH68348.1|  Hsp90 protein                                         78.2    3e-13   Ancylostoma duodenale
dbj|BAK08742.1|  heat shock protein 90                                78.2    3e-13   Chara braunii
dbj|BAK08728.1|  heat shock protein 90                                78.2    3e-13   Chara braunii
ref|XP_006632299.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  78.2    3e-13   
dbj|BAK08741.1|  heat shock protein 90                                78.2    3e-13   Chara braunii
gb|AGT57168.1|  heat shock protein 90-alpha 4                         78.2    3e-13   Salmo salar
gb|ETN83529.1|  putative heat shock protein 90                        78.2    3e-13   Necator americanus
dbj|BAH97107.1|  heat shock protein of Hsp90                          78.2    3e-13   Chara braunii
dbj|BAK08690.1|  heat shock protein 90                                77.8    4e-13   Chara braunii
gb|ESA08764.1|  hypothetical protein GLOINDRAFT_348967                77.8    4e-13   
emb|CAA34748.1|  heat shock-like protein                              75.5    4e-13   Mus musculus [mouse]
ref|XP_006149126.1|  PREDICTED: heat shock protein HSP 90-beta        77.8    4e-13   Tupaia chinensis
dbj|BAK08691.1|  heat shock protein 90                                77.8    4e-13   Chara braunii
dbj|BAF92789.1|  cytosolic heat shock protein 90 alpha                77.8    4e-13   Solea senegalensis
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like          77.8    4e-13   Elaeis guineensis
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg           77.8    4e-13   Eutrema salsugineum [saltwater cress]
gb|ACU00668.1|  heat shock protein 90                                 77.8    4e-13   Haemonchus contortus [red stomach worm]
gb|ACO55134.1|  heat shock protein 90                                 77.8    4e-13   Ascaris suum
tpg|DAA40367.1|  TPA: putative heat shock protein 90 family protein   76.3    4e-13   
gb|ERG82208.1|  heat shock protein hsp 90-alpha                       77.8    4e-13   
gb|AEG78394.1|  heat shock protein 90                                 73.9    4e-13   Epinephelus coioides [estuary cod]
dbj|BAN65820.1|  hsp90 protein                                        77.0    4e-13   Babesia bovis
gb|ADZ97023.1|  heat shock protein 90                                 73.6    4e-13   Rana sauteri [Kanshirei village frog]
gb|AIU38242.1|  heat shock protein 90                                 77.8    4e-13   Anisakis pegreffii
ref|XP_010736427.1|  PREDICTED: heat shock protein HSP 90-alpha i...  77.8    4e-13   Larimichthys crocea [croceine croaker]
dbj|BAJ34368.1|  unnamed protein product                              77.8    4e-13   Eutrema halophilum
ref|XP_004035743.1|  hypothetical protein IMG5_091060                 77.8    4e-13   Ichthyophthirius multifiliis
gb|AIU38243.1|  heat shock protein 90                                 77.8    4e-13   Anisakis typica
dbj|BAD83620.1|  cytosolic-type hsp90                                 77.8    4e-13   Entamoeba histolytica
gb|AIU38245.1|  heat shock protein 90                                 77.8    4e-13   Anisakis physeteris
ref|XP_002637777.1|  C. briggsae CBR-DAF-21 protein                   77.8    4e-13   Caenorhabditis briggsae
gb|AIU38246.1|  heat shock protein 90                                 77.8    4e-13   Anisakis brevispiculata
ref|XP_008855466.1|  heat shock protein 90, putative                  77.8    4e-13   Entamoeba nuttalli P19
ref|XP_308797.3|  AGAP006961-PA                                       76.3    4e-13   Anopheles gambiae str. PEST
gb|AIU38244.1|  heat shock protein 90                                 77.8    5e-13   Anisakis paggiae
gb|ACZ13352.1|  HSP90 protein                                         77.0    5e-13   Bursaphelenchus xylophilus [pine wilt nematode]
ref|XP_005805662.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  77.8    5e-13   Xiphophorus maculatus
ref|XP_568451.1|  chaperone                                           77.8    5e-13   Cryptococcus neoformans var. neoformans JEC21
ref|XP_007577310.1|  PREDICTED: heat shock protein HSP 90-alpha 1     77.8    5e-13   Poecilia formosa
gb|EPY40503.1|  heat shock protein 83-1                               75.1    5e-13   Angomonas deanei
gb|AEH27540.1|  cytosolic heat shock protein 90-alpha                 77.8    5e-13   Lates calcarifer [Asian seabass]
dbj|BAN65595.1|  hsp90 protein                                        76.6    5e-13   Babesia bovis
gb|ELW65618.1|  Heat shock protein HSP 90-beta                        77.8    5e-13   Tupaia chinensis
ref|XP_001735351.1|  heat shock protein 81-1                          77.4    5e-13   Entamoeba dispar SAW760
gb|KFD54842.1|  hypothetical protein M513_04276                       77.4    5e-13   Trichuris suis
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like          77.4    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817           77.4    5e-13   Phytophthora sojae
ref|NP_506626.1|  Protein DAF-21                                      77.4    5e-13   Caenorhabditis elegans [roundworm]
ref|XP_002998541.1|  heat shock protein 90                            77.4    5e-13   
emb|CDR97179.1|  hsp90 protein, putative                              77.4    5e-13   
ref|XP_653132.1|  heat shock protein 90                               77.4    5e-13   
gb|ETK95017.1|  heat shock protein 90-2                               77.4    5e-13   
ref|XP_008915791.1|  heat shock protein 90-2                          77.4    5e-13   
ref|XP_653162.1|  heat shock protein 90                               77.4    5e-13   
ref|XP_005805663.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  77.4    5e-13   
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like            77.4    5e-13   
ref|XP_308799.3|  AGAP006959-PA                                       76.3    6e-13   
gb|EKG00457.1|  heat shock protein 85, putative                       76.6    6e-13   
ref|XP_010788727.1|  PREDICTED: heat shock protein HSP 90-alpha 1     77.4    6e-13   
gb|AAG22091.1|AF306643_1  90 kDa heat-shock protein                   73.2    6e-13   
gb|AEV91217.1|  cytosolic heat shock protein 90                       77.0    6e-13   
ref|XP_004542148.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  77.4    6e-13   
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like          77.4    6e-13   
ref|XP_804480.1|  heat shock protein 85                               77.4    6e-13   
ref|XP_008297037.1|  PREDICTED: heat shock protein HSP 90-alpha 1     77.4    6e-13   
ref|XP_003440693.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  77.4    6e-13   
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like    77.0    6e-13   
ref|NP_200076.1|  heat shock protein 90.1                             77.0    6e-13   
gb|EJT49886.1|  chaperone                                             77.0    6e-13   
sp|P06660.1|HSP85_TRYCR  RecName: Full=Heat shock-like 85 kDa pro...  77.0    7e-13   
ref|XP_811791.1|  heat shock protein 85                               77.0    7e-13   
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg           77.0    7e-13   
ref|XP_007863437.1|  HSP90-domain-containing protein                  77.0    7e-13   
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                 77.0    7e-13   
gb|AAA32822.1|  heat shock protein 83                                 77.0    7e-13   
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2               77.0    7e-13   
prf||1710352A  heat shock protein 83                                  77.0    7e-13
ref|XP_010257890.1|  PREDICTED: heat shock protein 81-1-like          77.4    7e-13   
gb|ADF31755.1|  heat shock protein 90                                 77.0    7e-13   
gb|EMD43140.1|  Heat shock family 85 kDa protein                      77.0    7e-13   
gb|ACY01918.1|  heat shock protein 90                                 77.0    7e-13   
prf||1908431A  heat shock protein HSP81-1                             77.0    7e-13
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...  77.0    7e-13   
dbj|BAA00615.1|  81kDa heat-shock protein                             77.0    7e-13   
ref|XP_814893.1|  heat shock protein 85                               76.6    7e-13   
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80         77.0    7e-13   
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2               77.0    7e-13   
ref|XP_005900146.1|  PREDICTED: heat shock protein HSP 90-beta is...  77.0    7e-13   
gb|AAH49951.1|  Hsp90ab1 protein                                      75.5    7e-13   
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like          77.0    7e-13   
gb|ACU00686.1|  heat shock protein 90                                 75.5    7e-13   
ref|NP_001278186.1|  heat shock protein HSP 90-alpha 1-like           77.0    8e-13   
gb|EKF32565.1|  heat shock protein 85, putative                       77.0    8e-13   
ref|XP_005900147.1|  PREDICTED: heat shock protein HSP 90-beta is...  77.0    8e-13   
ref|XP_005285846.1|  PREDICTED: heat shock protein HSP 90-alpha       77.0    8e-13   
ref|XP_005900148.1|  PREDICTED: heat shock protein HSP 90-beta is...  77.0    8e-13   
dbj|BAE87688.1|  unnamed protein product                              75.5    8e-13   
dbj|BAF83423.1|  unnamed protein product                              75.5    8e-13   
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1               77.0    8e-13   
dbj|BAB15121.1|  unnamed protein product                              75.5    8e-13   
gb|EPY32689.1|  heat shock protein 83-1                               74.3    8e-13   
gb|AEG19531.1|  heat shock protein 90                                 77.0    8e-13   
gb|ELW61522.1|  Heat shock cognate protein HSP 90-beta                73.6    9e-13   
dbj|BAH71458.1|  ACYPI002010                                          73.9    9e-13   
emb|CBJ23502.1|  heat shock protein 90                                73.9    9e-13   
gb|AAH08189.1|  Unknown (protein for IMAGE:3584589)                   76.3    9e-13   
gb|AAH44888.1|  Hsp90ab1 protein                                      75.5    9e-13   
gb|KDD75584.1|  heat shock protein 90 Hsp90                           76.6    9e-13   
tpg|DAA61993.1|  TPA: putative heat shock protein 90 family protein   75.9    9e-13   
gb|KIK94310.1|  hypothetical protein PAXRUDRAFT_143168                76.6    9e-13   
gb|EMP32875.1|  Heat shock protein HSP 90-alpha                       76.6    9e-13   
ref|XP_001611554.1|  hsp90 protein                                    76.6    1e-12   
gb|AAP51213.1|  90-kDa heat-shock protein                             76.6    1e-12   
gb|KIP08934.1|  hypothetical protein PHLGIDRAFT_103566                76.6    1e-12   
ref|XP_007062955.1|  PREDICTED: heat shock protein HSP 90-alpha       76.6    1e-12   
gb|ABO93609.1|  heat shock protein 90                                 75.1    1e-12   
gb|ADF31778.1|  heat shock protein 90                                 76.6    1e-12   
gb|KIJ16896.1|  hypothetical protein PAXINDRAFT_162512                76.6    1e-12   
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                 75.1    1e-12   
gb|ESS64949.1|  heat shock protein 85                                 76.6    1e-12   
dbj|BAF75058.1|  heat shock protein                                   72.8    1e-12   
emb|CDW54307.1|  heat shock protein 90                                76.6    1e-12   
ref|XP_006373573.1|  HSP80 family protein                             76.6    1e-12   
ref|NP_001236599.1|  heat shock protein 90-2                          76.6    1e-12   
gb|KHN23824.1|  Heat shock cognate protein 80                         76.6    1e-12   
ref|XP_004254906.1|  heat shock protein 81-1, putative                76.6    1e-12   
ref|XP_009627181.1|  PREDICTED: heat shock protein 90-1-like          76.6    1e-12   
ref|XP_004083818.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  76.6    1e-12   
ref|XP_001744222.1|  hypothetical protein                             76.6    1e-12   
gb|ADF31772.1|  heat shock protein 90                                 76.6    1e-12   
gb|ADF31754.1|  heat shock protein 90                                 76.6    1e-12   
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like    76.6    1e-12   
gb|EMS66149.1|  Heat shock protein 83                                 76.3    1e-12   
gb|ESL11989.1|  molecular chaperone HtpG                              76.3    1e-12   
gb|AGN32883.1|  heat shock protein 85                                 76.6    1e-12   
emb|CAC29071.1|  heat shock protein 90                                73.9    1e-12   
ref|XP_009776793.1|  PREDICTED: heat shock protein 90-1-like          76.6    1e-12   
ref|XP_005145389.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...  76.3    1e-12   
gb|ADC53691.1|  heat shock protein 90-2                               73.6    1e-12   
gb|ESL05552.1|  molecular chaperone HtpG                              76.3    1e-12   
gb|AER28024.1|  heat shock protein 83S1                               76.6    1e-12   
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                 76.6    1e-12   
dbj|BAI23212.1|  heat shock protein 90kDa beta (cytosolic), class...  76.6    1e-12   
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like          76.6    1e-12   
gb|EPB88745.1|  heat shock protein 90-1                               76.3    1e-12   
ref|NP_996842.1|  heat shock cognate protein HSP 90-beta              76.6    1e-12   
ref|XP_006793113.1|  PREDICTED: heat shock protein HSP 90-alpha 1...  76.3    1e-12   
ref|XP_009542788.1|  hypothetical protein HETIRDRAFT_311260           76.3    1e-12   
gb|KHN43913.1|  Heat shock cognate protein 80                         75.9    1e-12   
ref|XP_007071731.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_005296381.1|  PREDICTED: heat shock protein HSP 90-beta        76.3    1e-12   
gb|EPB86046.1|  heat shock protein 90-1                               76.3    1e-12   
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like  76.3    1e-12   
ref|NP_001153536.1|  heat shock protein 90                            76.3    1e-12   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like            76.3    1e-12   
ref|XP_005439121.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_005238718.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_003203973.1|  PREDICTED: heat shock protein HSP 90-beta        76.3    1e-12   
ref|XP_005238717.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_007071732.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_007071733.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80         76.3    1e-12   
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                   76.3    1e-12   
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like            76.3    1e-12   
ref|XP_009003691.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...  76.3    1e-12   
gb|EPS64640.1|  hypothetical protein M569_10141                       73.9    1e-12   
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...  76.3    1e-12   
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like          76.3    1e-12   
ref|XP_005238716.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
gb|ADC53692.1|  heat shock protein 90-1                               73.6    1e-12   
gb|KDO70244.1|  hypothetical protein CISIN_1g0038272mg                75.1    1e-12   
gb|ADF31779.1|  heat shock protein 90                                 76.3    1e-12   
ref|XP_011345590.1|  PREDICTED: heat shock protein 83                 76.3    1e-12   
ref|XP_005439123.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|XP_011396896.1|  Heat shock protein 83-1                          76.3    1e-12   
ref|XP_005439122.1|  PREDICTED: heat shock protein HSP 90-beta is...  76.3    1e-12   
ref|NP_001072765.1|  heat shock protein 90kDa alpha (cytosolic), ...  76.3    1e-12   
emb|CEP09503.1|  hypothetical protein                                 76.3    1e-12   
gb|EGW01344.1|  Heat shock protein HSP 90-beta                        75.1    1e-12   
ref|NP_001025655.1|  heat shock protein 90kDa alpha (cytosolic), ...  76.3    2e-12   
ref|XP_008256039.1|  PREDICTED: heat shock protein HSP 90-alpha-like  72.0    2e-12   
emb|CAY56585.1|  putative heat shock protein 83                       75.9    2e-12   
gb|AGU99972.1|  HSP90                                                 75.9    2e-12   
ref|XP_010213538.1|  PREDICTED: heat shock protein HSP 90-alpha       76.3    2e-12   
dbj|BAE48212.1|  heat shock protein 90 beta                           73.9    2e-12   
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like          75.9    2e-12   
gb|AEM65180.1|  heat shock protein 90 alpha                           75.9    2e-12   
ref|XP_007300418.1|  HSP90-domain-containing protein                  75.9    2e-12   
gb|AJM13601.1|  heat shock protein 90 beta                            75.9    2e-12   
ref|XP_006874806.1|  PREDICTED: putative heat shock protein HSP 9...  74.3    2e-12   
gb|ABV55506.1|  heat shock protein 90                                 75.9    2e-12   
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like            75.9    2e-12   
gb|KHG21667.1|  Heat shock cognate 80                                 75.9    2e-12   
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1               75.9    2e-12   
gb|KHJ75025.1|  Hsp90 protein                                         73.2    2e-12   
dbj|BAP11233.1|  putative heat shock protein                          70.5    2e-12   
gb|EPY33491.1|  molecular chaperone HtpG                              74.7    2e-12   
ref|NP_001255537.1|  Protein ENPL-1, isoform b                        75.9    2e-12   
gb|AGB76029.1|  heat shock protein 90                                 75.9    2e-12   
gb|EEC84770.1|  hypothetical protein OsI_31800                        73.2    2e-12   
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839           75.9    2e-12   
dbj|BAP11234.1|  putative heat shock protein                          70.5    2e-12   
ref|XP_002509852.1|  heat shock protein, putative                     75.9    2e-12   
ref|XP_007385736.1|  HSP90-domain-containing protein                  75.9    2e-12   
ref|XP_001448308.1|  hypothetical protein                             73.2    2e-12   
dbj|GAN09812.1|  heat-shock protein 90                                75.9    2e-12   
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2               75.9    2e-12   
ref|XP_008839681.1|  PREDICTED: heat shock protein HSP 90-beta-like   75.9    2e-12   
gb|EDM18740.1|  rCG43497, isoform CRA_a                               75.5    2e-12   
ref|XP_008551765.1|  PREDICTED: heat shock protein 83                 75.9    2e-12   
ref|NP_001274755.1|  heat shock protein 83-like                       75.9    2e-12   
ref|XP_009391128.1|  PREDICTED: heat shock protein 81-1-like          71.2    2e-12   
emb|CAA68885.1|  heat shock protein 90A                               75.9    2e-12   
gb|ABD75383.1|  heat shock protein 90                                 75.9    2e-12   
gb|KJB22184.1|  hypothetical protein B456_004G033900                  75.9    2e-12   
gb|AGA62462.1|  heat shock protein 90                                 75.9    2e-12   
emb|CAU15486.1|  heat shock protein 90                                75.9    2e-12   
ref|XP_010357560.1|  PREDICTED: putative heat shock protein HSP 9...  70.5    2e-12   
ref|XP_009927241.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
gb|ETN77129.1|  Hsp90 protein                                         75.9    2e-12   
gb|EPQ17302.1|  Heat shock protein HSP 90-beta                        72.4    2e-12   
gb|EHH53075.1|  hypothetical protein EGM_13637                        75.9    2e-12   
gb|AEF33377.1|  heat shock protein 90                                 72.0    2e-12   
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like          75.9    2e-12   
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2               75.9    2e-12   
emb|CAG01828.1|  unnamed protein product                              75.5    2e-12   
ref|XP_009927240.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2               75.9    2e-12   
ref|XP_011154034.1|  PREDICTED: heat shock protein 83                 75.9    2e-12   
ref|XP_006290250.1|  hypothetical protein CARUB_v100035111mg          70.9    2e-12   
gb|KFP46972.1|  Heat shock cognate protein HSP 90-beta                75.9    2e-12   
ref|XP_010374224.1|  PREDICTED: heat shock protein HSP 90-beta-like   75.9    2e-12   
ref|XP_005176932.1|  PREDICTED: heat shock protein 83                 75.5    2e-12   
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1               75.5    2e-12   
ref|NP_001255536.1|  Protein ENPL-1, isoform a                        75.9    2e-12   
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like          75.5    2e-12   
gb|AER28022.1|  heat shock protein 83P1                               75.5    2e-12   
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha       75.1    2e-12   
gb|ACX42226.1|  heat shock protein 90                                 75.9    2e-12   
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg           75.5    2e-12   
ref|XP_010579458.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
gb|AIA62362.1|  hsp90                                                 75.1    2e-12   
dbj|GAN05858.1|  heat-shock protein 90                                75.5    2e-12   
ref|XP_007040338.1|  Heat shock protein 90.1                          75.5    2e-12   
ref|XP_002864186.1|  heat shock protein 81-1                          75.5    2e-12   
ref|XP_007537449.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
gb|ADK26462.1|  heat shock protein 90                                 75.5    2e-12   
ref|XP_308800.3|  AGAP006958-PA                                       75.5    2e-12   
gb|ACV71142.1|  heat shock protein 90                                 75.5    2e-12   
gb|KIP09595.1|  hypothetical protein PHLGIDRAFT_126182                75.5    2e-12   
ref|XP_005861017.1|  PREDICTED: heat shock protein HSP 90-beta        75.5    2e-12   
gb|AAH07989.2|  HSP90AA1 protein                                      74.7    2e-12   
gb|AIC33004.1|  heat-shock protein 90                                 75.5    2e-12   
gb|AAF82792.1|AF275719_1  chaperone protein HSP90 beta                75.5    2e-12   
ref|XP_006458532.1|  hypothetical protein AGABI2DRAFT_190809          75.5    2e-12   
gb|EPQ04441.1|  Heat shock cognate protein HSP 90-beta                75.5    2e-12   
ref|XP_002914502.1|  PREDICTED: heat shock protein HSP 90-beta        75.5    2e-12   
gb|ERE90102.1|  heat shock protein HSP 90-beta-like protein           75.5    2e-12   
ref|XP_006190768.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
ref|XP_007537448.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
ref|XP_005960167.1|  PREDICTED: heat shock protein HSP 90-beta        75.5    2e-12   
ref|XP_010579461.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
ref|XP_007085185.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   
gb|EMD38391.1|  hypothetical protein CERSUDRAFT_153213                75.5    2e-12   
dbj|BAE27449.1|  unnamed protein product                              75.5    2e-12   
ref|XP_004408188.1|  PREDICTED: heat shock cognate protein HSP 90...  75.5    2e-12   
gb|AIU47031.1|  heat shock protein                                    75.5    2e-12   
gb|EPY76710.1|  heat shock cognate protein HSP 90-beta-like isofo...  75.5    2e-12   
ref|XP_004590465.1|  PREDICTED: heat shock protein HSP 90-beta is...  75.5    2e-12   



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD++KQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K TAQLIY+TA ME
Sbjct  688  MQSQTLSDSAKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKHTAQLIYQTALME  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEENDeve--kkaetsskkaEFNPENAKNG  246
            SGF +PDPKDFAS IY+SVKSS NI+PDA VEE D+ E   +AE  +   E  PE     
Sbjct  748  SGFVLPDPKDFASRIYSSVKSSLNINPDATVEEEDDTEDPAEAEAETPANEATPEAEAAN  807

Query  245  ADGIKDEL  222
            AD +KDEL
Sbjct  808  ADSLKDEL  815



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K+TAQLIY+TA ME
Sbjct  612  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALME  671

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF++PDPKDFAS IY+SVKSS NISPDA +
Sbjct  672  SGFSLPDPKDFASRIYSSVKSSLNISPDATI  702



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K+TAQLIY+TA ME
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF++PDPKDFAS IY+SVKSS NISPDA
Sbjct  751  SGFSLPDPKDFASRIYSSVKSSLNISPDA  779



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K+TAQLIY+TA ME
Sbjct  707  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALME  766

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF++PDPKDFAS IY+SVKSS NISPDA
Sbjct  767  SGFSLPDPKDFASRIYSSVKSSLNISPDA  795



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERVVK  EDE  K+TAQLIY+TA ME
Sbjct  604  MQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVVKDSEDEGVKQTAQLIYQTALME  663

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY+SVKSS NISPDA
Sbjct  664  SGFNLPDPKDFASRIYSSVKSSLNISPDA  692



>gb|KJB63505.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=500

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV K  EDE  K+TAQLIY+TA ME
Sbjct  386  MQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALME  445

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+P+PKDFAS IY+SVKSS NISPDA +
Sbjct  446  SGFNLPEPKDFASRIYSSVKSSLNISPDATI  476



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKR+LEINPRHPIIKELRERVVK  EDES K+TAQLIY+TA ME
Sbjct  692  MQSQTLSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALME  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY+SVKSS NI+PD
Sbjct  752  SGFNLPDPKDFASRIYSSVKSSLNINPD  779



>gb|KJB63503.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
 gb|KJB63504.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=540

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV K  EDE  K+TAQLIY+TA ME
Sbjct  426  MQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALME  485

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+P+PKDFAS IY+SVKSS NISPDA +
Sbjct  486  SGFNLPEPKDFASRIYSSVKSSLNISPDATI  516



>gb|AAF64453.1|AF239931_1 putative heat-shock protein 90 [Euphorbia esula]
Length=317

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDA KQAYM+GKRVLEINPRHPIIKELRERVVK PEDE+ K+TA LIY+TA ME
Sbjct  191  MQAQTLSDAKKQAYMKGKRVLEINPRHPIIKELRERVVKDPEDENVKQTAHLIYQTALME  250

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVKSS NISPDA
Sbjct  251  SGFMLSDPKDFASRIYSSVKSSLNISPDA  279



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K+T+QLIY+TA ME
Sbjct  687  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTSQLIYQTALME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF + DPKDFA+ IY+SVKSS NI+PDA+VE
Sbjct  747  SGFMLTDPKDFANRIYSSVKSSLNINPDAMVE  778



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV K  EDE  K+TAQLIY+TA ME
Sbjct  667  MQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALME  726

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+P+PKDFAS IY+SVKSS NISPDA +
Sbjct  727  SGFNLPEPKDFASRIYSSVKSSLNISPDATI  757



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKR+LEINPRHPIIKELRERVVK  EDES K+TAQLIY+TA ME
Sbjct  692  MQSQTLSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALME  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPKDFAS IY+SVKSS NI+P
Sbjct  752  SGFNLPDPKDFASRIYSSVKSSLNINP  778



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV K  EDE  K+TAQLIY+TA ME
Sbjct  709  MQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALME  768

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+P+PKDFAS IY+SVKSS NISPDA +
Sbjct  769  SGFNLPEPKDFASRIYSSVKSSLNISPDATI  799



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 101/130 (78%), Gaps = 10/130 (8%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVK PEDE  K+TAQLIY+TA ME
Sbjct  686  MQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPEDEGVKQTAQLIYQTALME  745

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEENDevekkaetsskkaEFNPENAKNGAD  240
            SGF + DPKDFAS IY+SVKSS NISPDA +EE D+VE+             +  K+GAD
Sbjct  746  SGFILSDPKDFASRIYSSVKSSLNISPDATIEEEDDVEETETEP------ETKAGKDGAD  799

Query  239  ----GIKDEL  222
                G+KDEL
Sbjct  800  AESSGLKDEL  809



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M SQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PED+S KETAQLIY+TA ME
Sbjct  690  MSSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKETAQLIYQTALME  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IYNSVKSS +ISP+A
Sbjct  750  SGFMLNDPKDFASRIYNSVKSSLDISPEA  778



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTL+DASKQAYMRG+R+LEINPRHPIIKELRERVVK PEDE  K+TAQLIY+TA ME
Sbjct  689  MQAQTLTDASKQAYMRGRRILEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALME  748

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS NI PDA +
Sbjct  749  SGFILTDPKDFASRIYSSVKSSLNIGPDATI  779



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+K PEDES K+TAQL+Y+TA +E
Sbjct  692  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLE  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS N+SPDA V
Sbjct  752  SGFLLNDPKDFASRIYSSVKSSLNVSPDATV  782



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+K PEDES K+TAQL+Y+TA +E
Sbjct  692  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLE  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS N+SPDA V
Sbjct  752  SGFLLNDPKDFASRIYSSVKSSLNVSPDATV  782



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK  EDES K+TAQLIY+TA ME
Sbjct  691  MQSQTLSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKKTAQLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPKDFAS IY+SVKSS NI+P
Sbjct  751  SGFNLPDPKDFASRIYSSVKSSLNINP  777



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M SQTLSDASKQAYMRGKRVLEINPRHPIIK LRERVV  PEDES K TA+LIY+TA ME
Sbjct  685  MHSQTLSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALME  744

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF++ DPKDFAS IY+SVKSS NISPDA V
Sbjct  745  SGFDLSDPKDFASHIYSSVKSSLNISPDATV  775



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M SQTLSDASKQAYMRGKRVLEINPRHPIIK LRERVV  PEDES K TA+LIY+TA ME
Sbjct  691  MHSQTLSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF++ DPKDFAS IY+SVKSS NISPDA V
Sbjct  751  SGFDLSDPKDFASHIYSSVKSSLNISPDATV  781



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQ YMRGKR+LEINPRHPI+KELRERVVK  EDES K+TAQLIY+TA ME
Sbjct  691  MQSQTLSDANKQGYMRGKRILEINPRHPIVKELRERVVKNAEDESVKKTAQLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPKDFAS IY+SVKSS NI+P
Sbjct  751  SGFNLPDPKDFASRIYSSVKSSLNINP  777



>gb|AAB63606.1| HSP90 isolog [Arabidopsis thaliana]
Length=335

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  200  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  259

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA+ IYNSVKS  NISPD
Sbjct  260  SGFILTDPKDFAARIYNSVKSGLNISPD  287



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTL+DA+KQAYMRGKRVLEINPRHPIIKELRERVVK PED S K+TA LIY+TA ME
Sbjct  691  MQSQTLTDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDASVKQTAHLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVKSS NISPDA
Sbjct  751  SGFMLSDPKDFASRIYSSVKSSLNISPDA  779



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK  EDES K TAQLIY+TA ME
Sbjct  691  MQSQTLSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKLTAQLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPKDFAS IY+SVKSS NI+P
Sbjct  751  SGFNLPDPKDFASRIYSSVKSSLNINP  777



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERV   PE+ES KETA+L+Y+TA +E
Sbjct  693  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELKERVASDPEEESAKETAKLMYQTALLE  752

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF + DPKDFAS IYNSVK+S NISPDAV
Sbjct  753  SGFILQDPKDFASRIYNSVKTSLNISPDAV  782



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  EDES K+TA+L+Y+TA ME
Sbjct  692  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDAEDESVKQTARLMYQTALME  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPK+FAS IY+SVKSS  ISPDA V
Sbjct  752  SGFMLNDPKEFASSIYDSVKSSLKISPDATV  782



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K+TAQL+Y+TA +E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFAS IY+SVKSS N+SP
Sbjct  751  SGFLLNDPKDFASRIYSSVKSSLNVSP  777



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K+TAQL+Y+TA +E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFAS IY+SVKSS N+SP
Sbjct  751  SGFLLNDPKDFASRIYSSVKSSLNVSP  777



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA KQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K+TAQL+Y+TA  E
Sbjct  691  MQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKQTAQLMYQTALFE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISPDA
Sbjct  751  SGFLLNDPKDFASRIYDSVKTSLDISPDA  779



>gb|KDO84885.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=679

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PED   ++TAQLIY+TA ME
Sbjct  554  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALME  613

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF++ DPKDFAS IY++VKSS NISP
Sbjct  614  SGFSLNDPKDFASRIYSTVKSSLNISP  640



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV + PEDES K+TA+LIY+TA ME
Sbjct  688  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPEDESMKQTARLIYQTALME  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+ DPK+FAS IY SV  S +ISP A+V
Sbjct  748  SGFNLNDPKEFASSIYKSVHKSLDISPGAIV  778



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RVVK  EDES K+TAQLIY+TA ME
Sbjct  691  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVVKDSEDESVKQTAQLIYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DP+DFAS IY+SVK+S  ISPDA V
Sbjct  751  SGFMLSDPQDFASRIYSSVKNSLKISPDATV  781



>gb|ACN26939.1| unknown [Zea mays]
Length=123

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  5    MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  64

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+   ++SPDA V
Sbjct  65   SGFNLPDPKEFASSIYKSVQKGLDLSPDATV  95



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K+TAQL+Y+TA  E
Sbjct  692  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKQTAQLMYQTALFE  751

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDF S IY+SVK+S +ISP+A V
Sbjct  752  SGFLLDDPKDFTSRIYDSVKTSLDISPEATV  782



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQ YMRGKRVLEINPRHPIIKELRERVV  PEDES K+TA+L+Y+TA ME
Sbjct  686  MQSQTLSDASKQGYMRGKRVLEINPRHPIIKELRERVVNDPEDESVKQTARLMYQTALME  745

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVK+S  ISPDA V
Sbjct  746  SGFMLNDPKDFASRIYDSVKASLKISPDASV  776



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PED   ++TAQLIY+TA ME
Sbjct  693  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALME  752

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF++ DPKDFAS IY++VKSS NISP
Sbjct  753  SGFSLNDPKDFASRIYSTVKSSLNISP  779



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PED   ++TAQLIY+TA ME
Sbjct  695  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALME  754

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF++ DPKDFAS IY++VKSS NISP
Sbjct  755  SGFSLNDPKDFASRIYSTVKSSLNISP  781



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PED   ++TAQLIY+TA ME
Sbjct  697  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALME  756

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF++ DPKDFAS IY++VKSS NISP
Sbjct  757  SGFSLNDPKDFASRIYSTVKSSLNISP  783



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  751  SGFLLDDPKDFASRIYDSVKTSLDISPEA  779



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  690  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFE  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  750  SGFLLDDPKDFASRIYDSVKTSLDISPEA  778



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV + P+DES K+TAQLIY+TA ME
Sbjct  693  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPKDESVKQTAQLIYQTALME  752

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPK+FAS IY SV+ S +ISPDA V
Sbjct  753  SGFILNDPKEFASSIYKSVQKSLDISPDATV  783



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR+RV K PEDES ++TAQL+Y+TA +E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDRVAKDPEDESVEQTAQLMYQTALLE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFAS IY+SVKSS N+SPD
Sbjct  751  SGFLLNDPKDFASRIYSSVKSSLNVSPD  778



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  751  SGFLLNDPKDFASRIYDSVKTSLDISPEA  779



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  690  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFE  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  750  SGFLLNDPKDFASRIYDSVKTSLDISPEA  778



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSD+SKQAYMRGKRVLEINPRHPIIKELRERVVK PE ES K+TA L+Y+TA ME
Sbjct  690  MQSQTLSDSSKQAYMRGKRVLEINPRHPIIKELRERVVKDPEGESVKQTAHLMYQTALME  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFAS IY+SVKSS +ISPD
Sbjct  750  SGFMLNDPKDFASRIYDSVKSSLHISPD  777



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQ+LSD  KQAYMRGKRVLEINPRHPIIKELRERVVK PED S K+TA+LIY+T+ ME
Sbjct  687  MQSQSLSDHRKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDNSVKQTARLIYQTSLME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVK+S NISPDA V
Sbjct  747  SGFMLDDPKDFASRIYDSVKTSLNISPDASV  777



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  690  MQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFE  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  750  SGFLLDDPKDFASRIYDSVKTSLDISPEA  778



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK PEDE  K TAQL+Y+TA  E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVK+S +ISP+A
Sbjct  751  SGFLLDDPKDFASRIYDSVKTSLDISPEA  779



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQ YMRGKRVLEINPRHPIIKELRERVVK PEDES K TAQL+Y+TA ME
Sbjct  695  MQSQTLSDANKQGYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKNTAQLMYQTALME  754

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFAS I++SVKS  NISP
Sbjct  755  SGFTLSDPKDFASRIHDSVKSGLNISP  781



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVK  EDE  K+TAQL+Y+TA ME
Sbjct  687  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPK FAS IY+SVKSS NISPD
Sbjct  747  SGFLLSDPKHFASNIYDSVKSSLNISPD  774



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYM GKRVLEINPRHPIIKELRERV + P+DES K+TA+LIY+TA ME
Sbjct  693  MQSQTLSDASKQAYMHGKRVLEINPRHPIIKELRERVAQDPKDESVKQTARLIYQTALME  752

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPK+FAS IYNSV+ S +ISPDA V
Sbjct  753  SGFILNDPKEFASSIYNSVQKSLDISPDATV  783



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV   P+DE+ KETA+L+Y+TA ME
Sbjct  691  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENVKETAKLMYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + +PK+FAS IYNSVKSS  ISPDA V
Sbjct  751  SGFMLSEPKEFASSIYNSVKSSLKISPDATV  781



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV   P+DE+ K+TA+LIY+TA ME
Sbjct  688  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENIKQTAKLIYQTALME  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPK+FA+ IY+SVKSS NISPDA
Sbjct  748  SGFLMNDPKEFATSIYSSVKSSLNISPDA  776



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIK+LRER+VK PEDE  K+ A+L+Y+TA +E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKDLRERIVKDPEDEGAKQAAKLMYQTALLE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFAS IY++VK+S NISPD
Sbjct  751  SGFILSDPKDFASQIYDTVKTSLNISPD  778



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA+ IYNSVKS  NISPD
Sbjct  748  SGFILTDPKDFAARIYNSVKSGLNISPD  775



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA+ IYNSVKS  NISPD
Sbjct  748  SGFILTDPKDFAARIYNSVKSGLNISPD  775



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV   PEDES KETAQL+Y+TA +E
Sbjct  657  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIE  716

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA  IYNSVKSS  ISPD
Sbjct  717  SGFVLNDPKDFAGRIYNSVKSSLKISPD  744



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA KQ+YMRGKRVLEIN RHPIIKELRERVVK PEDES K+TAQL+Y+TA +E
Sbjct  688  MQSQTLSDARKQSYMRGKRVLEINARHPIIKELRERVVKDPEDESVKQTAQLMYQTALLE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF + DPKDFAS IY+SVK+S  ISPDA 
Sbjct  748  SGFILNDPKDFASRIYSSVKNSLRISPDAT  777



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA  IYNSVKSS  ISPD
Sbjct  748  SGFILNDPKDFAGRIYNSVKSSLKISPD  775



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA  IYNSVKSS  ISPD
Sbjct  748  SGFILNDPKDFAGRIYNSVKSSLKISPD  775



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA  IYNSVKSS  ISPD
Sbjct  748  SGFILNDPKDFAGRIYNSVKSSLKISPD  775



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPI+KELRERV + P+DES K+TA+LIY+TA ME
Sbjct  709  MQSQTLSDASKQAYMRGKRVLEINPRHPIVKELRERVAQDPKDESVKQTARLIYQTALME  768

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPK+FAS IY SV+ S +ISPDA V
Sbjct  769  SGFILNDPKEFASSIYKSVQKSLDISPDATV  799



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV   PEDES KETAQL+Y+TA +E
Sbjct  684  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIE  743

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA  IYNSVKSS  ISPD
Sbjct  744  SGFVLNDPKDFAGRIYNSVKSSLKISPD  771



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599   MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
             MQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVK  EDE  K+TAQL+Y+TA ME
Sbjct  953   MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALME  1012

Query  419   SGFNVPDPKDFASGIYNSVKSSFNISPD  336
             SGF + DPK FAS IY+SVKSS NISPD
Sbjct  1013  SGFLLSDPKHFASNIYDSVKSSLNISPD  1040



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPI+K+LRER+VK PEDE  K+ A+L+Y+TA +E
Sbjct  691  MQSQTLSDASKQAYMRGKRVLEINPRHPIVKDLRERIVKDPEDEGAKQAAKLMYQTALLE  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFAS IY++VK+S NISPD
Sbjct  751  SGFILSDPKDFASQIYDTVKTSLNISPD  778



>gb|ABK24228.1| unknown [Picea sitchensis]
Length=466

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA++Q+YMRGKRVLEINPRHPIIKELRERV ++PEDE+ K+TA+LIY+TA ME
Sbjct  322  MQSQTLSDANRQSYMRGKRVLEINPRHPIIKELRERVTQSPEDENIKQTARLIYQTALME  381

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPK+FAS IY+++K++ N++PDA
Sbjct  382  SGFILNDPKEFASSIYSTIKTTLNVNPDA  410



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRER+   P+DES K+TA+L+Y+TA ME
Sbjct  689  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERIAANPQDESIKQTARLMYQTALME  748

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFA  IY+SVK+S +ISPDA
Sbjct  749  SGFLLNDPKDFAERIYSSVKASLDISPDA  777



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  688  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAEDNESESLKQTAKLVYQTALME  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGFN+PDPKDFAS IY SV+ S ++SPDA 
Sbjct  748  SGFNLPDPKDFASSIYKSVQKSLDLSPDAT  777



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  688  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGFN+PDPK+FAS IY SV+   ++SPDA VEE+D
Sbjct  748  SGFNLPDPKEFASSIYKSVQKGLDLSPDATVEEDD  782



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA+ IYNSVKS  NISP
Sbjct  748  SGFLLTDPKDFAARIYNSVKSGLNISP  774



>gb|ABK92622.1| unknown [Populus trichocarpa]
Length=214

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVK PED+S K+TA L+Y+TA ME
Sbjct  82   MQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALME  141

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS +ISPDA++
Sbjct  142  SGFILNDPKDFASRIYSSVKSSLSISPDAII  172



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA+ IYNSVKS  NISP
Sbjct  748  SGFILNDPKDFAARIYNSVKSGLNISP  774



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  687  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY SV+ S ++SPD
Sbjct  747  SGFNLPDPKDFASSIYRSVQKSLDLSPD  774



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  689  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALME  748

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY SV+ S ++SPD
Sbjct  749  SGFNLPDPKDFASSIYRSVQKSLDLSPD  776



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  714  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALME  773

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY SV+ S ++SPD
Sbjct  774  SGFNLPDPKDFASSIYRSVQKSLDLSPD  801



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  715  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALME  774

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY SV+ S ++SPD
Sbjct  775  SGFNLPDPKDFASSIYRSVQKSLDLSPD  802



>dbj|BAJ89816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  + E  K+TA+L+Y+TA ME
Sbjct  418  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALME  477

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY SV+ S ++SPDA
Sbjct  478  SGFNLPDPKDFASSIYRSVQKSLDLSPDA  506



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA+ IYNSVKS  NISP
Sbjct  748  SGFLLNDPKDFAARIYNSVKSGLNISP  774



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYM+GKRVLEINPRHPIIKELRERV+K PEDES K+TAQL+Y+TA ME
Sbjct  761  MQSQTLSDANKQAYMKGKRVLEINPRHPIIKELRERVLKDPEDESIKQTAQLVYQTALME  820

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPK FAS IY+SVK+S  ISP
Sbjct  821  SGFVLTDPKSFASQIYSSVKNSLEISP  847



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA+ IYNSVKSS +ISP
Sbjct  748  SGFILNDPKDFAARIYNSVKSSLSISP  774



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA+ IYNSVKSS +ISP
Sbjct  748  SGFILNDPKDFAARIYNSVKSSLSISP  774



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV   PED+  K+TA+L+Y+TA  E
Sbjct  690  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVATDPEDDGVKQTARLMYQTALFE  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEENDevekkaetsskkaEFNPENAKNGAD  240
            SGF + DPKDFAS +Y+SVK+S +I+PDA VEE D+ E+        +  N E     AD
Sbjct  750  SGFLLDDPKDFASRVYDSVKTSLSINPDAAVEEEDDTEEPEIEMKGDSSSNAE-----AD  804

Query  239  GIKDEL  222
             +KDEL
Sbjct  805  DVKDEL  810



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV    EDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDAEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DPKDFA+ IYNSVKSS  ISPD
Sbjct  748  SGFILNDPKDFAARIYNSVKSSLKISPD  775



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA KQAYMRGKRVLEIN RHPIIKEL++RV   PED S KETAQL+Y+TA +E
Sbjct  670  MQSQTLSDAKKQAYMRGKRVLEINLRHPIIKELKDRVASDPEDGSVKETAQLMYQTALIE  729

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF + DPKDFA  IYNSVKSS  ISPDAV
Sbjct  730  SGFILNDPKDFAGRIYNSVKSSLKISPDAV  759



>gb|AFK40768.1| unknown [Lotus japonicus]
Length=82

 Score =   132 bits (332),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PEDES K+TAQL+Y+TA  E
Sbjct  5    MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALFE  64

Query  419  SGFNVPDPKDFASGI  375
            SGF + DPKDFAS I
Sbjct  65   SGFLLNDPKDFASRI  79



>gb|AFW75769.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=429

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  311  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  370

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+   ++SPDA V
Sbjct  371  SGFNLPDPKEFASSIYKSVQKGLDLSPDATV  401



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K+TA+L+Y+TA ME
Sbjct  685  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDTESEGLKQTARLVYQTALME  744

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+ S ++SPDA V
Sbjct  745  SGFNLPDPKEFASSIYKSVQKSLDLSPDATV  775



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  + E  K+TA+L+Y+TA ME
Sbjct  685  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALME  744

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY SV+ S ++SPDA
Sbjct  745  SGFNLPDPKDFASSIYRSVQKSLDLSPDA  773



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  + E  K+TA+L+Y+TA ME
Sbjct  753  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALME  812

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY SV+ S ++SPDA
Sbjct  813  SGFNLPDPKDFASSIYRSVQKSLDLSPDA  841



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  685  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTARLVYQTALME  744

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY SV+ S ++S DA
Sbjct  745  SGFNLPDPKDFASSIYRSVQKSLDLSEDA  773



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  E ES K+TA+L+Y+TA ME
Sbjct  687  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFA  IY SV+ S ++SPD
Sbjct  747  SGFNLPDPKDFAFSIYRSVQKSLDLSPD  774



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  ED   K+TA+L+Y+TA ME
Sbjct  684  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDNEDVGLKQTARLVYQTALME  743

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGFN+PDPKDFAS IY SV+ S ++SPD
Sbjct  744  SGFNLPDPKDFASSIYRSVQKSLDLSPD  771



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +  + E  K+TA+L+Y+TA ME
Sbjct  694  MQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALME  753

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGFN+PDPKDFAS IY SV+ S ++SPDA
Sbjct  754  SGFNLPDPKDFASSIYRSVQKSLDLSPDA  782



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  686  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  745

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+ S ++SPDA V
Sbjct  746  SGFNLPDPKEFASSIYKSVQKSLDLSPDATV  776



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+   PEDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNIS  342
            SGF + DPKDFA+ IYNSVKSS  IS
Sbjct  748  SGFLLNDPKDFAARIYNSVKSSLKIS  773



>gb|AFW75768.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=667

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  549  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  608

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+   ++SPDA V
Sbjct  609  SGFNLPDPKEFASSIYKSVQKGLDLSPDATV  639



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV +  +DE  K TA+LIY+TA ME
Sbjct  690  MQSQTLSDATKQAYMRGKRVLEINPRHPIIKELRDRVAQDSKDEGLKHTARLIYQTALME  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF + DPKDFAS IY SV+ S +ISPDA 
Sbjct  750  SGFILNDPKDFASSIYKSVQKSLDISPDAT  779



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHP+IKELR+RV +  +DES K TA+LIY+TA ME
Sbjct  687  MQSQTLSDASKQAYMRGKRVLEINPRHPVIKELRDRVAQDSKDESLKHTARLIYQTALME  746

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF + DPK+FAS IY SV+ S +ISPDA 
Sbjct  747  SGFILNDPKEFASSIYKSVQKSLDISPDAT  776



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K TA+L+Y+TA ME
Sbjct  686  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALME  745

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGFN+PDPK+FAS IY SV+   ++SPDA V
Sbjct  746  SGFNLPDPKEFASSIYKSVQKGLDLSPDATV  776



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQA-YMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFM  423
            MQSQTLSD++KQ+ YMRGKRVLEINPRHPIIKELR+RV   PEDE  K+TAQL+Y+TA M
Sbjct  691  MQSQTLSDSNKQSSYMRGKRVLEINPRHPIIKELRDRVALNPEDEGVKQTAQLMYQTALM  750

Query  422  ESGFNVPDPKDFASGIYNSVKSSFNISPD  336
            ESGF + DPKDFAS IY SVK+S NISPD
Sbjct  751  ESGFVLNDPKDFASRIYGSVKNSLNISPD  779



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA KQAYMRGKRVLEINPRHPIIKEL++RV    ED+S KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELKDRVASDQEDKSVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGF + DPKDFA  IYNSVKSS  ISP
Sbjct  748  SGFILNDPKDFAGRIYNSVKSSLKISP  774



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA++Q+YMRGKRVLEINP+HPIIKELRERV + PE+E+ K+TA+LIY+TA ME
Sbjct  690  MQSQTLSDANRQSYMRGKRVLEINPKHPIIKELRERVTQNPEEENIKQTARLIYQTALME  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPK+FA+ IY+++K++ N++PDA
Sbjct  750  SGFILNDPKEFATSIYSTIKTTLNVNPDA  778



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVK PED+S K+TA L+Y+TA ME
Sbjct  691  MQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS +ISPDA++
Sbjct  751  SGFILNDPKDFASRIYSSVKSSLSISPDAII  781



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+    EDES KETAQL+Y+TA +E
Sbjct  688  MQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDSEDESVKETAQLMYQTALIE  747

Query  419  SGFNVPDPKDFASGIYNSVKSSFNIS  342
            SGF + DPKDFA+ IYNSVKS   IS
Sbjct  748  SGFVLNDPKDFAARIYNSVKSGLKIS  773



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K+TA+L+Y+TA ME
Sbjct  597  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALME  656

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPK+FAS IY SV  S ++SP
Sbjct  657  SGFNLPDPKEFASSIYKSVHKSLDLSP  683



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K+TA+L+Y+TA ME
Sbjct  686  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALME  745

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPK+FAS IY SV  S ++SP
Sbjct  746  SGFNLPDPKEFASSIYKSVHKSLDLSP  772



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVK PED+S K+TA L+Y+TA ME
Sbjct  691  MQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALME  750

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DPKDFAS IY+SVKSS +ISPDA +
Sbjct  751  SGFILNDPKDFASRIYSSVKSSLSISPDASI  781



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +  E E  K+TA+L+Y+TA ME
Sbjct  879  MQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALME  938

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP  339
            SGFN+PDPK+FAS IY SV  S ++SP
Sbjct  939  SGFNLPDPKEFASSIYKSVHKSLDLSP  965



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 8/89 (9%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQSQTLSDASKQAYMRGKRVLEINPRHPII  +        +DES K+TAQL+Y+TA ME
Sbjct  690  MQSQTLSDASKQAYMRGKRVLEINPRHPIIFLV--------QDESVKQTAQLMYQTALME  741

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFAS IY+SVKSS NISPDA
Sbjct  742  SGFLLNDPKDFASRIYSSVKSSLNISPDA  770



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDES K T +LIYKTA ++
Sbjct  710  MRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALID  769

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF V D K+FAS IY+ +KS+ NISPDA  +E
Sbjct  770  SGFLVDDSKEFASQIYSIIKSNLNISPDAQFDE  802



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDES K T +LIYKTA ++
Sbjct  710  MRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALID  769

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF V D K+FAS IY+ +KS+ NISPDA  +E
Sbjct  770  SGFLVDDSKEFASQIYSIIKSNLNISPDAQFDE  802



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            MQ+QTL+D SKQ+YMRGKR+LEINP+HPIIK+L+E++  + ED+S K+ A+L+++TA +E
Sbjct  695  MQAQTLADPSKQSYMRGKRILEINPKHPIIKDLKEKISLSSEDDSAKQAAKLVFETALLE  754

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF + DPKDFA+ IY+ +KS+ N+SPDA
Sbjct  755  SGFVLEDPKDFANRIYSVIKSNLNVSPDA  783



>gb|ABY26951.1| endoplasmic heat shock protein 90 [Capsicum annuum]
Length=82

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  530  NPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFMESGFNVPDPKDFASGIYNSVKSSF  351
            NPRHPIIK L E+VV  PEDES K TA+LIY+TA MESGF + DPK+FAS IY+SVKSS 
Sbjct  1    NPRHPIIKGLLEKVVTDPEDESVKLTAKLIYQTALMESGFELSDPKNFASQIYSSVKSSL  60

Query  350  NISPDA  333
            NISPDA
Sbjct  61   NISPDA  66



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q LSD  + AYMRG++ LEINP HPIIK L+E+      DE  K TA ++Y+TA +E
Sbjct  666  MKAQALSDDGRMAYMRGRKTLEINPGHPIIKALKEKSEDDAGDEDTKRTALIMYETALLE  725

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF   +PK FA  +++ V+    +  DA VEE D
Sbjct  726  SGFMFEEPKGFAGRLFDMVRRDLGVEADAEVEEPD  760



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q LSD S+ +YM+GK+ LEINPRHPIIK L+ER     +DE  K  A+++++TA +E
Sbjct  690  MKAQALSDESRLSYMKGKKTLEINPRHPIIKALKERAADDADDEETKTLAKVMFETAMLE  749

Query  419  SGFNVPDPKDFASGIYNSVKSSFNIS  342
            SGF   +P  FAS +++ V+S+  +S
Sbjct  750  SGFTFEEPAGFASRLFDMVRSNMGVS  775



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q + D S+  YMRGK+ LE+NPRHP+I  L+ER    P+ E  +  A+L+++TA +E
Sbjct  671  MKAQAMGDESRHEYMRGKKTLEVNPRHPMIAALKERAATDPDSEETETLAKLMFETAMLE  730

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF+   P+++ S +++ +KS+  I  DA
Sbjct  731  SGFSFDKPQEYTSRVFDLLKSNMGIEKDA  759



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDE  468
            MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK PE E
Sbjct  693  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEVE  736



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q + D S+  YMRGK+ LEINPRHP+I  L+ER    P+    +  A+L+++TA +E
Sbjct  669  MKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLE  728

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF+   P D+A  +++ +K +  +  DA
Sbjct  729  SGFSFDKPGDYAGRVFDLLKMNMGVEKDA  757



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q + D S+  YMRGK+ LEINPRHP+I  L+ER    P+    +  A+L+++TA +E
Sbjct  668  MKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLE  727

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF+   P D+A  +++ +K +  +  DA
Sbjct  728  SGFSFDKPGDYAGRVFDLLKMNMGVEKDA  756



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -1

Query  593  SQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFMESG  414
            +Q L D SK + M+ KR+LEINPRHPII+ L ++V + P DE     A LIY+TA +ESG
Sbjct  636  AQALVDPSKVSQMKSKRILEINPRHPIIRMLLQKVTEDPADEVAHRVAVLIYETALLESG  695

Query  413  FNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            F + + K FA  I++ +K   ++ P+A V
Sbjct  696  FTLNNAKTFAEQIHSLMKLVLDVDPNAQV  724



>ref|XP_005842771.1| hypothetical protein CHLNCDRAFT_59468, partial [Chlorella variabilis]
 gb|EFN50654.1| hypothetical protein CHLNCDRAFT_59468 [Chlorella variabilis]
Length=325

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  596  QSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFMES  417
            +SQTL D+ +  +MRG+R LEINPRHP+I+EL+ + +  PE  S K+ AQL+Y+T  +ES
Sbjct  253  RSQTLGDSERAKWMRGQRTLEINPRHPLIRELKAQHIADPESASVKDNAQLLYQTCLLES  312

Query  416  GFNVPDPKDFAS  381
            G  + D K+F S
Sbjct  313  GCLLDDMKEFNS  324



>gb|ACO58576.1| heat shock protein 90 [Apis mellifera]
Length=149

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L DAS   YM  K+ LEINP HPI++ LR++      D+S K+   L+++TA + 
Sbjct  31   MKAQALRDASTMGYMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLS  90

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  ASGIY  +K       D
Sbjct  91   SGFALEDPQVHASGIYRMIKLGLGFDDD  118



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPE  474
            MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVK PE
Sbjct  686  MQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727



>gb|EWM29604.1| heat shock protein 90 [Nannochloropsis gaditana]
Length=713

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP+HPI+K LRE+      D++ K+   L+Y T+ + 
Sbjct  595  MKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLT  654

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGF++ DP  FAS I+  +K   +I  D   EE 
Sbjct  655  SGFSLDDPNTFASRIHRLIKLGLSIDEDVEEEEG  688



>emb|CAU15484.1| heat shock protein 90 [Meloidogyne artiellia]
Length=723

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H IIK LRERV    +D++ K+   L+Y+TA + 
Sbjct  603  MKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRERVDSDQDDKTAKDLVVLLYETALLT  662

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF++ DP+  AS IY  VK   +I+ + V
Sbjct  663  SGFSLEDPQQHASRIYRMVKLGLDITEEDV  692



>emb|CAG01829.1| unnamed protein product [Tetraodon nigroviridis]
Length=212

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D+S   YM  K+ LEINP HPII+ LRE+      D++ K+   L+Y+TA + 
Sbjct  94   MKSQALRDSSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLYETALLS  153

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  A+ IY  +K    I  D
Sbjct  154  SGFTLEDPQTHANRIYRMIKLGLGIDDD  181



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D + ++YM+G + LEINPRHP++ EL+ +  +  E +     A+L++ TA +E
Sbjct  654  MKSQALGDTADRSYMKGMKTLEINPRHPLVLELKRQFEEDKESDKAAAYARLLWDTALLE  713

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF +  PK+F S IY  +  ++NI  D
Sbjct  714  SGFEIEAPKEFNSRIYGLLAQAYNIQGD  741



>gb|AAA30132.1| heat shock protein 90 [Theileria parva]
 prf||2106315A heat shock protein 90kD
Length=721

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINPRH I+KEL+ R      D++ K+   L+Y TA + 
Sbjct  609  MKAQALRDSSITSYMLSKKIMEINPRHSIMKELKTRAANDKTDKTVKDLVWLLYDTALLT  668

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGFN+ +P  F + IY  +K   ++  +  VEE+
Sbjct  669  SGFNLDEPTQFGNRIYRMIKLGLSLDDEEHVEED  702



>ref|XP_764810.1| heat shock protein 90 [Theileria parva strain Muguga]
 sp|P24724.2|HSP90_THEPA RecName: Full=Heat shock protein 90; Short=HSP90 [Theileria parva]
 gb|EAN32527.1| heat shock protein 90 [Theileria parva]
Length=721

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINPRH I+KEL+ R      D++ K+   L+Y TA + 
Sbjct  609  MKAQALRDSSITSYMLSKKIMEINPRHSIMKELKTRAANDKTDKTVKDLVWLLYDTALLT  668

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGFN+ +P  F + IY  +K   ++  +  VEE+
Sbjct  669  SGFNLDEPTQFGNRIYRMIKLGLSLDDEEHVEED  702



>gb|ADD10372.1| heat shock protein 90 [Meloidogyne incognita]
Length=708

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H IIK LRER+    +D++ K+   L+Y+TA + 
Sbjct  588  MKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRERIDSDQDDKTAKDLVVLLYETALLT  647

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  VK   +I+ +
Sbjct  648  SGFSLEDPQQHASRIYRMVKLGLDITEE  675



>gb|ACR57215.1| Hsp90 [Heterodera glycines]
Length=721

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H IIK LR+RV K  +D++ K+   L+Y+T+ + 
Sbjct  600  MKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEKEQDDKTAKDLVVLLYETSLLT  659

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  VK   +I PD
Sbjct  660  SGFSLEDPQQHASRIYRMVKLGLDI-PD  686



>gb|AAO14563.2|AF461150_1 Hsp90 [Heterodera glycines]
Length=721

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H IIK LR+RV K  +D++ K+   L+Y+T+ + 
Sbjct  600  MRAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEKEQDDKTAKDLVVLLYETSLLT  659

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  VK   +I PD
Sbjct  660  SGFSLEDPQQHASRIYRMVKLGLDI-PD  686



>ref|XP_009606992.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=83

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  476  EDESPKETAQLIYKTAFMESGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            +DES K+TAQL+Y+TA +ESGF + DPKDFAS IY+SVKSS N+SPDA V
Sbjct  4    QDESVKQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSPDATV  53



>ref|XP_952473.1| heat shock protein 90 [Theileria annulata strain Ankara]
 sp|Q4UDU8.1|HSP90_THEAN RecName: Full=Heat shock protein 90; Short=HSP90 [Theileria annulata]
 emb|CAI74741.1| heat shock protein 90, putative [Theileria annulata]
Length=722

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINPRH I+KEL+ R      D++ K+   L+Y TA + 
Sbjct  610  MKAQALRDSSITSYMLSKKIMEINPRHSIMKELKARAANDKTDKTVKDLVWLLYDTALLT  669

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGFN+ +P  F + IY  +K   ++  +  VE++
Sbjct  670  SGFNLDEPTQFGNRIYRMIKLGLSLDDEEHVEDD  703



>ref|XP_006220022.1| PREDICTED: heat shock protein 90-like, partial [Vicugna pacos]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  71   MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  130

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + +P+  AS IY  +K   +I  D
Sbjct  131  SGFTLEEPQSHASRIYRMIKLGLDIGDD  158



>ref|XP_005538149.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAC67671.2| heat shock 90kD protein [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82113.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
Length=706

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D++   YM  K+++E+NP +PII+ELR+RV   P D++ K+   L+Y TA + 
Sbjct  588  MKAQALRDSTMSMYMSAKKIMEVNPSNPIIRELRDRVEADPSDKTVKDLVNLLYDTALLA  647

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P  F+S I+  +K   +I  D
Sbjct  648  SGFSLDEPNTFSSRIHRMIKLGLSIDED  675



>ref|XP_010928209.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  19   MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKNDKSVKDLVLLLFETALLT  78

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ DP  F + I+  +K   +I  D  V+
Sbjct  79   SGFSLDDPNTFGNRIHRMLKLGLSIDEDETVD  110



>gb|ACR57216.1| Hsp90 [Heterodera glycines]
Length=721

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H IIK LR+RV K   D++ K+   L+Y+T+ + 
Sbjct  600  MKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEKEQNDKTAKDLVVLLYETSLLT  659

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  VK   +I PD
Sbjct  660  SGFSLEDPQQHASRIYRMVKLGLDI-PD  686



>ref|XP_005855339.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
 gb|EKU21014.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
Length=712

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP+HPI+K LRE+      D++ K+   L+Y T+ + 
Sbjct  595  MKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLT  654

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF++ DP  FAS I+  +K   +I
Sbjct  655  SGFSLDDPNTFASRIHRLIKLGLSI  679



>gb|ADZ13510.1| HSP90-1 [Ditylenchus destructor]
Length=719

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV K  +D++ K+   L+++TA + 
Sbjct  599  MKAQALRDSSTMGYMASKKNLEINPDHSIMKTLRERVEKDQDDKTAKDLVVLLFETALLT  658

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P+  AS I+  +K   +IS D
Sbjct  659  SGFSLEEPQSHASRIFRMIKLGLDISDD  686



>ref|XP_001740319.1| heat shock protein [Entamoeba dispar SAW760]
 gb|EDR23250.1| heat shock protein, putative [Entamoeba dispar SAW760]
Length=207

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP HPI++ELR+RV     D++ K+   L+++TA + 
Sbjct  94   MKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHTDNSDKTVKDLVVLLFETALLS  153

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF++ +P  FA  IY  VK   ++
Sbjct  154  SGFSLDEPAAFAGRIYRMVKLGLSL  178



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  62   MKAQALRDNNMSAYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLT  121

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ DP  FA  I+  +K   NI  D   E+
Sbjct  122  SGFSLEDPNTFAGRIHRMLKLGLNIDEDETAED  154



>ref|XP_007515443.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14322.1| predicted protein [Bathycoccus prasinos]
Length=802

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q + DA  Q YM+GK+ LEINP  P+IK+L+ RV  AP+ E  KE  +L++ TA + 
Sbjct  704  MKAQAMGDARAQDYMKGKKTLEINPFSPVIKQLKMRVESAPDAEETKEMCKLLFDTALLT  763

Query  419  SGFNVPDPKDFASGIYN---------SVKSSFNISPDAV  330
            SGF++  P +FA  ++          S K S +I P+ V
Sbjct  764  SGFSIDQPAEFAERVFKLMTQEANLESEKKSASIDPEVV  802



>emb|CDP96098.1| Protein BM-DAF-21, isoform a [Brugia malayi]
Length=717

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  596  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  655

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  656  SGFSLEDPQLHASRIYRMIKLGLDITED  683



>sp|O61998.2|HSP90_BRUPA RecName: Full=Heat shock protein 90 [Brugia pahangi]
 emb|CAA06695.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  596  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  655

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  656  SGFSLEDPQLHASRIYRMIKLGLDITED  683



>gb|EJW88125.1| heat shock protein 90 [Wuchereria bancrofti]
Length=717

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  596  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  655

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  656  SGFSLEDPQLHASRIYRMIKLGLDITED  683



>ref|XP_005843734.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
 gb|EFN51632.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
Length=574

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ + DA    YMRG+R++E+NP+HPII+ L+ +V    E    KE  QL+Y+ A + 
Sbjct  454  MRSQAMGDARSAEYMRGRRIMELNPQHPIIRTLKSKV--ELESREAKEQVQLLYEAALLA  511

Query  419  SGFNVPDPKDFASGIYN  369
             GF +  PKDFA+ IY+
Sbjct  512  GGFMIESPKDFAARIYS  528



>emb|CAA06694.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  596  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  655

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  656  SGFSLEDPQLHASRIYRMIKLGLDITED  683



>gb|AIL52741.1| heat shock protein 90 [Phenacoccus solenopsis]
Length=724

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP HPII+ LR++      D++ K+   L+++TA + 
Sbjct  605  MKAQALRDSSTMGYMAAKKHMEINPDHPIIETLRQKAEADKNDKAVKDLVILLFETALLS  664

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISP-DAVVEEND  315
            SGFN+ DP+  A+ IY  +K    I   DAV++E+D
Sbjct  665  SGFNLEDPQVHATRIYRMIKLGLGIDEDDAVMQEDD  700



>ref|XP_001901767.1| heat shock protein 90 [Brugia malayi]
Length=699

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  578  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  637

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  638  SGFSLEDPQLHASRIYRMIKLGLDITED  665



>ref|XP_003135662.1| heat shock protein 90 [Loa loa]
Length=700

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  579  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  638

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  639  SGFSLEDPQLHASRIYRMIKLGLDITED  666



>gb|ACO55133.1| heat shock protein 90 [Litomosoides sigmodontis]
Length=718

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  597  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  656

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ D
Sbjct  657  SGFSLDDPQLHASRIYRMIKLGLDITED  684



>ref|XP_005911315.1| PREDICTED: heat shock protein HSP 90-alpha-like, partial [Bos 
mutus]
Length=164

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D SK  YM  K+ LEINP H II+ LR++      D+S K+   L+Y TA + 
Sbjct  46   MKAQALRDNSKMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYDTALLS  105

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+ IY  +K    I  D
Sbjct  106  SGFSLEDPQTHANRIYRMIKLGLGIDED  133



>ref|XP_006678605.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80649.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
Length=586

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L DAS Q+YM GK+ LE+NP + I+K L+ +V +   D++ K+  QL+Y+TA + 
Sbjct  473  MKAQALRDASMQSYMLGKKTLELNPDNAIVKALKVKVDEDKNDKTVKDLTQLLYETALLS  532

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF++ +P  FA  I+  +K   +I  D ++
Sbjct  533  SGFSLEEPSSFAGRIHRMIKLGLSIDEDEIL  563



>ref|XP_009690258.1| heat shock protein 90 [Theileria orientalis strain Shintoku]
 dbj|BAM39957.1| heat shock protein 90 [Theileria orientalis strain Shintoku]
Length=668

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINPRH I+KEL+ R      D++ K+   L+Y TA + 
Sbjct  558  MKAQALRDSSITSYMLSKKIMEINPRHSIMKELKNRAATDKTDKTVKDLVWLLYDTALLT  617

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGFN+ +P  F + IY  +K   ++  +   EE
Sbjct  618  SGFNLDEPTQFGNRIYRMIKLGLSLDDEEQHEE  650



>gb|EMT27103.1| Heat shock protein 83 [Aegilops tauschii]
Length=679

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  565  MKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLT  624

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  +K   NI   A  EE D
Sbjct  625  SGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEED  659



>emb|CDS03201.1| Putative Heat shock protein 90-1 [Absidia idahoensis var. thermophila]
Length=701

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  AYM  K+  E+NP+H IIK L+E+V     D + K+   L+++TA + 
Sbjct  587  MKAQALRDNSMSAYMASKKTFELNPKHAIIKTLKEKVAADASDRTVKDLTTLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ +P  FAS I+  V    +I  D V+E+
Sbjct  647  SGFSLDEPATFASRIHRMVALGLSIDEDEVLED  679



>gb|ADF31756.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31765.1| heat shock protein 90 [Triticum aestivum]
Length=713

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  599  MKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLT  658

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  +K   NI   A  EE D
Sbjct  659  SGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEED  693



>gb|ADF31775.1| heat shock protein 90 [Aegilops tauschii]
Length=713

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  599  MKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLT  658

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  +K   NI   A  EE D
Sbjct  659  SGFSLDDPNTFAARIHRMLKLGLNIDDQADAEEED  693



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  587  MKAQALRDSSMAGYMSSKKTLEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  F + I+  +K   +I  D  VE+ D
Sbjct  647  SGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTD  681



>emb|CDS03376.1| Putative Heat shock protein 90-1 [Absidia idahoensis var. thermophila]
Length=700

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  AYM  K+  E+NP+H IIK L+E+V     D + K+   L+++TA + 
Sbjct  587  MKAQALRDNSMSAYMASKKTFELNPQHAIIKTLKEKVAADASDRTVKDLTTLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ +P  FA+ I+  V    +I  D VVE+
Sbjct  647  SGFSLDEPATFATRIHRMVALGLSIDEDEVVED  679



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  599   MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
             M++Q LSD S+  YM+GK+ LEIN +HP++  L+E+     EDE+ K  A ++++TA +E
Sbjct  1092  MRAQALSDDSRAQYMKGKKTLEINYKHPLVAALKEKYEADGEDETSKNLAVVMFETALIE  1151

Query  419   SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
             SGF + D K  AS +++ +K    +  DA
Sbjct  1152  SGFVIDDSKSMASRVFDLLKDKMGVEKDA  1180



>dbj|BAN64175.1| hsp90 protein [Babesia bovis]
Length=205

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  ++M  K+ +E+NP H I+KELR+R      D++ K+   L+Y TA + 
Sbjct  94   MKAQALRDSSFGSFMISKKTMELNPHHSIMKELRQRAETDKSDKTLKDLVWLLYDTAMLT  153

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGFN+ DP  F   IY  +K   ++  +   E+ D
Sbjct  154  SGFNLDDPTQFGGRIYRMIKLGLSLDDEPTGEDVD  188



>emb|CDJ91963.1| ATP-binding region and Heat shock protein Hsp90 domain containing 
protein, partial [Haemonchus contortus]
Length=732

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = -1

Query  599  MQSQTLS---DASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTA  429
            M+SQ  +   D S+  Y   K+  EINPRHP++KEL  RV++  ED+  K+TA L+++TA
Sbjct  602  MKSQAYAKAKDPSQDFYANQKKTFEINPRHPVVKELLRRVIEDKEDQKAKDTALLLFETA  661

Query  428  FMESGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
             + SGF++ D   FA  I + ++ S N++ DA VE
Sbjct  662  TLRSGFSLKDQVGFAERIESVLRQSLNVAADAEVE  696



>emb|CDH60666.1| heat shock protein 90 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=688

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D++  +YM  K+ LE+NP H IIK L+++  +   D + K+  QL+Y+TA + 
Sbjct  571  MKAQALRDSTMSSYMASKKTLELNPNHGIIKALKQKFSEDSSDRTVKDLTQLLYETALLT  630

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP +FA  IY  V    +I  D    E D
Sbjct  631  SGFSLDDPSNFAYRIYRMVALGLSIDEDDTTMEED  665



>emb|CDH57487.1| heat shock protein 90 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=700

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  AYM  K+  E+NP+H IIK L+E+V     D + K+   L+++TA + 
Sbjct  587  MKAQALRDNSMSAYMASKKTFELNPQHAIIKTLKEKVAADASDRTVKDLTTLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ +P  FA+ I+  V    +I  D VVE+
Sbjct  647  SGFSLDEPATFATRIHRMVALGLSIDEDEVVED  679



>gb|EKF32566.1| heat shock protein 85, putative, partial [Trypanosoma cruzi marinkellei]
Length=323

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV     D++ K+   L++ TA + 
Sbjct  208  MRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLT  267

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + DP  +A  I+  +K   ++
Sbjct  268  SGFTLDDPTSYAERIHRMIKLGLSL  292


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV     D++ K+   L++ TA + 
Sbjct  64   MRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLT  123

Query  419  SGFNVPDPKDFASGIYNSVK  360
            SGF + DP  +A  I+  +K
Sbjct  124  SGFTLDDPTSYAERIHRMIK  143



>dbj|BAK08743.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++QTL D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQTLRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>gb|KHJ75602.1| Hsp90 protein [Oesophagostomum dentatum]
Length=212

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  94   MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  153

Query  419  SGFNVPDPKDFASGIYNSVKSSFNIS  342
            SGF++ +P+  AS IY  +K   +I 
Sbjct  154  SGFSLEEPQSHASRIYRMIKLGLDIG  179



>gb|EXX78198.1| Hsp90 family chaperone HSC82 [Rhizophagus irregularis DAOM 197198w]
Length=359

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINP HPI+K L+ +V     D++ K+   L+++T+ ++
Sbjct  244  MKAQALRDSSMASYMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQ  303

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + +P  FA  I+  +K   +I  D
Sbjct  304  SGFTLEEPSSFAGRIFKMIKLGLDIGGD  331



>gb|ABA06421.1| 83 kDa heat shock protein [Leishmania chagasi]
Length=127

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +E+NPRHPIIKELR RV     D++ K+   L++ T+ + 
Sbjct  13   MRNQALRDSSMAQYMMSKKTMELNPRHPIIKELRRRVEADENDKAVKDLVFLLFDTSLLT  72

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + DP  +A  I   +K   ++
Sbjct  73   SGFQLEDPTGYAERINRMIKLGLSL  97



>gb|KGG50896.1| molecular chaperone HtpG [Microsporidia sp. UGP3]
Length=715

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L ++S   YM  K+ LE+NPRHPI++ L+E+      D++ K+   L+++T+ + 
Sbjct  599  MKAQALRESSMSTYMASKKTLELNPRHPIVRSLKEKFEADKNDKTIKDLTFLLFETSLLS  658

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD--AVVEEN  318
            SGF++ DP  +A+ I+  +K   NI+ D  +VVE+N
Sbjct  659  SGFSIEDPSAYATRIHRIIKFGLNINEDDVSVVEDN  694



>ref|XP_010928210.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  19   MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKNDKSVKDLVLLLFETALLT  78

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ +P  F + I+  +K   +I  D  V+
Sbjct  79   SGFSLDEPNTFGNRIHRMLKLGLSIDEDETVD  110



>gb|ADM83426.1| heat shock protein 90 [Panonychus citri]
Length=730

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +   YM  K+ LEINP HPI++ LR+R+     D++ K+   L+++TA + 
Sbjct  610  MKAQALRDTTTMGYMAAKKHLEINPDHPIVENLRQRIEADKSDKAVKDLVMLLFETALLC  669

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF++ DP++ +S IY  +K    I  D V
Sbjct  670  SGFSLEDPQNHSSRIYRMIKLGLGIDEDLV  699



>ref|NP_571403.1| heat shock protein HSP 90-alpha 1 [Danio rerio]
 gb|AAC21567.1| heat shock protein hsp90alpha [Danio rerio]
Length=726

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  608  MKSQALRDNSTMGYMTAKKHLEINPAHPIVETLREKAEAEKNDKAVKDLVILLFETALLS  667

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+VVEE
Sbjct  668  SGFTLDDPQTHANRIYRMIKLGLGIDDDDSVVEE  701



>gb|AFZ62631.1| HSP90-1 [Ditylenchus destructor]
Length=719

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV    +D++ K+   L+++TA + 
Sbjct  599  MKAQALRDSSTMGYMASKKNLEINPDHSIMKTLRERVENDQDDKTAKDLVVLLFETALLT  658

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P+  AS I+  +K   +IS D
Sbjct  659  SGFSLEEPQSHASRIFRMIKLGLDISDD  686



>gb|AAN77149.1| fiber protein Fb9 [Gossypium barbadense]
Length=176

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  62   MKAQALRDNSMAGYMSSKKTMEINPDNPIMEELRKRADADKNDKSVKDLVLLLFETALLT  121

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  F + I+  +K   +I  DA   E D
Sbjct  122  SGFSLDDPNTFGNRIHRMLKLGLSIDEDAGEAEAD  156



>ref|XP_003102316.1| CRE-DAF-21 protein [Caenorhabditis remanei]
 gb|EFP05935.1| CRE-DAF-21 protein [Caenorhabditis remanei]
Length=702

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  584  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVETDKNDKTVKDLVVLLFETALLS  643

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ +P+  AS IY  +K   +I  D + E
Sbjct  644  SGFSLEEPQSHASRIYRMIKLGLDIGDDDIEE  675



>dbj|BAE90429.1| unnamed protein product [Macaca fascicularis]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP H II+ LR++      D+S K+   L+Y+TA + 
Sbjct  1    MKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLS  60

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+ IY  +K    I  D
Sbjct  61   SGFSLEDPQTHANRIYRMIKLGLGIDED  88



>gb|KDE07091.1| heat shock protein 90-1 [Microbotryum violaceum p1A1 Lamole]
Length=707

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L DAS  +YM+ K+ LEINP + I+KELR +V +   D++ ++   L+Y+TA + 
Sbjct  588  MKAQALRDASMSSYMQSKKTLEINPHNAIVKELRSKVQEDAADKTVRDLVTLLYETALLT  647

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD---AVVEEN  318
            SGF +  P DFA+ I+  +    +I  D   A VEE+
Sbjct  648  SGFTLDAPTDFAARIHRMISLGLSIDEDEEPAAVEES  684



>dbj|BAJ85535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  602  MKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLT  661

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  ++   NI   A  EE D
Sbjct  662  SGFSLDDPNTFAARIHRMLRLGLNIDDQADAEEED  696



>gb|AAH75757.1| Hsp90a.1 protein [Danio rerio]
Length=725

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  607  MKSQALRDNSTMGYMTAKKHLEINPAHPIVETLREKAEADKNDKAVKDLVILLFETALLS  666

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+VVEE
Sbjct  667  SGFTLDDPQTHANRIYRMIKLGLGIDDDDSVVEE  700



>ref|XP_002968038.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
 gb|EFJ31385.1| hypothetical protein SELMODRAFT_88538 [Selaginella moellendorffii]
Length=751

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S+  YMRGKR+LEINP+HPII  L E    +P D   +E  +L+Y+TA + 
Sbjct  599  MKAQALGDTSQLDYMRGKRILEINPQHPIIASLNEACKSSPHDTRAQEIVELLYETAHVS  658

Query  419  SGFNVPDPKDFASGIYNSV  363
            SGF   +  +F + IY+ +
Sbjct  659  SGFTPDNASEFGARIYDMI  677



>ref|XP_002992602.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
 gb|EFJ06304.1| hypothetical protein SELMODRAFT_448838 [Selaginella moellendorffii]
Length=836

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S+  YMRGKR+LEINP+HPII  L E    +P D   +E  +L+Y+TA + 
Sbjct  684  MKAQALGDTSQLDYMRGKRILEINPQHPIIASLNEACKSSPHDTRAQEIVELLYETAHVS  743

Query  419  SGFNVPDPKDFASGIYNSV  363
            SGF   +  +F + IY+ +
Sbjct  744  SGFTPDNASEFGARIYDMI  762



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  587  MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  F + I+  +K   +I  D  VE+ D
Sbjct  647  SGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTD  681



>sp|Q90474.3|H90A1_DANRE RecName: Full=Heat shock protein HSP 90-alpha 1 [Danio rerio]
Length=725

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  607  MKSQALRDNSTMGYMTAKKHLEINPAHPIVETLREKAEADKNDKAVKDLVILLFETALLS  666

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+VVEE
Sbjct  667  SGFTLDDPQTHANRIYRMIKLGLGIDDDDSVVEE  700



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  587  MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  F + I+  +K   +I  D  VE+ D
Sbjct  647  SGFSLDDPNTFGNRIHRMLKLGLSIDEDEKVEDTD  681



>emb|CDS02719.1| Putative Heat shock protein 90-1 [Absidia idahoensis var. thermophila]
Length=703

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D++  +YM  K+ LE+NP H IIK L+++  +   D + K+  QL+Y+TA + 
Sbjct  587  MKAQALRDSTMSSYMASKKTLELNPNHGIIKALKQKFSEDSSDRTVKDLTQLLYETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP +FA  IY  V    +I  D    + D
Sbjct  647  SGFSLDDPSNFAYRIYRMVSLGLSIDEDDTTMQED  681



>ref|XP_010902983.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Esox lucius]
Length=725

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPII+ LRE+      D++ K+   L+++TA M 
Sbjct  607  MKSQALRDNSTMGYMTAKKHLEINPTHPIIETLREKAEADKNDKAVKDLVILLFETALMS  666

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  A+ IY  +K    I  D
Sbjct  667  SGFTLDDPQTHANRIYRMIKLGLGIDDD  694



>gb|EKG06682.1| heat shock protein 85, putative, partial [Trypanosoma cruzi]
Length=343

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV     D++ K+   L++ TA + 
Sbjct  228  MRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLT  287

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + DP  +A  I+  +K   ++
Sbjct  288  SGFTLDDPTSYAERIHRMIKLGLSL  312



>dbj|BAA13431.1| heat shock protein 90 [Homo sapiens]
Length=151

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP H II+ LR++      D+S K+   L+Y+TA + 
Sbjct  33   MKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLS  92

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+ IY  +K    I  D
Sbjct  93   SGFSLEDPQTHANRIYRMIKLGLGIDED  120



>gb|ACV71144.1| heat shock protein 90 [Babesia sp. Tianzhu]
Length=594

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +  ++M  K+ +E+NP H I+KEL++R      D++ K+   L+Y TA + 
Sbjct  483  MKAQALRDNNFGSFMISKKTMELNPHHSIMKELKQRAEADKSDKTLKDLVWLLYDTAILT  542

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGFN+ DP  F   IY  +K   ++  DA VE+
Sbjct  543  SGFNLDDPTQFGGRIYRMIKLGLSLDDDAAVED  575



>gb|ACV04849.1| heat shock protein 90 [Babesia sp. BQ1/Lintan]
Length=717

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +  ++M  K+ +E+NP H I+KEL++R      D++ K+   L+Y TA + 
Sbjct  606  MKAQALRDNNFGSFMISKKTMELNPHHSIMKELKQRAEADKSDKTLKDLVWLLYDTAILT  665

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGFN+ DP  F   IY  +K   ++  DA VE+
Sbjct  666  SGFNLDDPTQFGGRIYRMIKLGLSLDDDAAVED  698



>gb|KGB79019.1| hsp90-like protein [Cryptococcus gattii R265]
 gb|KIR27901.1| hsp90-like protein [Cryptococcus gattii LA55]
 gb|KIR35468.1| hsp90-like protein [Cryptococcus gattii MMRL2647]
 gb|KIR38737.1| hsp90-like protein [Cryptococcus gattii Ram5]
 gb|KIR70922.1| hsp90-like protein [Cryptococcus gattii CA1014]
 gb|KIR90532.1| hsp90-like protein [Cryptococcus gattii CBS 10090]
 gb|KIR97264.1| hsp90-like protein [Cryptococcus gattii 2001/935-1]
 gb|KIY57748.1| hsp90-like protein [Cryptococcus gattii 99/473]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>gb|ACV71146.1| heat shock protein 90 [Babesia sp. BQ1/Lintan]
Length=594

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +  ++M  K+ +E+NP H I+KEL++R      D++ K+   L+Y TA + 
Sbjct  483  MKAQALRDNNFGSFMISKKTMELNPHHSIMKELKQRAEADKSDKTLKDLVWLLYDTAILT  542

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGFN+ DP  F   IY  +K   ++  DA VE+
Sbjct  543  SGFNLDDPTQFGGRIYRMIKLGLSLDDDAAVED  575



>gb|KJE05047.1| hsp90-like protein [Cryptococcus gattii NT-10]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>ref|XP_009616710.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=163

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            +QSQ + D  KQ YM  KRVL+IN +H IIKELR RV K P+D++ KE  ++IY  A + 
Sbjct  84   LQSQAILDLDKQTYMLNKRVLKINHKHSIIKELRSRVAKDPKDDNAKEIEKIIYGIASLT  143

Query  419  SGFNVPDPKDFASGIYNSVK  360
            +G  + D    A   YN V+
Sbjct  144  NGLKLTDLDSAAFHPYNLVQ  163



>gb|AAN76524.1|AF384807_1 heat-shock protein 90 [Cryptococcus gattii]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>ref|XP_003197339.1| cytoplasmic chaperone (Hsp90 family); Hsp82p [Cryptococcus gattii 
WM276]
 gb|ADV25552.1| Cytoplasmic chaperone (Hsp90 family), putative; Hsp82p [Cryptococcus 
gattii WM276]
 gb|KIR52818.1| hsp90-like protein [Cryptococcus gattii Ru294]
 gb|KIR78923.1| hsp90-like protein [Cryptococcus gattii EJB2]
 gb|KIY32889.1| hsp90-like protein [Cryptococcus gattii E566]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>gb|EGT39214.1| CBN-DAF-21 protein [Caenorhabditis brenneri]
Length=706

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  588  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEADKNDKTVKDLVVLLFETALLS  647

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ +P+  AS IY  +K   +I  D + E
Sbjct  648  SGFSLEEPQSHASRIYRMIKLGLDIGDDDLEE  679



>gb|KIR45891.1| hsp90-like protein [Cryptococcus gattii CA1280]
 gb|KIR59078.1| hsp90-like protein [Cryptococcus gattii CA1873]
Length=699

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>gb|ACV71143.1| heat shock protein 90 [Babesia sp. Hebei]
Length=594

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D +  ++M  K+ +E+NP H I+KEL++R      D++ K+   L+Y TA + 
Sbjct  483  MKAQALRDNNFGSFMISKKTMELNPHHSIMKELKQRAEADKSDKTLKDLVWLLYDTAILT  542

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGFN+ DP  F   IY  +K   ++  DA VE+
Sbjct  543  SGFNLDDPTQFGGRIYRMIKLGLSLDDDAAVED  575



>gb|KIR84754.1| hsp90-like protein [Cryptococcus gattii IND107]
Length=698

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  582  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKSDKTVRDLTYLLFETALLT  641

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  642  SGFTLSNPQDFASRINRMIALGLSI  666



>ref|XP_003971591.1| PREDICTED: heat shock protein HSP 90-alpha 1-like [Takifugu rubripes]
Length=724

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D +   YM  K+ LEINP HPII+ LRE+      D++ K+   L+Y+TA + 
Sbjct  606  MKSQALRDTATMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLYETALLS  665

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  A+ IY  +K    I  D
Sbjct  666  SGFTLEDPQTHANRIYRMIKLGLGIDDD  693



>emb|CDH51743.1| heat shock protein 90 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=701

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  AYM  K+  E+NP+H IIK L+++V     D + K+   L+++TA + 
Sbjct  587  MKAQALRDNSMSAYMASKKTFELNPKHAIIKTLKDKVAADASDRTVKDLTTLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ +P  FAS I+  V    +I  D V+E+
Sbjct  647  SGFSLDEPATFASRIHRMVALGLSIDEDEVLED  679



>gb|AAB23704.1| HSP90, partial [Mus sp.]
Length=194

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP HPI++ LR++      D++ K+   L+++TA + 
Sbjct  76   MKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLS  135

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ DP+  ++ IY  +K    I  D V  E
Sbjct  136  SGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAE  168



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  AYM  K+++EINP +PI+ ELR+R      D+S K+   L+++TA + 
Sbjct  592  MKAQALRDNSMSAYMSSKKIMEINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLT  651

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  +K    I  D   E+ D
Sbjct  652  SGFSLDDPNTFAARIHRMLKLGLGIDEDESGEQED  686



>gb|KHN76289.1| Heat shock protein HSP 90-alpha [Toxocara canis]
Length=656

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  535  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  594

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ +
Sbjct  595  SGFSLDDPQLHASRIYRMIKLGLDIAEE  622



>gb|AFR98377.1| hsp90-like protein [Cryptococcus neoformans var. grubii H99]
Length=699

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  583  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKGRVAEDKSDKTVRDLTYLLFETALLT  642

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  643  SGFTLSNPQDFASRINRMIALGLSI  667



>emb|CDQ81678.1| unnamed protein product [Oncorhynchus mykiss]
Length=725

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA M 
Sbjct  607  MKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMS  666

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  A+ IY  +K    I  D
Sbjct  667  SGFTLDDPQTHANRIYRMIKLGLGIDDD  694



>gb|ESL09761.1| heat shock protein 85 [Trypanosoma rangeli SC58]
Length=367

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV     D++ K+   L++ TA + 
Sbjct  251  MRNQALRDSSMSAYMMSKKTMEINPTHPIVKELKRRVEADENDKAVKDLVYLLFDTALLT  310

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + DP  +A  I+  +K   ++
Sbjct  311  SGFALDDPTSYADRIHRMIKLGLSL  335



>gb|ACO55135.1| heat shock protein 90 [Toxocara cati]
Length=723

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  602  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  661

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  AS IY  +K   +I+ +
Sbjct  662  SGFSLDDPQLHASRIYRMIKLGLDIAEE  689



>gb|AAN76525.1|AF384808_1 heat-shock protein 90 [Cryptococcus neoformans var. grubii]
Length=691

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +   D++ ++   L+++TA + 
Sbjct  580  MKAQALRDSSMSSYMASKKTMELNPSHPIIKELKGRVAEDKSDKTVRDLTYLLFETALLT  639

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF + +P+DFAS I   +    +I
Sbjct  640  SGFTLSNPQDFASRINRMIALGLSI  664



>gb|AGT57167.1| heat shock protein 90-alpha 3 [Salmo salar]
Length=727

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA M 
Sbjct  609  MKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMS  668

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  A+ IY  +K    I  D
Sbjct  669  SGFTLDDPQTHANRIYRMIKLGLGIDDD  696



>emb|CBN74418.1| Heat shock protein 90 [Ectocarpus siliculosus]
Length=767

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++QTL+D+ +   + G R +EINPRHPI+ EL +++ + P+ E  K+ + L+Y+TA   
Sbjct  651  MKAQTLADSKQMGLLGGHRSMEINPRHPIVHELNKKIEEDPDSEETKDLSWLLYETALTA  710

Query  419  SGFNVPDPKDFASGIYNSVKSSFNIS  342
            SGF V D + FA+ +  ++  + N+S
Sbjct  711  SGFQVEDTEAFANRVQRAMAKTLNLS  736



>ref|XP_005643869.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE19325.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=717

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQTL D+    YM+G++ LEINP HPII+ L ++V    +    K  A+L+Y TA + 
Sbjct  605  MRSQTLGDSRAAEYMKGRKTLEINPDHPIIRALSDKVNN--DAAGAKAVAELMYDTALVT  662

Query  419  SGFNVPDPKDFASGIYNSVKSSFN  348
            SGF V  P++FA+ IYN V  + N
Sbjct  663  SGFTVESPREFAARIYNMVGLAVN  686



>gb|AAF31705.1|AF221856_1 heat-shock protein 80 [Euphorbia esula]
Length=320

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI+ ELR+R      D+S K+   L+++TA + 
Sbjct  206  MKAQALRDSSMAGYMSSKKTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLT  265

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDA  333
            SGF++ DP  F + I+  +K   +I  DA
Sbjct  266  SGFSLDDPNTFGNRIHRMLKLGLSIDEDA  294



>gb|AEM37757.1| heat shock protein 90 beta, partial [Epinephelus bruneus]
Length=126

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP HPI++ LR++      D++ K+   L+++TA + 
Sbjct  5    MKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETALLS  64

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF++ DP+  ++ IY  +K    I  D V
Sbjct  65   SGFSLDDPQTHSNRIYRMIKLGLGIDDDDV  94



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  AYM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  238  MKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLT  297

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FA+ I+  +K   +I  D   E+ D
Sbjct  298  SGFSLEDPNTFAARIHRMLKLGLSIEEDDAGEDAD  332



>ref|XP_005333421.1| PREDICTED: heat shock protein HSP 90-alpha-like isoform X1 [Ictidomys 
tridecemlineatus]
Length=733

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP H II+ LR++      D+S K+   L+Y+TA + 
Sbjct  615  MKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLS  674

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+GIY  +K    I  D
Sbjct  675  SGFSLEDPQTHANGIYRMIKLGLGIDED  702



>gb|AAQ63041.1| heat shock protein HSP 90 alpha, partial [Platichthys flesus]
Length=207

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP HPI++ LR++      D+S K+   L+++TA + 
Sbjct  88   MKAQALRDNSTMGYMAAKKHLEINPDHPIVETLRQKAEADKNDKSVKDLVILLFETALLS  147

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVV  327
            SGF + DP+  ++ IY  +K    I  D ++
Sbjct  148  SGFTLDDPQTHSNRIYRMIKLGLGIDEDDLI  178



>gb|EYD92886.1| hsp90 family protein, partial [Escherichia coli 1-176-05_S1_C1]
Length=294

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S  +YM  K+ +EINP +PI+ EL+ ++V    D++ K+   L+Y+T+ + 
Sbjct  181  MKAQALRDTSMTSYMMSKKTMEINPYNPIMTELKNKIVNDKSDKTVKDLIWLLYETSLLT  240

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ DP  F+S I   +K   +I  + +V++
Sbjct  241  SGFSLEDPTQFSSRINRMIKLGLSIDEEDIVDD  273



>gb|ACO58580.1| heat shock protein 90 [Apis mellifera]
Length=362

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L DAS   YM  K+ LEINP HPI++ LR++      D+S K+   L+++TA + 
Sbjct  244  MKAQALRDASTMGYMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLS  303

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + DP+  AS IY  +K       D
Sbjct  304  SGFALEDPQVHASRIYRMIKLGLGFDDD  331



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  585  MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLT  644

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAV  330
            SGF++ DP  F + I+  +K   +I  DAV
Sbjct  645  SGFSLDDPNTFGNRIHRMLKLGLSIDEDAV  674



>gb|AAB49983.1| heat shock protein hsp90 [Oncorhynchus tshawytscha]
Length=726

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  608  MKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLS  667

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+ VEE
Sbjct  668  SGFTLDDPQTHANRIYRMIKLGLGIDGDDSAVEE  701



>ref|XP_006632301.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X3 
[Lepisosteus oculatus]
Length=727

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPII+ LR++      D+S K+   L+++TA + 
Sbjct  609  MKSQALRDNSTMGYMAAKKHLEINPEHPIIETLRQKAEVDKNDKSVKDLVILLFETALLS  668

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGF++ DP+  A+ IY  +K    I  D +  E+
Sbjct  669  SGFSLDDPQTHANRIYRMIKLGLGIDEDDMTTED  702



>emb|CDQ59969.1| unnamed protein product [Oncorhynchus mykiss]
Length=718

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  600  MKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLS  659

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+ VEE
Sbjct  660  SGFTLDDPQTHANRIYRMIKLGLGIDGDDSAVEE  693



>ref|XP_005333422.1| PREDICTED: heat shock protein HSP 90-alpha-like isoform X2 [Ictidomys 
tridecemlineatus]
Length=685

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP H II+ LR++      D+S K+   L+Y+TA + 
Sbjct  567  MKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLS  626

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+GIY  +K    I  D
Sbjct  627  SGFSLEDPQTHANGIYRMIKLGLGIDED  654



>gb|EYC13285.1| hypothetical protein Y032_0044g1081 [Ancylostoma ceylanicum]
Length=707

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  589  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  648

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P+  AS IY  +K   +I  D
Sbjct  649  SGFSLEEPQSHASRIYRMIKLGLDIGDD  676



>ref|XP_006632300.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Lepisosteus oculatus]
Length=732

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPII+ LR++      D+S K+   L+++TA + 
Sbjct  614  MKSQALRDNSTMGYMAAKKHLEINPEHPIIETLRQKAEVDKNDKSVKDLVILLFETALLS  673

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGF++ DP+  A+ IY  +K    I  D +  E+
Sbjct  674  SGFSLDDPQTHANRIYRMIKLGLGIDEDDMTTED  707



>gb|KIH68348.1| Hsp90 protein [Ancylostoma duodenale]
Length=707

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  589  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  648

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P+  AS IY  +K   +I  D
Sbjct  649  SGFSLEEPQSHASRIYRMIKLGLDIGDD  676



>dbj|BAK08742.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>dbj|BAK08728.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>ref|XP_006632299.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Lepisosteus oculatus]
Length=732

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPII+ LR++      D+S K+   L+++TA + 
Sbjct  614  MKSQALRDNSTMGYMAAKKHLEINPEHPIIETLRQKAEVDKNDKSVKDLVILLFETALLS  673

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGF++ DP+  A+ IY  +K    I  D +  E+
Sbjct  674  SGFSLDDPQTHANRIYRMIKLGLGIDEDDMTTED  707



>dbj|BAK08741.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>gb|AGT57168.1| heat shock protein 90-alpha 4 [Salmo salar]
Length=727

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  609  MKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLS  668

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+ VEE
Sbjct  669  SGFTLDDPQTHANRIYRMIKLGLGIDGDDSAVEE  702



>gb|ETN83529.1| putative heat shock protein 90 [Necator americanus]
Length=689

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  571  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  630

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ +P+  AS IY  +K   +I  D
Sbjct  631  SGFSLEEPQSHASRIYRMIKLGLDIGDD  658



>dbj|BAH97107.1| heat shock protein of Hsp90 [Chara braunii]
 dbj|BAK08668.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08669.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08670.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08671.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08672.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08673.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08674.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08675.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08676.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08677.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08678.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08679.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08680.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08681.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08682.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08683.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08684.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08685.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08686.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08687.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08688.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08689.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08692.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08694.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08695.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08696.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08697.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08698.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08699.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08700.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08701.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08702.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08703.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08704.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08705.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08706.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08707.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08708.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08709.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08710.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08711.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08712.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08713.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08714.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08715.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08716.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08717.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08718.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08719.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08720.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08721.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08722.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08723.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08724.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08725.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08726.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08727.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08729.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08730.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08731.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08732.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08733.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08736.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08737.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08738.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08739.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08740.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08832.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08833.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08834.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08835.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08836.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08837.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08838.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08839.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08840.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>dbj|BAK08690.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08693.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>gb|ESA08764.1| hypothetical protein GLOINDRAFT_348967 [Rhizophagus irregularis 
DAOM 181602]
Length=706

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+++EINP HPI+K L+ +V     D++ K+   L+++T+ ++
Sbjct  591  MKAQALRDSSMASYMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQ  650

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + +P  FA  I+  +K   +I  D
Sbjct  651  SGFTLEEPSSFAGRIFKMIKLGLDIGGD  678



>emb|CAA34748.1| heat shock-like protein [Mus musculus]
Length=274

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D S   YM  K+ LEINP H II+ LR++      D+S K+   L+Y+TA + 
Sbjct  156  MKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLS  215

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF++ DP+  A+ IY  +K    I  D
Sbjct  216  SGFSLEDPQTHANRIYRMIKLGLGIDED  243



>ref|XP_006149126.1| PREDICTED: heat shock protein HSP 90-beta [Tupaia chinensis]
Length=724

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++QTL D S   YM  K+ LEINP HPI++ LR++      D++ K+   L+++TA + 
Sbjct  606  MKAQTLLDTSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLS  665

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEE  321
            SGF++ DP+  ++ IY  +K    I  D V  E
Sbjct  666  SGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAE  698



>dbj|BAK08691.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08734.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08735.1| heat shock protein 90 [Chara braunii]
Length=701

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S  +YM  K+ +E+NP + I+KEL++R      D++ K+   L+++TA + 
Sbjct  587  MRAQALRDSSMSSYMTSKKTMEVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLT  646

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEND  315
            SGF++ DP  FAS I+  +K   +I  DA  E+ D
Sbjct  647  SGFSLDDPNMFASRIHRMIKLGLSIDEDAAGEDED  681



>dbj|BAF92789.1| cytosolic heat shock protein 90 alpha [Solea senegalensis]
Length=724

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M+SQ L D S   YM  K+ LEINP HPI++ LRE+      D++ K+   L+++TA + 
Sbjct  606  MKSQALRDNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDLVILLFETALLS  665

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI-SPDAVVEE  321
            SGF + DP+  A+ IY  +K    I   D+ VEE
Sbjct  666  SGFTLEDPQTHANRIYRMIKLGLGIDDDDSAVEE  699



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI++ELR+R      D+S K+   L+++TA + 
Sbjct  589  MKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKNDKSVKDLVLLLFETALLT  648

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ DP  F + I+  +K   +I  D +V+
Sbjct  649  SGFSLDDPNTFGNRIHRMLKLGLSIDEDEIVD  680



>ref|XP_006401798.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
 gb|ESQ43251.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
Length=707

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP + I++ELR+R      D+S K+   L+++TA + 
Sbjct  594  MKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLT  653

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVEEN  318
            SGF++ DP  FA+ I+  +K   +I  D  VEE+
Sbjct  654  SGFSLDDPNTFAARIHRMLKLGLSIDEDENVEED  687



>gb|ACU00668.1| heat shock protein 90 [Haemonchus contortus]
Length=707

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H I+K LRERV     D++ K+   L+++TA + 
Sbjct  589  MKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLS  648

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPD  336
            SGF + +P+  AS IY  +K   +I  D
Sbjct  649  SGFTLEEPQSHASRIYRMIKLGLDIGDD  676



>gb|ACO55134.1| heat shock protein 90 [Ascaris suum]
Length=721

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ LEINP H +IK LRERV     D++ K+   L+++TA + 
Sbjct  600  MKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLS  659

Query  419  SGFNVPDPKDFASGIYNSVKSSFNI  345
            SGF++ DP+  AS IY  +K   +I
Sbjct  660  SGFSLDDPQLHASRIYRMIKLGLDI  684



>tpg|DAA40367.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=365

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -1

Query  599  MQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKAPEDESPKETAQLIYKTAFME  420
            M++Q L D+S   YM  K+ +EINP +PI+ ELR+R      D+S K+   L+++TA + 
Sbjct  253  MKAQALRDSSMAGYMSSKKTMEINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLT  312

Query  419  SGFNVPDPKDFASGIYNSVKSSFNISPDAVVE  324
            SGF++ DP  F + I+  +K   +I  D  VE
Sbjct  313  SGFSLDDPNTFGNRIHRMLKLGLSIDEDEPVE  344



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510