BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041E08

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg                119   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...    118   5e-27   Sesamum indicum [beniseed]
ref|XP_010063847.1|  PREDICTED: cellulose synthase A catalytic su...    117   1e-26   Eucalyptus grandis [rose gum]
gb|AFD33697.1|  cellulose synthase A                                    117   1e-26   Eucalyptus camaldulensis
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...    117   2e-26   Glycine max [soybeans]
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...    116   3e-26   Nicotiana sylvestris
gb|AFY06685.1|  cellulose synthase                                      116   3e-26   Nicotiana tabacum [American tobacco]
gb|AEI87569.1|  cellulose synthase catalytic subunit protein            116   3e-26   Nicotiana tabacum [American tobacco]
gb|AAK49454.1|AF304374_1  cellulose synthase catalytic subunit          116   3e-26   Nicotiana alata [flowering tobacco]
ref|XP_009609627.1|  PREDICTED: cellulose synthase A catalytic su...    116   3e-26   Nicotiana tomentosiformis
gb|AES62337.2|  cellulose synthase-like protein                         115   4e-26   Medicago truncatula
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...    115   5e-26   Sesamum indicum [beniseed]
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                115   6e-26   Erythranthe guttata [common monkey flower]
gb|EPS73674.1|  cellulose synthase catalytic subunit                    112   2e-25   Genlisea aurea
gb|AGV22110.1|  cellulose synthase 8                                    114   2e-25   Betula luminifera [liang ye hua]
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...    113   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...    112   4e-25   Vitis vinifera
ref|XP_010680991.1|  PREDICTED: cellulose synthase A catalytic su...    112   5e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP11417.1|  unnamed protein product                                112   5e-25   Coffea canephora [robusta coffee]
gb|AFZ78560.1|  cellulose synthase                                      112   7e-25   Populus tomentosa [Chinese white poplar]
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g             112   7e-25   Phaseolus vulgaris [French bean]
ref|XP_010678670.1|  PREDICTED: cellulose synthase A catalytic su...    112   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g             111   1e-24   Phaseolus vulgaris [French bean]
gb|KCW57899.1|  hypothetical protein EUGRSUZ_H006461                    106   2e-24   Eucalyptus grandis [rose gum]
dbj|BAG06272.1|  cellulose synthase Z632                                110   3e-24   Zinnia elegans [garden zinnia]
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...    110   4e-24   Elaeis guineensis
ref|XP_008785840.1|  PREDICTED: cellulose synthase A catalytic su...    110   4e-24   Phoenix dactylifera
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...    109   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...    109   9e-24   Fragaria vesca subsp. vesca
gb|KEH43649.1|  cellulose synthase-like protein                         109   9e-24   Medicago truncatula
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg             108   9e-24   Prunus persica
ref|XP_003592086.1|  Cellulose synthase                                 108   9e-24   
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550          108   1e-23   Amborella trichopoda
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    108   1e-23   Nicotiana sylvestris
gb|KJB59452.1|  hypothetical protein B456_009G255100                    108   1e-23   Gossypium raimondii
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                108   1e-23   Brassica napus [oilseed rape]
ref|XP_007019545.1|  Cellulose synthase 6                               108   1e-23   
emb|CDX81145.1|  BnaC03g03990D                                          108   1e-23   
gb|KJB59451.1|  hypothetical protein B456_009G255100                    108   1e-23   Gossypium raimondii
gb|KJB59449.1|  hypothetical protein B456_009G255100                    108   1e-23   Gossypium raimondii
emb|CDY56540.1|  BnaA03g55860D                                          108   1e-23   Brassica napus [oilseed rape]
gb|KHG29218.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    108   1e-23   Gossypium arboreum [tree cotton]
gb|AFB18639.1|  CESA9                                                   108   1e-23   Gossypium hirsutum [American cotton]
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    108   1e-23   Eucalyptus grandis [rose gum]
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    108   2e-23   Nicotiana tomentosiformis
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    108   2e-23   Cucumis sativus [cucumbers]
ref|NP_179768.1|  cellulose synthase A9                                 108   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376550.1|  PREDICTED: cellulose synthase A catalytic su...    108   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    108   2e-23   Cucumis melo [Oriental melon]
gb|ABK95901.1|  unknown                                                 102   2e-23   Populus trichocarpa [western balsam poplar]
gb|KDP35302.1|  hypothetical protein JCGZ_09461                         108   2e-23   Jatropha curcas
gb|KDP30751.1|  hypothetical protein JCGZ_15180                         108   2e-23   Jatropha curcas
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_010070596.1|  PREDICTED: probable cellulose synthase A cat...    106   2e-23   Eucalyptus grandis [rose gum]
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit             107   2e-23   Medicago truncatula
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Brassica rapa
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Solanum lycopersicum
ref|XP_006394117.1|  hypothetical protein EUTSA_v100035741mg            102   3e-23   
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Elaeis guineensis
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Populus euphratica
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Populus euphratica
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   Populus euphratica
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    107   4e-23   Prunus mume [ume]
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   Populus euphratica
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   
gb|AFV91431.1|  cellulose synthase CesA2                              97.8    4e-23   Salix hybrid cultivar
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             107   4e-23   Phaseolus vulgaris [French bean]
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    106   6e-23   Nelumbo nucifera [Indian lotus]
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                106   6e-23   Erythranthe guttata [common monkey flower]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    106   6e-23   Cicer arietinum [garbanzo]
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...    106   6e-23   Solanum lycopersicum
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    106   6e-23   
ref|XP_002878571.1|  hypothetical protein ARALYDRAFT_900606             106   6e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...    106   7e-23   Glycine max [soybeans]
ref|XP_007048203.1|  Cellulose synthase 6                               106   7e-23   
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    106   7e-23   Glycine soja [wild soybean]
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             106   7e-23   
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...    106   7e-23   Glycine max [soybeans]
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     106   8e-23   Eucalyptus grandis [rose gum]
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    106   8e-23   Solanum tuberosum [potatoes]
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    106   8e-23   Tarenaya hassleriana [spider flower]
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...    106   9e-23   Pyrus x bretschneideri [bai li]
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...    106   9e-23   
ref|XP_010106861.1|  Isoxaben-resistant protein 2                       106   9e-23   
ref|XP_009414591.1|  PREDICTED: cellulose synthase A catalytic su...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557327.1|  PREDICTED: probable cellulose synthase A cat...    105   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Tarenaya hassleriana [spider flower]
gb|AGV22108.1|  cellulose synthase 6                                    105   1e-22   Betula luminifera [liang ye hua]
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   105   1e-22   Citrus sinensis [apfelsine]
gb|AFV91433.1|  cellulose synthase CesA2                              96.7    1e-22   Salix hybrid cultivar
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             105   1e-22   Citrus clementina [clementine]
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Populus euphratica
gb|AAK53023.1|AF375439_1  AT5g64740/MVP7_7                              102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307145.1|  cellulose synthase family protein                  105   1e-22   Populus trichocarpa [western balsam poplar]
gb|KJB49076.1|  hypothetical protein B456_008G100200                    103   1e-22   Gossypium raimondii
gb|AEE60899.1|  cellulose synthase                                      105   2e-22   Populus tomentosa [Chinese white poplar]
ref|XP_002302169.1|  CesA7A-like family protein                         105   2e-22   
ref|XP_002533503.1|  Cellulose synthase A catalytic subunit 6 [UD...    105   2e-22   
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...    105   2e-22   Populus euphratica
gb|AFZ78561.1|  cellulose synthase                                      105   2e-22   Populus tomentosa [Chinese white poplar]
gb|ACS88358.1|  cellulose synthase catalytic subunit                    104   2e-22   Gossypium hirsutum [American cotton]
gb|KJB14948.1|  hypothetical protein B456_002G150300                    105   2e-22   Gossypium raimondii
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    105   2e-22   Cicer arietinum [garbanzo]
gb|KJB14950.1|  hypothetical protein B456_002G150300                    105   2e-22   Gossypium raimondii
gb|AAY43224.2|  cellulose synthase BoCesA7                              105   2e-22   Bambusa oldhamii
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       105   2e-22   Morus notabilis
gb|AAT09895.1|  cellulose synthase                                      105   2e-22   Populus tremula x Populus tremuloides
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    105   2e-22   Gossypium arboreum [tree cotton]
gb|ABI34115.1|  cellulose synthase catalytic subunit                    102   2e-22   Brassica napus [oilseed rape]
gb|AFB18634.1|  CESA5                                                   105   2e-22   Gossypium hirsutum [American cotton]
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    105   2e-22   Gossypium arboreum [tree cotton]
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    105   2e-22   Oryza brachyantha
ref|XP_006658446.1|  PREDICTED: probable cellulose synthase A cat...    105   2e-22   
ref|XP_008667855.1|  PREDICTED: uncharacterized protein LOC100280...    105   2e-22   
ref|NP_001051830.1|  Os03g0837100                                       105   2e-22   
ref|NP_001059487.1|  Os07g0424400                                       105   2e-22   
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050          105   2e-22   Sorghum bicolor [broomcorn]
gb|KJB49075.1|  hypothetical protein B456_008G100200                    104   2e-22   Gossypium raimondii
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    104   2e-22   Glycine soja [wild soybean]
ref|NP_001104957.1|  cellulose synthase7                                105   2e-22   Zea mays [maize]
gb|KJB18373.1|  hypothetical protein B456_003G049300                    105   2e-22   Gossypium raimondii
gb|KCW87523.1|  hypothetical protein EUGRSUZ_B03971                     104   2e-22   Eucalyptus grandis [rose gum]
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...    105   3e-22   Ricinus communis
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...    104   3e-22   Glycine max [soybeans]
emb|CDP12843.1|  unnamed protein product                                104   3e-22   Coffea canephora [robusta coffee]
ref|XP_011466718.1|  PREDICTED: cellulose synthase A catalytic su...    104   3e-22   Fragaria vesca subsp. vesca
gb|KJB18370.1|  hypothetical protein B456_003G049300                    104   3e-22   Gossypium raimondii
ref|XP_009411928.1|  PREDICTED: cellulose synthase A catalytic su...    104   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    104   3e-22   Oryza brachyantha
gb|EEE67058.1|  hypothetical protein OsJ_24012                          104   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          104   3e-22   
ref|XP_004981131.1|  PREDICTED: probable cellulose synthase A cat...    104   3e-22   
gb|EEC81812.1|  hypothetical protein OsI_25542                          104   3e-22   Oryza sativa Indica Group [Indian rice]
gb|ACZ82299.1|  cellulose synthase                                      104   3e-22   Phyllostachys edulis [kikko-chiku]
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    104   3e-22   Tarenaya hassleriana [spider flower]
gb|AAL24340.1|  cellulose synthase catalytic subunit (Ath-A)            102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001104956.1|  cellulose synthase6                                104   3e-22   
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    104   3e-22   Setaria italica
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...    104   3e-22   
ref|XP_002459635.1|  hypothetical protein SORBIDRAFT_02g007810          104   4e-22   Sorghum bicolor [broomcorn]
gb|EMT11411.1|  Putative cellulose synthase A catalytic subunit 5...    104   4e-22   
ref|XP_002306707.1|  CesA7A-like family protein                         104   4e-22   Populus trichocarpa [western balsam poplar]
dbj|BAJ97774.1|  predicted protein                                      104   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAR29964.1|  putative cellulose synthase catalytic subunit           104   4e-22   Hordeum vulgare [barley]
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          104   4e-22   Amborella trichopoda
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             104   4e-22   
gb|EPS71230.1|  hypothetical protein M569_03522                         104   4e-22   Genlisea aurea
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    104   4e-22   Setaria italica
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    104   4e-22   Setaria italica
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    104   5e-22   
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    104   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    103   5e-22   Setaria italica
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             103   5e-22   Capsella rubella
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    103   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    103   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    103   6e-22   Camelina sativa [gold-of-pleasure]
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    103   7e-22   Gossypium arboreum [tree cotton]
ref|NP_001059303.1|  Os07g0252400                                       103   7e-22   
gb|AIA61439.1|  cellulose synthase                                      103   7e-22   Boehmeria nivea [Chinese silk-plant]
ref|XP_010484268.1|  PREDICTED: cellulose synthase A catalytic su...    103   8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    103   8e-22   Brassica rapa
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...    103   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862432.1|  predicted protein                                  103   8e-22   Arabidopsis lyrata subsp. lyrata
emb|CDY46820.1|  BnaC02g43280D                                          103   8e-22   Brassica napus [oilseed rape]
gb|AAC29067.1|  cellulose synthase                                      103   8e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14504.1|  BnaC03g49550D                                          103   8e-22   Brassica napus [oilseed rape]
ref|XP_010462809.1|  PREDICTED: cellulose synthase A catalytic su...    103   8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010444419.1|  PREDICTED: cellulose synthase A catalytic su...    103   8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             103   8e-22   Capsella rubella
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             103   9e-22   
emb|CDY31305.1|  BnaA02g34360D                                          103   9e-22   Brassica napus [oilseed rape]
emb|CDY42621.1|  BnaC01g00330D                                          103   1e-21   Brassica napus [oilseed rape]
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    102   1e-21   Arabis alpina [alpine rockcress]
gb|AFZ78562.1|  cellulose synthase                                      102   1e-21   Populus tomentosa [Chinese white poplar]
ref|NP_001104958.1|  cellulose synthase8                                102   1e-21   Zea mays [maize]
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...    102   1e-21   Brassica rapa
emb|CDX81249.1|  BnaC09g06600D                                          102   1e-21   
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit                102   1e-21   Brassica napus [oilseed rape]
emb|CDY18696.1|  BnaA09g06990D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    102   1e-21   Brassica rapa
emb|CDY41973.1|  BnaA01g05450D                                          102   1e-21   Brassica napus [oilseed rape]
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                102   2e-21   Brassica napus [oilseed rape]
gb|AAM97089.1|  cellulose synthase catalytic subunit                  99.4    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310628.1|  cellulose synthase family protein                  102   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             102   2e-21   Populus trichocarpa [western balsam poplar]
gb|KDO83761.1|  hypothetical protein CISIN_1g001373mg                   102   2e-21   Citrus sinensis [apfelsine]
gb|KDO83760.1|  hypothetical protein CISIN_1g001373mg                   102   2e-21   Citrus sinensis [apfelsine]
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             102   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006473074.1|  PREDICTED: cellulose synthase A catalytic su...    102   2e-21   Citrus sinensis [apfelsine]
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             102   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg             102   2e-21   Citrus clementina [clementine]
ref|XP_006434482.1|  hypothetical protein CICLE_v10000103mg             102   2e-21   
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    102   2e-21   Sesamum indicum [beniseed]
gb|AFV91426.1|  cellulose synthase CesA2                              93.2    2e-21   Salix hybrid cultivar
gb|KDO83765.1|  hypothetical protein CISIN_1g001373mg                   102   2e-21   Citrus sinensis [apfelsine]
gb|KDO83767.1|  hypothetical protein CISIN_1g001373mg                   102   2e-21   Citrus sinensis [apfelsine]
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    102   2e-21   Brassica rapa
emb|CDY08854.1|  BnaA06g23700D                                          102   3e-21   Brassica napus [oilseed rape]
gb|AFS95066.1|  cellulose synthase                                      102   3e-21   Rosa hybrid cultivar
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    102   3e-21   Fragaria vesca subsp. vesca
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    102   3e-21   Nelumbo nucifera [Indian lotus]
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    101   3e-21   Gossypium arboreum [tree cotton]
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    101   3e-21   Vitis vinifera
ref|XP_009372681.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    101   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_009765335.1|  PREDICTED: cellulose synthase A catalytic su...    101   3e-21   Nicotiana sylvestris
ref|XP_009599913.1|  PREDICTED: cellulose synthase A catalytic su...    101   4e-21   Nicotiana tomentosiformis
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    101   4e-21   Vitis vinifera
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    101   4e-21   Phoenix dactylifera
ref|XP_009101741.1|  PREDICTED: cellulose synthase A catalytic su...    101   4e-21   Brassica rapa
ref|XP_009101742.1|  PREDICTED: cellulose synthase A catalytic su...    101   4e-21   Brassica rapa
gb|ACN34934.1|  unknown                                               97.8    4e-21   Zea mays [maize]
ref|NP_001146633.1|  uncharacterized protein LOC100280232             97.8    5e-21   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    101   5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    101   5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          100   5e-21   Amborella trichopoda
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    100   6e-21   Eucalyptus grandis [rose gum]
gb|AHL45025.1|  cellulose synthase 3A                                   100   6e-21   Linum usitatissimum
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         100   6e-21   Jatropha curcas
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     100   6e-21   Eucalyptus grandis [rose gum]
emb|CDX94752.1|  BnaC07g17610D                                          100   7e-21   
gb|AFV91432.1|  cellulose synthase CesA2                              92.0    7e-21   Salix dasyclados
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             100   7e-21   Prunus persica
ref|XP_008459950.1|  PREDICTED: cellulose synthase A catalytic su...    100   7e-21   Cucumis melo [Oriental melon]
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    100   7e-21   Prunus mume [ume]
gb|AAQ63935.1|  cellulose synthase                                      100   7e-21   Pinus radiata
gb|ACS68194.1|  cellulose synthase 4.2 catalytic subunit                100   7e-21   Brassica napus [oilseed rape]
ref|XP_010045345.1|  PREDICTED: probable cellulose synthase A cat...  99.4    8e-21   Eucalyptus grandis [rose gum]
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    100   8e-21   Nicotiana tomentosiformis
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    100   8e-21   Nicotiana tomentosiformis
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...    100   8e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AFV91448.1|  cellulose synthase CesA2                              91.7    8e-21   Populus tremula [European aspen]
emb|CDY22315.1|  BnaA06g36370D                                          100   9e-21   Brassica napus [oilseed rape]
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    100   9e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010239070.1|  PREDICTED: probable cellulose synthase A cat...    100   1e-20   Brachypodium distachyon [annual false brome]
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    100   1e-20   Phoenix dactylifera
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    100   1e-20   Elaeis guineensis
ref|XP_007138849.1|  hypothetical protein PHAVU_009G242700g             100   1e-20   Phaseolus vulgaris [French bean]
gb|KHN47729.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    100   1e-20   Glycine soja [wild soybean]
gb|KFK31669.1|  hypothetical protein AALP_AA6G143600                    100   1e-20   Arabis alpina [alpine rockcress]
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    100   1e-20   Elaeis guineensis
ref|XP_003533679.1|  PREDICTED: cellulose synthase A catalytic su...    100   1e-20   Glycine max [soybeans]
ref|NP_001105672.1|  cellulose synthase10                               100   1e-20   Zea mays [maize]
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    100   1e-20   Glycine max [soybeans]
ref|XP_004487957.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   
tpg|DAA49708.1|  TPA: eukaryotic translation initiation factor 4E-2     100   1e-20   
gb|AEW70215.1|  cellulose synthase                                    93.2    1e-20   Pinus sylvestris var. mongolica
gb|ACR37507.1|  unknown                                               92.8    1e-20   Zea mays [maize]
gb|AIF75766.1|  cellulose synthase                                    93.2    1e-20   Pinus massoniana [Chinese red pine]
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg           99.8    1e-20   Capsella rubella
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...  99.8    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ38667.1|  cellulose synthase                                    99.8    2e-20   Betula luminifera [liang ye hua]
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...  99.8    2e-20   
gb|KEH19084.1|  cellulose synthase-like protein                       99.8    2e-20   Medicago truncatula
dbj|BAG90397.1|  unnamed protein product                              99.4    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ38666.1|  cellulose synthase                                    99.8    2e-20   Betula luminifera [liang ye hua]
gb|EEC81930.1|  hypothetical protein OsI_25789                        99.4    2e-20   Oryza sativa Indica Group [Indian rice]
gb|AHL45026.1|  cellulose synthase 3B                                 99.4    2e-20   Linum usitatissimum
gb|ACC59197.1|  cellulose synthase                                    99.4    2e-20   Betula platyphylla [Asian white birch]
dbj|BAK18577.1|  cellulose synthase catalytic subunit                 99.4    2e-20   Eucalyptus globulus [blue gum]
dbj|BAK18576.1|  cellulose synthase catalytic subunit                 99.4    2e-20   Eucalyptus globulus [blue gum]
gb|AFI71895.1|  cellulose synthase 6                                  99.4    2e-20   Paeonia lactiflora [common garden peony]
ref|XP_004981130.1|  PREDICTED: probable cellulose synthase A cat...  99.8    2e-20   
gb|AAY43223.2|  cellulose synthase BoCesA6                            99.4    2e-20   Bambusa oldhamii
ref|XP_003557396.1|  PREDICTED: probable cellulose synthase A cat...  99.4    2e-20   Brachypodium distachyon [annual false brome]
gb|KDP26483.1|  hypothetical protein JCGZ_17641                       99.4    2e-20   Jatropha curcas
ref|XP_002467109.1|  hypothetical protein SORBIDRAFT_01g019720        99.4    2e-20   Sorghum bicolor [broomcorn]
ref|XP_010228235.1|  PREDICTED: probable cellulose synthase A cat...  99.4    2e-20   Brachypodium distachyon [annual false brome]
dbj|BAJ96780.1|  predicted protein                                    99.4    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004981132.1|  PREDICTED: probable cellulose synthase A cat...  99.4    2e-20   
ref|XP_004982919.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  99.8    2e-20   
gb|AES65133.2|  cellulose synthase-like protein                       99.4    2e-20   Medicago truncatula
ref|XP_002983910.1|  family 2 glycosyltransferase                     99.4    2e-20   
gb|AII73573.1|  cellulose synthase 4                                  99.4    2e-20   Medicago sativa [alfalfa]
ref|XP_010091789.1|  OsCesA4 protein                                  99.4    2e-20   
ref|XP_003532664.1|  PREDICTED: cellulose synthase A catalytic su...  99.4    2e-20   
ref|XP_003594882.1|  Cellulose synthase                               99.4    2e-20   
ref|XP_002960761.1|  cellulose synthase 4-1                           99.4    2e-20   
ref|XP_010039401.1|  PREDICTED: probable cellulose synthase A cat...  99.0    2e-20   
gb|AGC65584.1|  GFP-CESA3ixr1-2                                       99.4    2e-20   
ref|XP_006281455.1|  hypothetical protein CARUB_v10027534mg           99.4    2e-20   
gb|AAR29963.1|  putative cellulose synthase catalytic subunit         99.4    2e-20   
gb|KCW84750.1|  hypothetical protein EUGRSUZ_B01562                   99.0    2e-20   
gb|AFM37966.1|  cellulose synthase catalytic subunit                  99.4    2e-20   
gb|AAO15532.1|AF458083_1  cellulose synthase                          99.4    2e-20   
ref|XP_008356761.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    2e-20   
ref|XP_010039387.1|  PREDICTED: probable cellulose synthase A cat...  99.0    2e-20   
ref|XP_010494402.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    2e-20   
ref|XP_010481785.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    2e-20   
gb|ACF81885.1|  unknown                                               95.5    2e-20   
ref|XP_010441941.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    2e-20   
gb|AEK31216.1|  cellulose synthase A                                  99.0    3e-20   
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...  99.0    3e-20   
ref|XP_006662427.1|  PREDICTED: cellulose synthase A catalytic su...  99.4    3e-20   
ref|XP_002865387.1|  hypothetical protein ARALYDRAFT_494593           99.0    3e-20   
ref|NP_199216.2|  cellulose synthase A catalytic subunit 4 [UDP-f...  99.0    3e-20   
ref|XP_006382504.1|  cellulose synthase 6 family protein              99.0    3e-20   
ref|NP_001289665.1|  cellulose synthase A catalytic subunit 4         99.0    3e-20   
gb|AFZ78563.1|  cellulose synthase                                    99.0    3e-20   
gb|AAY60844.1|  cellulose synthase 2                                  99.0    3e-20   
ref|XP_002319002.2|  cellulose synthase 6 family protein              99.0    3e-20   
gb|ABY25278.1|  cellulose synthase                                    99.0    3e-20   
ref|XP_010934249.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    3e-20   
gb|AAP40636.1|  cellulose synthase 6                                  99.0    3e-20   
ref|XP_007158869.1|  hypothetical protein PHAVU_002G188600g           99.0    3e-20   
ref|XP_006582808.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...  99.0    3e-20   
gb|ADR74043.1|  cellulose synthase                                    99.0    3e-20   
ref|XP_010556863.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    3e-20   
gb|AGW52065.1|  cellulose synthase 4                                  99.0    3e-20   
gb|AGW52057.1|  cellulose synthase 4                                  99.0    3e-20   
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...  99.0    3e-20   
ref|XP_002301856.1|  hypothetical protein POPTR_0002s25970g           99.0    3e-20   
gb|AGW52052.1|  cellulose synthase 4                                  99.0    3e-20   
gb|AGW52051.1|  cellulose synthase 4                                  99.0    3e-20   
gb|AGW52043.1|  cellulose synthase 4                                  99.0    3e-20   
gb|ADV58936.1|  cellulose synthase                                    99.0    3e-20   
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...  99.0    3e-20   
gb|AGJ71353.1|  cellulose synthase 2                                  99.0    3e-20   
ref|XP_009400930.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    3e-20   
ref|XP_009383229.1|  PREDICTED: probable cellulose synthase A cat...  98.6    3e-20   
gb|AGW52077.1|  cellulose synthase 4                                  99.0    3e-20   
ref|XP_009400929.1|  PREDICTED: cellulose synthase A catalytic su...  99.0    3e-20   
gb|AAQ63936.1|  cellulose synthase                                    99.0    3e-20   
gb|EAZ03185.1|  hypothetical protein OsI_25338                        98.6    3e-20   
gb|AFR39446.1|  cellulose synthase                                    90.9    3e-20   
ref|XP_009781299.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   
ref|XP_009781300.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   
ref|XP_010486709.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
gb|AFR39445.1|  cellulose synthase                                    90.9    4e-20   
ref|NP_001059162.1|  Os07g0208500                                     98.6    4e-20   
ref|XP_010486710.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
gb|AFI71894.1|  cellulose synthase 3                                  98.6    4e-20   
gb|AFR39471.1|  cellulose synthase                                    91.3    4e-20   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
ref|XP_008785168.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein      98.6    4e-20   
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
ref|XP_009588096.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
ref|XP_002461675.1|  hypothetical protein SORBIDRAFT_02g006290        98.6    4e-20   
ref|XP_009588107.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    4e-20   
gb|AFR39480.1|  cellulose synthase                                    91.7    4e-20   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...  98.6    4e-20   
ref|XP_009588113.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   
ref|XP_002273521.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   
ref|NP_001105621.1|  cellulose synthase-4                             98.2    4e-20   
gb|AFR39438.1|  cellulose synthase                                    91.7    5e-20   
gb|AFR39443.1|  cellulose synthase                                    90.9    5e-20   
gb|AHX74223.1|  cellulose synthase                                    98.2    5e-20   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...  98.2    5e-20   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...  98.2    5e-20   
gb|AGW52072.1|  cellulose synthase 4                                  98.2    5e-20   
gb|AGW52062.1|  cellulose synthase 4                                  98.2    5e-20   
gb|AGW52045.1|  cellulose synthase 4                                  98.2    5e-20   
ref|XP_006657551.1|  PREDICTED: probable cellulose synthase A cat...  98.2    5e-20   
gb|AFR39472.1|  cellulose synthase                                    91.7    5e-20   
gb|AGW52047.1|  cellulose synthase 4                                  98.2    5e-20   
gb|AGW52042.1|  cellulose synthase 4                                  98.2    5e-20   
gb|AAK76634.2|  putative cellulose synthase catalytic subunit         91.3    5e-20   
gb|AFR39441.1|  cellulose synthase                                    91.3    5e-20   
gb|AGW52040.1|  cellulose synthase 4                                  98.2    5e-20   
gb|ACT78709.1|  cellulose synthase 4                                  98.2    5e-20   
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
ref|XP_010091161.1|  OsCesA7 protein                                  98.2    5e-20   
gb|AFR39469.1|  cellulose synthase                                    91.7    5e-20   
ref|XP_004247500.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
gb|AGW52078.1|  cellulose synthase 4                                  98.2    5e-20   
gb|AGW52058.1|  cellulose synthase 4                                  98.2    5e-20   
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
gb|AHY28743.1|  cellulose synthase                                    90.1    5e-20   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  98.2    5e-20   
gb|AFG25777.1|  cellulose synthase 3                                  98.2    5e-20   
ref|XP_006403149.1|  hypothetical protein EUTSA_v10003137mg           98.2    5e-20   
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
gb|AAY43220.1|  cellulose synthase BoCesA4                            98.2    5e-20   
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    5e-20   
gb|AGW52039.1|  cellulose synthase 4                                  98.2    6e-20   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  98.2    6e-20   
ref|XP_003574029.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    6e-20   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit             97.8    6e-20   
gb|AGG91493.1|  cellulose synthase A4                                 97.8    6e-20   
emb|CBI37171.3|  unnamed protein product                              97.8    6e-20   
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
ref|XP_011080097.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
gb|EYU46412.1|  hypothetical protein MIMGU_mgv1a000605mg              97.8    6e-20   
ref|XP_006358416.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
gb|KEH32618.1|  cellulose synthase-like protein                       97.8    6e-20   
gb|AII73574.1|  cellulose synthase 7-A                                97.8    6e-20   
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936           97.8    6e-20   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
gb|AFR39455.1|  cellulose synthase                                    90.5    6e-20   
gb|AFR39452.1|  cellulose synthase                                    90.5    6e-20   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   
gb|EMT11949.1|  Cellulose synthase A catalytic subunit 7 (UDP-for...  97.8    6e-20   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...  97.8    7e-20   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    7e-20   
gb|ACT16002.1|  cellulose synthase                                    97.8    7e-20   
emb|CDX85455.1|  BnaA02g03580D                                        97.8    7e-20   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    7e-20   
gb|AFR39451.1|  cellulose synthase                                    91.3    7e-20   
gb|ACZ82298.1|  cellulose synthase                                    97.8    7e-20   
tpg|DAA52080.1|  TPA: cellulose synthase5                             97.8    7e-20   
gb|AFR39202.1|  cellulose synthase                                    89.7    7e-20   
emb|CDP03783.1|  unnamed protein product                              97.8    7e-20   
ref|XP_004955797.1|  PREDICTED: probable cellulose synthase A cat...  97.8    7e-20   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g           97.8    7e-20   
ref|NP_001104955.1|  cellulose synthase5                              97.8    7e-20   
gb|AFR39195.1|  cellulose synthase                                    89.7    7e-20   
ref|XP_010063851.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    8e-20   
ref|XP_004965847.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    8e-20   
ref|XP_004965846.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    8e-20   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  97.8    8e-20   
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698            97.8    8e-20   
gb|EMT09789.1|  Putative cellulose synthase A catalytic subunit 8...  97.8    8e-20   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  97.4    8e-20   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit              97.4    8e-20   
gb|AFV91430.1|  cellulose synthase CesA2                              89.0    8e-20   
dbj|BAD06322.1|  putative cellulose synthase                          97.4    8e-20   
ref|XP_002983952.1|  family 2 glycosyltransferase                     97.4    8e-20   
gb|AEE60897.1|  cellulose synthase                                    97.4    8e-20   
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    8e-20   
gb|AFR39185.1|  cellulose synthase                                    89.7    8e-20   
gb|AAX18648.1|  cellulose synthase catalytic subunit                  97.4    9e-20   
ref|XP_004499618.1|  PREDICTED: probable cellulose synthase A cat...  97.4    9e-20   
ref|XP_003638289.1|  hypothetical protein MTR_125s1017                94.0    9e-20   
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    9e-20   
gb|AFZ78551.1|  cellulose synthase                                    97.4    9e-20   
gb|AFR39205.1|  cellulose synthase                                    89.4    9e-20   
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2      97.4    9e-20   
gb|ADI99492.1|  cellulose synthase                                    97.4    9e-20   
gb|AAR29967.1|  putative cellulose synthase catalytic subunit         97.4    9e-20   
ref|XP_002325122.1|  cellulose synthase family protein                97.4    1e-19   
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1       97.4    1e-19   
gb|AEK31218.1|  cellulose synthase A                                  97.4    1e-19   
dbj|BAG06271.1|  cellulose synthase Z811                              92.8    1e-19   
gb|ADH95191.1|  cellulose synthase                                    97.4    1e-19   
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...  97.4    1e-19   
gb|ABY25277.1|  cellulose synthase                                    97.4    1e-19   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g           97.4    1e-19   
ref|XP_007028786.1|  Cellulose synthase family protein                97.4    1e-19   
ref|XP_006650766.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...  97.4    1e-19   
gb|AAY43218.1|  cellulose synthase BoCesA2                            97.4    1e-19   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990        97.4    1e-19   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...  97.4    1e-19   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
gb|ACN27465.1|  unknown                                               92.0    1e-19   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
gb|EPS60781.1|  hypothetical protein M569_14019                       97.1    1e-19   
gb|AAY43217.1|  cellulose synthase BoCesA1                            97.1    1e-19   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
ref|XP_002526560.1|  Cellulose synthase A catalytic subunit 6 [UD...  97.1    1e-19   
gb|EEC67136.1|  hypothetical protein OsI_33963                        97.1    1e-19   
ref|NP_001064811.1|  Os10g0467800                                     97.1    1e-19   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...  97.1    1e-19   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...  97.1    1e-19   
gb|EEE51108.1|  hypothetical protein OsJ_31839                        97.1    1e-19   
gb|AAY43222.1|  cellulose synthase BoCesA5                            97.1    1e-19   
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
ref|XP_010696484.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
gb|EMT03676.1|  Putative cellulose synthase A catalytic subunit 1...  97.1    1e-19   
gb|AAV36241.1|  cellulose synthase                                    90.5    1e-19   
ref|NP_001054788.1|  Os05g0176100                                     97.1    1e-19   
ref|XP_007050192.1|  Cellulose synthase A4 isoform 2                  97.1    1e-19   
ref|NP_001104959.1|  cellulose synthase-9                             97.1    1e-19   
gb|AAM26299.1|  cellulose synthase                                    97.1    1e-19   
gb|AHY28737.1|  cellulose synthase                                    89.4    1e-19   
ref|XP_007050191.1|  Cellulose synthase A4 isoform 1                  97.1    1e-19   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
gb|EPS65651.1|  hypothetical protein M569_09122                       97.1    1e-19   
gb|AAY43216.1|  cellulose synthase BoCesA8                            97.1    1e-19   
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   
gb|ADD71499.1|  cellulose synthase catalytic subunit                  97.1    1e-19   
gb|ABI78958.1|  cellulose synthase 5                                  97.1    1e-19   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...  96.7    1e-19   
ref|XP_004981340.1|  PREDICTED: probable cellulose synthase A cat...  96.7    2e-19   
gb|AEE60896.1|  cellulose synthase                                    96.7    2e-19   
gb|AAT66941.1|  CesA2                                                 96.7    2e-19   
gb|AGX27214.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27201.1|  cellulose synthase 7                                  96.7    2e-19   
ref|XP_006354075.1|  PREDICTED: probable cellulose synthase A cat...  96.7    2e-19   
gb|AGX27238.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27233.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27229.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27223.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27220.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27219.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27216.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27215.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27211.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27207.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27206.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27202.1|  cellulose synthase 7                                  96.7    2e-19   
gb|AGX27199.1|  cellulose synthase 7                                  96.7    2e-19   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g           96.7    2e-19   



>gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata]
Length=1087

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG MGKQN +PTII+VWSILLASIFSLLWVRINPF++R G+VLEVCGLD
Sbjct  1026  IWVIVHLYPFLKGFMGKQNRLPTIIIVWSILLASIFSLLWVRINPFLARGGIVLEVCGLD  1085

Query  364   C  362
             C
Sbjct  1086  C  1086



>ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1084

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG MGKQ+ +PTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD
Sbjct  1023  LWVIVHLYPFLKGFMGKQDRLPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  1082

Query  364   CE  359
             C+
Sbjct  1083  CD  1084



>ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis]
Length=1092

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG MGKQ+ +PTII+VW+ILLASI +LLWVRINPF+S+DG+VLEVCGLD
Sbjct  1031  LWVIVHLYPFLKGFMGKQDRLPTIIIVWAILLASILTLLWVRINPFISKDGIVLEVCGLD  1090

Query  364   C  362
             C
Sbjct  1091  C  1091



>gb|AFD33697.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1092

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG MGKQ+ +PTII+VW+ILLASI +LLWVRINPF+S+DG+VLEVCGLD
Sbjct  1031  LWVIVHLYPFLKGFMGKQDRLPTIIIVWAILLASILTLLWVRINPFISKDGIVLEVCGLD  1090

Query  364   C  362
             C
Sbjct  1091  C  1091



>ref|XP_003536418.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN17022.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1095

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ GVPTII+VW+ILLASIFSLLWVRINPF+S+ G+VLE+CGL+
Sbjct  1034  LWVIVHLYPFLKGVMGKQEGVPTIILVWAILLASIFSLLWVRINPFLSKGGIVLELCGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_009782822.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1091

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTIIVVWSILLASIFSLLWVR+NPF +R GLVLEVCGLD
Sbjct  1030  LWVIVHLYPFLKGVMGRQNKVPTIIVVWSILLASIFSLLWVRVNPFTARGGLVLEVCGLD  1089

Query  364   CE  359
             CE
Sbjct  1090  CE  1091



>gb|AFY06685.1| cellulose synthase [Nicotiana tabacum]
Length=1091

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTIIVVWSILLASIFSLLWVR+NPF +R GLVLEVCGLD
Sbjct  1030  LWVIVHLYPFLKGVMGRQNKVPTIIVVWSILLASIFSLLWVRVNPFTARGGLVLEVCGLD  1089

Query  364   CE  359
             CE
Sbjct  1090  CE  1091



>gb|AEI87569.1| cellulose synthase catalytic subunit protein [Nicotiana tabacum]
Length=1091

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTIIVVWSILLASIFSLLWVR+NPF +R GLVLEVCGLD
Sbjct  1030  LWVIVHLYPFLKGVMGRQNKVPTIIVVWSILLASIFSLLWVRVNPFTARGGLVLEVCGLD  1089

Query  364   CE  359
             CE
Sbjct  1090  CE  1091



>gb|AAK49454.1|AF304374_1 cellulose synthase catalytic subunit [Nicotiana alata]
Length=1091

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTIIVVWSILLASIFSLLWVR+NPF +R GLVLEVCGLD
Sbjct  1030  LWVIVHLYPFLKGVMGRQNKVPTIIVVWSILLASIFSLLWVRVNPFTARGGLVLEVCGLD  1089

Query  364   CE  359
             CE
Sbjct  1090  CE  1091



>ref|XP_009609627.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1087

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTIIVVWSILLASIFSLLWVR+NPF +R GLVLEVCGLD
Sbjct  1026  LWVIVHLYPFLKGVMGRQNKVPTIIVVWSILLASIFSLLWVRVNPFTARGGLVLEVCGLD  1085

Query  364   CE  359
             CE
Sbjct  1086  CE  1087



>gb|AES62337.2| cellulose synthase-like protein [Medicago truncatula]
Length=1093

 Score =   115 bits (289),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MGKQ GVPTII+VW+ILLASIFSLLWVRINPFVS++ +VLE+CGL+
Sbjct  1032  LWVILHLYPFLKGVMGKQEGVPTIILVWAILLASIFSLLWVRINPFVSKNDIVLELCGLN  1091

Query  364   CE  359
             C+
Sbjct  1092  CD  1093



>ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1092

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG MGKQ+ +PTIIVVWSILLASIFSLLWVRINPF+SRDG+VLEVCGLD
Sbjct  1031  IWVIVHLYPFLKGFMGKQDRLPTIIVVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLD  1090

Query  364   CE  359
             C+
Sbjct  1091  CD  1092



>gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=1093

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG MGKQ+G+PTII+VWSILLASIFSLLWVRINPFVSR G+VLEVCGLD
Sbjct  1032  LWVIVHLYPFLKGFMGKQSGLPTIIIVWSILLASIFSLLWVRINPFVSRGGVVLEVCGLD  1091

Query  364   C  362
             C
Sbjct  1092  C  1092



>gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Genlisea aurea]
Length=522

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            +WVIVHLYPFLKG MG+Q+ +PTI++VW+ILLASIFSLLWVR+NPF+SRDGLVLEVCGL+
Sbjct  461  IWVIVHLYPFLKGFMGRQDRIPTIVIVWTILLASIFSLLWVRVNPFLSRDGLVLEVCGLN  520

Query  364  CE  359
            CE
Sbjct  521  CE  522



>gb|AGV22110.1| cellulose synthase 8 [Betula luminifera]
Length=1091

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGMMGKQ+ +PTI+VVWSILLASIFSLLWVRINPF+SR G+VLEVCGL+
Sbjct  1030  LWVIVHLYPFLKGMMGKQDKIPTIVVVWSILLASIFSLLWVRINPFLSRGGIVLEVCGLN  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1095

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLWVRINPF+S+DG VLEVCGLD
Sbjct  1033  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWVRINPFLSKDGPVLEVCGLD  1092

Query  364   CE  359
             C+
Sbjct  1093  CD  1094



>ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
Length=1096

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLWVR+NPFVS+ G+VLEVCGLD
Sbjct  1035  LWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWVRVNPFVSKGGIVLEVCGLD  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKGMMGKQ+ +PTII+VWSILLASIFSLLWVRINPF +R G+VLEVCGLD
Sbjct  1041  LWVIMHLYPFLKGMMGKQDRLPTIIIVWSILLASIFSLLWVRINPFTARGGIVLEVCGLD  1100

Query  364   CE  359
             C+
Sbjct  1101  CD  1102



>emb|CDP11417.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MG+Q+ +PTIIVVWSILLASIFSLLWVRINPFV+++G+VLE+CGLD
Sbjct  1035  FWVIVHLYPFLKGLMGRQDRLPTIIVVWSILLASIFSLLWVRINPFVNKNGIVLEICGLD  1094

Query  364   CE  359
             CE
Sbjct  1095  CE  1096



>gb|AFZ78560.1| cellulose synthase [Populus tomentosa]
Length=1093

 Score =   112 bits (280),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG +GKQ+ +PTII+VWSILLAS+ +LLWVRINPFVS+ G+VLEVCGLD
Sbjct  1032  LWVIVHLYPFLKGWIGKQDRLPTIILVWSILLASVLTLLWVRINPFVSKGGIVLEVCGLD  1091

Query  364   C  362
             C
Sbjct  1092  C  1092



>ref|XP_007151999.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
 gb|ESW23993.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
Length=1089

 Score =   112 bits (280),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ GVPTII+VW+ILLASI +LLWVRINPF++++ +VLE+CGL 
Sbjct  1028  LWVIVHLYPFLKGVMGKQEGVPTIILVWAILLASILTLLWVRINPFLAKNDIVLEICGLK  1087

Query  364   CE  359
             C+
Sbjct  1088  CD  1089



>ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKGMMG+Q+ +PTII+VWSILLASIFSLLWVRINPF +R G+VLEVCGLD
Sbjct  1041  LWVIMHLYPFLKGMMGRQDRLPTIIIVWSILLASIFSLLWVRINPFTARGGIVLEVCGLD  1100

Query  364   CE  359
             C+
Sbjct  1101  CD  1102



>ref|XP_007143558.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
 gb|ESW15552.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
Length=1093

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ GVPTII+VWSILLASIFSLLWVRINPF+S+D +VLE+CGL+
Sbjct  1032  LWVIVHLYPFLKGVMGKQEGVPTIILVWSILLASIFSLLWVRINPFLSKDDIVLELCGLN  1091

Query  364   CE  359
             C+
Sbjct  1092  CD  1093



>gb|KCW57899.1| hypothetical protein EUGRSUZ_H006461, partial [Eucalyptus grandis]
Length=262

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVIVHLYPFLKG MGKQ+ +PTII+VW+ILLASI +LLWV+INPF+S+DG+VLEVCGLD
Sbjct  201  LWVIVHLYPFLKGFMGKQDRLPTIIIVWAILLASILTLLWVQINPFMSKDGIVLEVCGLD  260

Query  364  CE  359
            C 
Sbjct  261  CN  262



>dbj|BAG06272.1| cellulose synthase Z632 [Zinnia elegans]
Length=1090

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVI+HLYPFLKGMMGKQN VPTI++VWSILLASIFSLLWVR+NPF+ R G+VLEVC LD
Sbjct  1029  IWVILHLYPFLKGMMGKQNSVPTILIVWSILLASIFSLLWVRVNPFLDRGGIVLEVCQLD  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>ref|XP_010912005.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Elaeis guineensis]
Length=1099

 Score =   110 bits (275),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             +WVI+HLYPFLKGMMGKQ+ VPTI+VVWSILLASI SLLWVR+NPF S+ DG +LEVCGL
Sbjct  1037  IWVIMHLYPFLKGMMGKQDRVPTIVVVWSILLASICSLLWVRVNPFTSKYDGPILEVCGL  1096

Query  367   DCE  359
             +C+
Sbjct  1097  NCD  1099



>ref|XP_008785840.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1099

 Score =   110 bits (274),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVI+HLYPFLKGMMGKQ+ VPTI++VWSILLASI SLLWVR+NPF S+ DG VLEVCGL
Sbjct  1037  FWVIMHLYPFLKGMMGKQDRVPTIVIVWSILLASICSLLWVRVNPFTSKYDGPVLEVCGL  1096

Query  367   DCE  359
             +C+
Sbjct  1097  NCD  1099



>ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1093

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ VPTIIVVWSILLASIFSLLWVRINPF+++ G+VLEVCGL+
Sbjct  1031  FWVIVHLYPFLKGLMGKQDRVPTIIVVWSILLASIFSLLWVRINPFLAKGGIVLEVCGLN  1090

Query  364   CE  359
             C+
Sbjct  1091  CD  1092



>ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKGM+G+ + +PTII+VWSILLASIFSLLWVRINPF SR G+VLEVCGLD
Sbjct  1032  IWVIVHLYPFLKGMVGRNDRLPTIIIVWSILLASIFSLLWVRINPFASRGGIVLEVCGLD  1091

Query  364   CE  359
             C+
Sbjct  1092  CD  1093



>gb|KEH43649.1| cellulose synthase-like protein [Medicago truncatula]
Length=1097

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MGKQ GVPTII+VW+ILLASIFSLLWVRINPFVS++ +VLE+CGL+
Sbjct  1036  LWVILHLYPFLKGVMGKQEGVPTIILVWAILLASIFSLLWVRINPFVSKNDIVLELCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
 ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Prunus mume]
 gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
Length=1096

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFVS+ G+VLEVCGLD
Sbjct  1035  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVSKGGIVLEVCGLD  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|XP_003592086.1| Cellulose synthase [Medicago truncatula]
Length=1135

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MGKQ GVPTII+VW+ILLASIFSLLWVRINPFVS++ +VLE+CGL+
Sbjct  1074  LWVILHLYPFLKGVMGKQEGVPTIILVWAILLASIFSLLWVRINPFVSKNDIVLELCGLN  1133

Query  364   CE  359
             C+
Sbjct  1134  CD  1135



>ref|XP_006847152.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
 gb|ERN08733.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
Length=1087

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKGMMGKQN  PTIIVVWSILLASIFSLLWVRINPF+++ DG +LEVCGL
Sbjct  1025  FWVIVHLYPFLKGMMGKQNRTPTIIVVWSILLASIFSLLWVRINPFLAKSDGPLLEVCGL  1084

Query  367   DCE  359
             DC+
Sbjct  1085  DCD  1087



>ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1094

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MGKQ   PTI+VVWSILLAS+ +LLWVR+NPFVSRDG VLEVCGL+
Sbjct  1032  LWVIIHLYPFLKGLMGKQERTPTIVVVWSILLASVLTLLWVRVNPFVSRDGPVLEVCGLN  1091

Query  364   CE  359
             C+
Sbjct  1092  CD  1093



>gb|KJB59452.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1035

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  974   FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1033

Query  364   CE  359
             C+
Sbjct  1034  CD  1035



>gb|ACS68195.1| cellulose synthase 5.1 catalytic subunit [Brassica napus]
Length=1070

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPF+KG++GKQN +PTII+VWSILLASI +LLWVR+NPFV++ G  LE+CGLD
Sbjct  1009  LWVILHLYPFVKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVAKGGPTLEICGLD  1068

Query  364   C  362
             C
Sbjct  1069  C  1069



>ref|XP_007019545.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOY16770.1| Cellulose synthase 6 [Theobroma cacao]
Length=1091

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  1030  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>emb|CDX81145.1| BnaC03g03990D [Brassica napus]
Length=1070

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPF+KG++GKQN +PTII+VWSILLASI +LLWVR+NPFV++ G  LE+CGLD
Sbjct  1009  LWVILHLYPFVKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVAKGGPTLEICGLD  1068

Query  364   C  362
             C
Sbjct  1069  C  1069



>gb|KJB59451.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1064

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  1003  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1062

Query  364   CE  359
             C+
Sbjct  1063  CD  1064



>gb|KJB59449.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1090

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  1029  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>emb|CDY56540.1| BnaA03g55860D [Brassica napus]
Length=1074

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPF+KG++GKQN +PTII+VWSILLASI +LLWVR+NPFV++ G  LE+CGLD
Sbjct  1013  LWVILHLYPFVKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVAKGGPTLEICGLD  1072

Query  364   C  362
             C
Sbjct  1073  C  1073



>gb|KHG29218.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1090

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  1029  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>gb|AFB18639.1| CESA9 [Gossypium hirsutum]
Length=1090

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG+MGKQ+ +PTIIVVWSILLASIFSLLW R+NPF+S+ G+VLEVCGL+
Sbjct  1029  FWVIVHLYPFLKGLMGKQDRLPTIIVVWSILLASIFSLLWARVNPFISKGGIVLEVCGLN  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>ref|XP_010027732.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW54322.1| hypothetical protein EUGRSUZ_I00286 [Eucalyptus grandis]
Length=1092

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG++GKQ+ +PTI+VVWSILLASI +LLWVRINPFVSRDG VLEVCGL+
Sbjct  1031  FWVIVHLYPFLKGLLGKQDRMPTIVVVWSILLASILTLLWVRINPFVSRDGPVLEVCGLN  1090

Query  364   CE  359
             C+
Sbjct  1091  CD  1092



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MGKQ   PTI++VWSILLAS+ +LLWVR+NPFVSRDG VLEVCGL+
Sbjct  1032  LWVIIHLYPFLKGLMGKQERTPTIVIVWSILLASVLTLLWVRVNPFVSRDGPVLEVCGLN  1091

Query  364   CE  359
             C+
Sbjct  1092  CD  1093



>ref|XP_004141979.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 ref|XP_004160480.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 gb|KGN48397.1| hypothetical protein Csa_6G486700 [Cucumis sativus]
Length=1090

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVRINPFVS+DG VLEVCGL+
Sbjct  1029  LWVIIHLYPFLKGLLGKQDRLPTIIVVWSILLASILTLLWVRINPFVSKDGPVLEVCGLN  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>ref|NP_179768.1| cellulose synthase A9 [Arabidopsis thaliana]
 sp|Q9SJ22.1|CESA9_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
9 [UDP-forming]; Short=AtCesA9 [Arabidopsis thaliana]
 gb|AAD20396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07220.1| cellulose synthase A9 [Arabidopsis thaliana]
Length=1088

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ VPTII+VWSILLASI +LLWVR+NPFVS+DG VLE+CGLD
Sbjct  1026  LWVIVHLYPFLKGLLGKQDRVPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEICGLD  1085

Query  364   C  362
             C
Sbjct  1086  C  1086



>ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFVS+ G+VLEVCGLD
Sbjct  1034  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVSKGGIVLEVCGLD  1093

Query  364   C  362
             C
Sbjct  1094  C  1094



>ref|XP_008440995.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cucumis melo]
Length=1091

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVRINPFVS+DG VLEVCGL+
Sbjct  1030  LWVIIHLYPFLKGLLGKQDRLPTIIVVWSILLASILTLLWVRINPFVSKDGPVLEVCGLN  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>gb|ABK95901.1| unknown [Populus trichocarpa]
Length=184

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVS+ G VLE+CGL+
Sbjct  123  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSKGGPVLELCGLN  182

Query  364  CE  359
            C+
Sbjct  183  CD  184



>gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas]
Length=1097

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGLD
Sbjct  1036  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLD  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas]
Length=1092

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVI HLYPFLKG+M KQ+ VPTI+VVW+ILLASIFSLLWVR+NPF+S+DG+VLE+CGL+
Sbjct  1031  VWVIAHLYPFLKGLMAKQDRVPTIVVVWAILLASIFSLLWVRVNPFLSKDGIVLEICGLN  1090

Query  364   CE  359
             C+
Sbjct  1091  CD  1092



>ref|XP_006367803.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1091

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MG+QN VPTII+VWSILLASI SLLWVR+NPF ++ GL LEVCGLD
Sbjct  1030  LWVIVHLYPFLKGVMGRQNNVPTIIIVWSILLASICSLLWVRLNPFTAKGGLSLEVCGLD  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>ref|XP_010070596.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming] [Eucalyptus grandis]
 gb|KCW59458.1| hypothetical protein EUGRSUZ_H02200 [Eucalyptus grandis]
Length=582

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVIVH+YPFLKG MGKQ+ +PTII+VW+ILLASI +LLWVRINPF+S+DG+V EVCGLD
Sbjct  521  LWVIVHMYPFLKGFMGKQDRLPTIIIVWAILLASILTLLWVRINPFISKDGIVQEVCGLD  580

Query  364  CE  359
            C 
Sbjct  581  CN  582



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTI++VWSILLASI +LLWVR+NPFVSRDG VLE+CGL+
Sbjct  1035  LWVIIHLYPFLKGLLGKQDRMPTIVLVWSILLASILTLLWVRVNPFVSRDGPVLEICGLN  1094

Query  364   CE  359
             CE
Sbjct  1095  CE  1096



>ref|XP_009131129.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Brassica rapa]
Length=1072

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPF+KG++GKQN +PTII+VWSILLASI +LLWVR+NPFV + G  LE+CGLD
Sbjct  1011  LWVILHLYPFVKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVGKGGPTLEICGLD  1070

Query  364   C  362
             C
Sbjct  1071  C  1071



>ref|XP_004237809.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1090

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG MG+QN VPTII+VWSILLASI SLLWVR+NPF ++ GL LEVCGLD
Sbjct  1029  LWVIVHLYPFLKGCMGRQNNVPTIIIVWSILLASICSLLWVRLNPFTAKGGLSLEVCGLD  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>ref|XP_006394117.1| hypothetical protein EUTSA_v100035741mg, partial [Eutrema salsugineum]
 gb|ESQ31403.1| hypothetical protein EUTSA_v100035741mg, partial [Eutrema salsugineum]
Length=229

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  168  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  227

Query  364  C  362
            C
Sbjct  228  C  228



>ref|XP_010927397.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Elaeis guineensis]
Length=1097

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             +WVI+HLYPFLKGMMGKQ+ +PTII+VWSILLASI SLLWVR+NPF S+ DG  L VCGL
Sbjct  1035  IWVIMHLYPFLKGMMGKQDRLPTIIIVWSILLASICSLLWVRVNPFTSKYDGPALVVCGL  1094

Query  367   DCE  359
             DC+
Sbjct  1095  DCD  1097



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVSRDG VLEVCGL+
Sbjct  1036  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSRDGPVLEVCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVSRDG VLEVCGL+
Sbjct  1036  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSRDGPVLEVCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVSRDG VLEVCGL+
Sbjct  1035  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSRDGPVLEVCGLN  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|XP_008233413.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Prunus mume]
Length=1099

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVR++PF+++ DG VLE CGL
Sbjct  1037  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPVLEECGL  1096

Query  367   DCE  359
             DC+
Sbjct  1097  DCQ  1099



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVSRDG VLEVCGL+
Sbjct  1035  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSRDGPVLEVCGLN  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFV++ G+VLEVCGLD
Sbjct  1034  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLD  1093

Query  364   C  362
             C
Sbjct  1094  C  1094



>gb|AFV91431.1| cellulose synthase CesA2, partial [Salix hybrid cultivar]
 gb|AFV91439.1| cellulose synthase CesA2, partial [Salix x laurina]
Length=58

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -3

Query  532  VHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCE  359
            VHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+C+
Sbjct  1    VHLYPFLKGLLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLNCD  58



>ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFV++ G+VLEVCGLD
Sbjct  1034  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLD  1093

Query  364   C  362
             C
Sbjct  1094  C  1094



>ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFV++ G+VLEVCGLD
Sbjct  1034  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLD  1093

Query  364   C  362
             C
Sbjct  1094  C  1094



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVSRDG VLE+CGL+
Sbjct  1034  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSRDGPVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG++G+Q  +PTIIVVWSILLASIFSLLWVRINPFV++ G+VLEVCGLD
Sbjct  1034  IWVIVHLYPFLKGLVGRQERLPTIIVVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLD  1093

Query  364   C  362
             C
Sbjct  1094  C  1094



>ref|XP_010266321.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   106 bits (265),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1021  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1080

Query  367   DC  362
             DC
Sbjct  1081  DC  1082



>gb|EYU31127.1| hypothetical protein MIMGU_mgv1a000549mg [Erythranthe guttata]
Length=1082

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG+ GKQ  VPT+IV+WS+LLASI +L+WVRINPFVSRDG +LE+CGLD
Sbjct  1020  IWVIVHLYPFLKGLSGKQERVPTVIVIWSVLLASILTLVWVRINPFVSRDGPILEICGLD  1079

Query  364   CE  359
             C+
Sbjct  1080  CD  1081



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTI++VWSILLASI +LLWVR+NPFVSRDG VLE+CGL+
Sbjct  1033  LWVIIHLYPFLKGLLGKQDRMPTIVLVWSILLASILTLLWVRVNPFVSRDGPVLEICGLN  1092

Query  364   CE  359
             C+
Sbjct  1093  CD  1094



>ref|XP_010312466.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MG+Q   PTI++VWSILLAS+ +LLWVR+NPFVS+DG +LEVCGLD
Sbjct  1024  LWVIIHLYPFLKGLMGRQERTPTIVIVWSILLASVLTLLWVRVNPFVSKDGPLLEVCGLD  1083

Query  364   CE  359
             C+
Sbjct  1084  CD  1085



>ref|XP_010270659.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Nelumbo nucifera]
 ref|XP_010270660.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Nelumbo nucifera]
Length=1088

 Score =   106 bits (265),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1026  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1085

Query  367   DC  362
             DC
Sbjct  1086  DC  1087



>ref|XP_002878571.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54830.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ VPTII+VWSILLASI +LLWVR+NPFVS+DG VLE+CGL+
Sbjct  1027  LWVIVHLYPFLKGLLGKQDRVPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEICGLN  1086

Query  364   C  362
             C
Sbjct  1087  C  1087



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVSRDG VLE+CGL+
Sbjct  1034  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSRDGPVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao]
Length=1096

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1034  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|KHN34038.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVSRDG VLE+CGL+
Sbjct  1034  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSRDGPVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_007210416.1| hypothetical protein PRUPE_ppa000557mg [Prunus persica]
 gb|EMJ11615.1| hypothetical protein PRUPE_ppa000557mg [Prunus persica]
Length=1097

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVR++PF+++ DG VLE CGL
Sbjct  1035  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPVLEECGL  1094

Query  367   DC  362
             DC
Sbjct  1095  DC  1096



>ref|XP_003525098.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1097

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVSRDG VLE+CGL+
Sbjct  1034  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSRDGPVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|KCW70400.1| hypothetical protein EUGRSUZ_F03635 [Eucalyptus grandis]
Length=1063

 Score =   106 bits (264),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1001  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1060

Query  367   DC  362
             DC
Sbjct  1061  DC  1062



>ref|XP_006351001.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum tuberosum]
Length=1090

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG+MG+Q   PTI++VWSILLAS+ +LLWVR+NPFVS+DG +LEVCGLD
Sbjct  1028  LWVIIHLYPFLKGLMGRQERTPTIVIVWSILLASVLTLLWVRVNPFVSKDGPLLEVCGLD  1087

Query  364   CE  359
             C+
Sbjct  1088  CD  1089



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVS+DG VLE+CGL+
Sbjct  1006  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSKDGPVLEICGLN  1065

Query  364   CE  359
             C+
Sbjct  1066  CD  1067



>ref|XP_009350646.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Pyrus x bretschneideri]
Length=1097

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG++GKQ+ +PTI+VVWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1036  FWVIVHLYPFLKGLLGKQDRMPTIVVVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>ref|XP_009350645.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVIVHLYPFLKG++GKQ+ +PTI+VVWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1038  FWVIVHLYPFLKGLLGKQDRMPTIVVVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1097

Query  364   CE  359
             C+
Sbjct  1098  CD  1099



>ref|XP_010106861.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXC12321.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1121

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVI HLYPFLKG +GKQ+ VPTI+VVW+ILLASIFSLLWVRINPFVS+  +VLEVCGLD
Sbjct  1060  IWVIAHLYPFLKGFLGKQDRVPTILVVWAILLASIFSLLWVRINPFVSKGDIVLEVCGLD  1119

Query  364   CE  359
             C+
Sbjct  1120  CD  1121



>ref|XP_009414591.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1097

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             +WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI SLLWVR+NPF+ + DG VLEVCGL
Sbjct  1035  IWVIMHLYPFLKGIVGKQDRLPTIIIVWSILLASICSLLWVRVNPFIGKYDGPVLEVCGL  1094

Query  367   DC  362
             DC
Sbjct  1095  DC  1096



>ref|XP_003557327.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming] [Brachypodium distachyon]
Length=1086

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG VLE CGL
Sbjct  1024  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPVLEQCGL  1083

Query  367   DC  362
             DC
Sbjct  1084  DC  1085



>ref|XP_010546378.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1075

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFVS+DG VLE+CGL+
Sbjct  1013  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEICGLN  1072

Query  364   CE  359
             C+
Sbjct  1073  CD  1074



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVSRDG VLEVCGL+
Sbjct  1042  FWVIMHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSRDGPVLEVCGLN  1101

Query  364   CE  359
             C+
Sbjct  1102  CD  1103



>gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=1091

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  1030  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>gb|AFV91433.1| cellulose synthase CesA2, partial [Salix hybrid cultivar]
 gb|AFV91437.1| cellulose synthase CesA2, partial [Salix cinerea]
 gb|AFV91438.1| cellulose synthase CesA2, partial [Salix babylonica]
Length=57

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  529  HLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCE  359
            HLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+C+
Sbjct  1    HLYPFLKGLLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLNCD  57



>ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=1091

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  1030  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  1089

Query  364   CE  359
             C+
Sbjct  1090  CD  1091



>ref|XP_011042869.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1093

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG +GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLEVCGLD
Sbjct  1032  LWVIVHLYPFLKGWLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEVCGLD  1091

Query  364   C  362
             C
Sbjct  1092  C  1092



>gb|AAK53023.1|AF375439_1 AT5g64740/MVP7_7 [Arabidopsis thaliana]
 gb|AAN28896.1| At5g64740/MVP7_7 [Arabidopsis thaliana]
Length=366

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  305  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  364

Query  364  C  362
            C
Sbjct  365  C  365



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFVSRDG VLE+CGL+
Sbjct  1035  LWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVSRDGPVLELCGLN  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>gb|KJB49076.1| hypothetical protein B456_008G100200 [Gossypium raimondii]
Length=508

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GK++ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  446  LWVIIHLYPFLKGLLGKEDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  505

Query  364  CE  359
            C+
Sbjct  506  CD  507



>gb|AEE60899.1| cellulose synthase [Populus tomentosa]
Length=1100

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+
Sbjct  1039  LWVIVHLYPFLKGLIGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLN  1098

Query  364   CE  359
             C+
Sbjct  1099  CD  1100



>ref|XP_002302169.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE81442.1| CesA7A-like family protein [Populus trichocarpa]
Length=1093

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG +GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLEVCGLD
Sbjct  1032  LWVIVHLYPFLKGWLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEVCGLD  1091

Query  364   C  362
             C
Sbjct  1092  C  1092



>ref|XP_002533503.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF28872.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=828

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVR+NPFVSRDG VLEVCGL+
Sbjct  767  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLIWVRVNPFVSRDGPVLEVCGLN  826

Query  364  CE  359
            C+
Sbjct  827  CD  828



>ref|XP_011044242.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1095

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+
Sbjct  1034  LWVIVHLYPFLKGLIGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|AFZ78561.1| cellulose synthase [Populus tomentosa]
Length=1097

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+
Sbjct  1036  LWVIVHLYPFLKGLIGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>gb|ACS88358.1| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=598

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  536  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  595

Query  364  CE  359
            C+
Sbjct  596  CD  597



>gb|KJB14948.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14949.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=911

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  849  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  908

Query  364  CE  359
            C+
Sbjct  909  CD  910



>ref|XP_004502891.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cicer arietinum]
Length=1084

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTI++VWSILLASI +L+WVR+NPFVSRDG VLE+CGL+
Sbjct  1021  LWVILHLYPFLKGLLGKQDRMPTIVLVWSILLASILTLMWVRVNPFVSRDGPVLEICGLN  1080

Query  364   CE  359
             C+
Sbjct  1081  CD  1082



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1033  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1092

Query  364   CE  359
             C+
Sbjct  1093  CD  1094



>gb|AAY43224.2| cellulose synthase BoCesA7 [Bambusa oldhamii]
Length=1086

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1024  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1083

Query  367   DC  362
             DC
Sbjct  1084  DC  1085



>ref|XP_010088737.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXB36918.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1082

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  1021  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLVWVRINPFVSKDGPVLEICGLN  1080

Query  364   CE  359
             C+
Sbjct  1081  CD  1082



>gb|AAT09895.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1095

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+
Sbjct  1034  LWVIVHLYPFLKGLIGKQHRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|KHG02517.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1106

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1044  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1103

Query  364   CE  359
             C+
Sbjct  1104  CD  1105



>gb|ABI34115.1| cellulose synthase catalytic subunit [Brassica napus]
Length=418

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  357  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  416

Query  364  C  362
            C
Sbjct  417  C  417



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1033  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1092

Query  364   CE  359
             C+
Sbjct  1093  CD  1094



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1033  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1092

Query  364   CE  359
             C+
Sbjct  1093  CD  1094



>ref|XP_006664834.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming]-like [Oryza brachyantha]
Length=1093

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1031  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1090

Query  367   DC  362
             DC
Sbjct  1091  DC  1092



>ref|XP_006658446.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming]-like [Oryza brachyantha]
Length=1077

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1015  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1074

Query  367   DC  362
             DC
Sbjct  1075  DC  1076



>ref|XP_008667855.1| PREDICTED: uncharacterized protein LOC100280232 isoform X1 [Zea 
mays]
 tpg|DAA39740.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1083

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1021  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  1080

Query  367   DC  362
             DC
Sbjct  1081  DC  1082



>ref|NP_001051830.1| Os03g0837100 [Oryza sativa Japonica Group]
 sp|Q851L8.1|CESA5_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
5 [UDP-forming]; AltName: Full=OsCesA5 [Oryza sativa Japonica 
Group]
 sp|A2XNT2.1|CESA5_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
5 [UDP-forming]; AltName: Full=OsCesA5 [Oryza sativa Indica 
Group]
 gb|AAO41140.1| cellulose synthase [Oryza sativa Japonica Group]
 gb|ABF99771.1| Cellulose synthase A catalytic subunit 6, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13744.1| Os03g0837100 [Oryza sativa Japonica Group]
 gb|EAY92492.1| hypothetical protein OsI_14229 [Oryza sativa Indica Group]
 gb|EAZ29219.1| hypothetical protein OsJ_13280 [Oryza sativa Japonica Group]
Length=1092

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1030  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1089

Query  367   DC  362
             DC
Sbjct  1090  DC  1091



>ref|NP_001059487.1| Os07g0424400 [Oryza sativa Japonica Group]
 sp|Q69V23.1|CESA3_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
3 [UDP-forming]; AltName: Full=OsCesA3 [Oryza sativa Japonica 
Group]
 dbj|BAD30574.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAF21401.1| Os07g0424400 [Oryza sativa Japonica Group]
 dbj|BAH00360.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1093

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1031  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1090

Query  367   DC  362
             DC
Sbjct  1091  DC  1092



>ref|XP_002466137.1| hypothetical protein SORBIDRAFT_01g002050 [Sorghum bicolor]
 gb|EER93135.1| hypothetical protein SORBIDRAFT_01g002050 [Sorghum bicolor]
Length=1090

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1028  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  1087

Query  367   DC  362
             DC
Sbjct  1088  DC  1089



>gb|KJB49075.1| hypothetical protein B456_008G100200 [Gossypium raimondii]
Length=707

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GK++ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  645  LWVIIHLYPFLKGLLGKEDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  704

Query  364  CE  359
            C+
Sbjct  705  CD  706



>gb|KHN41284.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=847

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVIVHLYPFLKG+MGKQ GVPTII+VW+ILLASI +LLWVRINPF++++ +VLE+CGL+
Sbjct  786  LWVIVHLYPFLKGVMGKQEGVPTIILVWAILLASILTLLWVRINPFLAKNDVVLEICGLN  845

Query  364  CE  359
            C+
Sbjct  846  CD  847



>ref|NP_001104957.1| cellulose synthase7 [Zea mays]
 gb|AAF89967.1|AF200531_1 cellulose synthase-7 [Zea mays]
 tpg|DAA60394.1| TPA: cellulose synthase7 [Zea mays]
Length=1086

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1024  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  1083

Query  367   DC  362
             DC
Sbjct  1084  DC  1085



>gb|KJB18373.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1082

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  1020  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  1079

Query  364   CE  359
             C+
Sbjct  1080  CD  1081



>gb|KCW87523.1| hypothetical protein EUGRSUZ_B03971 [Eucalyptus grandis]
Length=788

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  726  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPLLEECGL  785

Query  367  DC  362
            DC
Sbjct  786  DC  787



>ref|XP_002524299.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF38039.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1095

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  541   WVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDC  362
             WVI+HLYPFLKG +GKQ+ +PTII+VWSILLASI SLLWVR+NPFVSR GL LEVCGLDC
Sbjct  1035  WVILHLYPFLKGFLGKQDRLPTIILVWSILLASICSLLWVRLNPFVSRGGLALEVCGLDC  1094

Query  361   E  359
             +
Sbjct  1095  D  1095



>ref|XP_003548102.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ GVPTII+VW+ILLASI +LLWVRINPF++++ +VLE+CGL+
Sbjct  1017  LWVIVHLYPFLKGVMGKQEGVPTIILVWAILLASILTLLWVRINPFLAKNDVVLEICGLN  1076

Query  364   CE  359
             C+
Sbjct  1077  CD  1078



>emb|CDP12843.1| unnamed protein product [Coffea canephora]
Length=1093

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG+ GKQ   PTII+VWSILLASI +LLWVR+NPFVSRDG VLE+CGL+
Sbjct  1031  FWVILHLYPFLKGLTGKQERTPTIIIVWSILLASIITLLWVRVNPFVSRDGPVLEICGLN  1090

Query  364   CE  359
             C+
Sbjct  1091  CD  1092



>ref|XP_011466718.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=1097

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILL+SI +L+WVRINPFVSRDG VLEVCGL+
Sbjct  1036  FWVIMHLYPFLKGLLGKQDRMPTIILVWSILLSSILTLMWVRINPFVSRDGPVLEVCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>gb|KJB18370.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1096

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+CGL+
Sbjct  1034  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_009411928.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1096

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKGMMGKQ+ VPTI++VWSILLASI SLLWVR+NPF+++ DG VLEVCGL
Sbjct  1034  FWVIVHLYPFLKGMMGKQDRVPTIVIVWSILLASICSLLWVRVNPFIAKYDGPVLEVCGL  1093

Query  367   DC  362
             DC
Sbjct  1094  DC  1095



>ref|XP_006651997.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming]-like [Oryza brachyantha]
Length=1100

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1038  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1097

Query  367   DC  362
             DC
Sbjct  1098  DC  1099



>gb|EEE67058.1| hypothetical protein OsJ_24012 [Oryza sativa Japonica Group]
Length=1117

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1055  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1114

Query  367   DC  362
             DC
Sbjct  1115  DC  1116



>ref|XP_008648127.1| PREDICTED: cellulose synthase6 isoform X1 [Zea mays]
 tpg|DAA52376.1| TPA: cellulose synthase6 [Zea mays]
Length=1089

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1027  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  1086

Query  367   DC  362
             DC
Sbjct  1087  DC  1088



>ref|XP_004981131.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming]-like isoform X2 [Setaria italica]
Length=1121

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1059  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1118

Query  367   DC  362
             DC
Sbjct  1119  DC  1120



>gb|EEC81812.1| hypothetical protein OsI_25542 [Oryza sativa Indica Group]
Length=1024

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ +G +LE CGL
Sbjct  962   FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNNGPLLEECGL  1021

Query  367   DC  362
             DC
Sbjct  1022  DC  1023



>gb|ACZ82299.1| cellulose synthase [Phyllostachys edulis]
Length=982

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  920  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  979

Query  367  DC  362
            DC
Sbjct  980  DC  981



>ref|XP_010526630.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Tarenaya hassleriana]
Length=1073

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFVS+DG VLE+CGL+
Sbjct  1011  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEICGLN  1070

Query  364   CE  359
             C+
Sbjct  1071  CD  1072



>gb|AAL24340.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AAM13307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=507

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  445  LWVIVHLYPFLKGMLGKQDKMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  504

Query  364  C  362
            C
Sbjct  505  C  505



>ref|NP_001104956.1| cellulose synthase6 [Zea mays]
 gb|AAF89966.1|AF200530_1 cellulose synthase-6 [Zea mays]
Length=1059

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  997   FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  1056

Query  367   DC  362
             DC
Sbjct  1057  DC  1058



>ref|XP_004981133.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming]-like isoform X4 [Setaria italica]
Length=1090

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1028  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGL  1087

Query  367   DC  362
             DC
Sbjct  1088  DC  1089



>ref|XP_008338760.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1097

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WV VHLYPFLKG++GKQ+ +PTI+VVWSILLASI +L+WVRINPFVS+DG VLEVCGL+
Sbjct  1036  FWVXVHLYPFLKGLLGKQDRMPTIVVVWSILLASILTLMWVRINPFVSKDGPVLEVCGLN  1095

Query  364   CE  359
             C+
Sbjct  1096  CD  1097



>ref|XP_002459635.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor]
 gb|EER96156.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor]
Length=1100

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVI+HLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1038  FWVIIHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1097

Query  367   DC  362
             DC
Sbjct  1098  DC  1099



>gb|EMT11411.1| Putative cellulose synthase A catalytic subunit 5 (UDP-forming) 
[Aegilops tauschii]
Length=1067

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASI SLLWVR+NPF+++ DG +LE CGL
Sbjct  1005  FWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIISLLWVRVNPFLAKTDGPLLEECGL  1064

Query  367   DC  362
             DC
Sbjct  1065  DC  1066



>ref|XP_002306707.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE93703.1| CesA7A-like family protein [Populus trichocarpa]
Length=1095

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPF+S+ G+VLE+CGL+
Sbjct  1034  LWVIVHLYPFLKGLIGKQDRLPTIIVVWSILLASVLTLLWVRINPFLSKGGIVLEICGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>dbj|BAJ97774.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1091

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASI SLLWVR+NPF+++ DG +LE CGL
Sbjct  1029  FWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIISLLWVRVNPFLAKTDGPLLEECGL  1088

Query  367   DC  362
             DC
Sbjct  1089  DC  1090



>gb|AAR29964.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1091

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASI SLLWVR+NPF+++ DG +LE CGL
Sbjct  1029  FWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIISLLWVRVNPFLAKTDGPLLEECGL  1088

Query  367   DC  362
             DC
Sbjct  1089  DC  1090



>ref|XP_006849886.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
 gb|ERN11467.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
Length=1095

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+SR DG VLE CGL
Sbjct  1033  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLSRSDGPVLEECGL  1092

Query  367   DC  362
             DC
Sbjct  1093  DC  1094



>ref|XP_002866842.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43101.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
Length=1084

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1022  LWVIVHLYPFLKGMLGKQDKMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1081

Query  364   C  362
             C
Sbjct  1082  C  1082



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVI+HLYPFLKG+ GKQ  VPT+IV+WSILLASI +L+WVRINPFVSRDG VLE+CGL+
Sbjct  1023  IWVIMHLYPFLKGLSGKQERVPTVIVIWSILLASILTLVWVRINPFVSRDGPVLEICGLN  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_004956060.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming]-like isoform X3 [Setaria italica]
Length=1088

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  1026  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPLLEECGL  1085

Query  367   DC  362
             DC
Sbjct  1086  DC  1087



>ref|XP_004956061.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming]-like isoform X4 [Setaria italica]
Length=1086

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  1024  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPLLEECGL  1083

Query  367   DC  362
             DC
Sbjct  1084  DC  1085



>ref|XP_004956058.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming]-like isoform X1 [Setaria italica]
Length=1117

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  1055  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPLLEECGL  1114

Query  367   DC  362
             DC
Sbjct  1115  DC  1116



>ref|NP_195645.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48947.1|CESA2_ARATH RecName: Full=Cellulose synthase A catalytic subunit 2 [UDP-forming]; 
Short=AtCesA2; Short=Ath-A [Arabidopsis thaliana]
 gb|AAC39335.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAB43650.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 emb|CAB80598.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AEE87059.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38978.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1022  LWVIVHLYPFLKGMLGKQDKMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1081

Query  364   C  362
             C
Sbjct  1082  C  1082



>ref|XP_004955913.1| PREDICTED: probable cellulose synthase A catalytic subunit 6 
[UDP-forming]-like [Setaria italica]
Length=1092

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  1030  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPLLEECGL  1089

Query  367   DC  362
             DC
Sbjct  1090  DC  1091



>ref|XP_006283042.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
 gb|EOA15940.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
Length=1084

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1022  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1081

Query  364   C  362
             C
Sbjct  1082  C  1082



>ref|XP_010446473.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1075

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1013  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1072

Query  364   C  362
             C
Sbjct  1073  C  1073



>ref|XP_010437052.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Camelina sativa]
Length=1074

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1012  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>ref|XP_010431901.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1074

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1012  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>gb|KHG24947.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1071

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG +LE+CGL+
Sbjct  1009  FWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPLLEICGLN  1068

Query  364   CE  359
             C+
Sbjct  1069  CD  1070



>ref|NP_001059303.1| Os07g0252400 [Oryza sativa Japonica Group]
 sp|Q6YVM4.1|CESA6_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
6 [UDP-forming]; AltName: Full=OsCesA6 [Oryza sativa Japonica 
Group]
 dbj|BAC84511.1| putative cellulose synthase-8 [Oryza sativa Japonica Group]
 dbj|BAF21217.1| Os07g0252400 [Oryza sativa Japonica Group]
 gb|EEE66900.1| hypothetical protein OsJ_23733 [Oryza sativa Japonica Group]
Length=1092

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ +G +LE CGL
Sbjct  1030  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKNNGPLLEECGL  1089

Query  367   DC  362
             DC
Sbjct  1090  DC  1091



>gb|AIA61439.1| cellulose synthase [Boehmeria nivea]
Length=1090

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVIVHLYPFLKG +G+Q+ VPTI++VWSILLASIFSLLWVRINPFVS+ G++LE C LD
Sbjct  1029  IWVIVHLYPFLKGFLGRQDKVPTILIVWSILLASIFSLLWVRINPFVSKGGIILEPCMLD  1088

Query  364   CE  359
             C+
Sbjct  1089  CD  1090



>ref|XP_010484268.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Camelina sativa]
Length=1084

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_009130469.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1079

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1018  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLD  1077

Query  364   C  362
             C
Sbjct  1078  C  1078



>ref|NP_201279.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q94JQ6.2|CESA6_ARATH RecName: Full=Cellulose synthase A catalytic subunit 6 [UDP-forming]; 
Short=AtCesA6; AltName: Full=AraxCelA; AltName: Full=Isoxaben-resistant 
protein 2; AltName: Full=Protein PROCUSTE 
1; AltName: Full=Protein QUILL [Arabidopsis thaliana]
 dbj|BAB10307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED97945.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66000.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_002862432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38690.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=831

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  770  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  829

Query  364  C  362
            C
Sbjct  830  C  830



>emb|CDY46820.1| BnaC02g43280D [Brassica napus]
Length=1079

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1018  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLD  1077

Query  364   C  362
             C
Sbjct  1078  C  1078



>gb|AAC29067.1| cellulose synthase [Arabidopsis thaliana]
Length=1081

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1020  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1079

Query  364   C  362
             C
Sbjct  1080  C  1080



>emb|CDY14504.1| BnaC03g49550D [Brassica napus]
Length=1082

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1021  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLD  1080

Query  364   C  362
             C
Sbjct  1081  C  1081



>ref|XP_010462809.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1084

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_010444419.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1090

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1029  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1088

Query  364   C  362
             C
Sbjct  1089  C  1089



>ref|XP_006279743.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
 gb|EOA12641.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
Length=1084

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_002864919.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41178.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1028  LWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1087

Query  364   C  362
             C
Sbjct  1088  C  1088



>emb|CDY31305.1| BnaA02g34360D [Brassica napus]
Length=1079

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1018  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLD  1077

Query  364   C  362
             C
Sbjct  1078  C  1078



>emb|CDY42621.1| BnaC01g00330D [Brassica napus]
Length=1069

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL 
Sbjct  1007  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLS  1066

Query  364   C  362
             C
Sbjct  1067  C  1067



>gb|KFK25282.1| hypothetical protein AALP_AA8G091900 [Arabis alpina]
Length=1071

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFV++ G +LE+CGLD
Sbjct  1010  LWVILHLYPFLKGLLGKQDRMPTIIIVWSILLASILTLLWVRINPFVAKGGPILEICGLD  1069

Query  364   C  362
             C
Sbjct  1070  C  1070



>gb|AFZ78562.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVS+ G VLE+CGL+
Sbjct  1035  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSKGGPVLELCGLN  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|NP_001104958.1| cellulose synthase8 [Zea mays]
 gb|AAF89968.1|AF200532_1 cellulose synthase-8 [Zea mays]
 tpg|DAA60188.1| TPA: cellulose synthase8 [Zea mays]
Length=1094

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ +G +LE CGL
Sbjct  1032  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKSNGPLLEECGL  1091

Query  367   DC  362
             DC
Sbjct  1092  DC  1093



>ref|XP_009112155.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1083

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1022  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1081

Query  364   C  362
             C
Sbjct  1082  C  1082



>emb|CDX81249.1| BnaC09g06600D [Brassica napus]
Length=1084

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>gb|ACS68196.1| cellulose synthase 6.1 catalytic subunit [Brassica napus]
Length=1084

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>emb|CDY18696.1| BnaA09g06990D [Brassica napus]
Length=1084

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1023  LWVVIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|XP_009115076.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Brassica rapa]
Length=1074

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL 
Sbjct  1012  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLG  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>emb|CDY41973.1| BnaA01g05450D [Brassica napus]
Length=1074

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL 
Sbjct  1012  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLG  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>gb|ACS68191.1| cellulose synthase 2.1 catalytic subunit [Brassica napus]
Length=1074

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKGM+GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL 
Sbjct  1012  LWVIVHLYPFLKGMLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLG  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>gb|AAM97089.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAP68271.1| At5g09870 [Arabidopsis thaliana]
Length=346

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  285  FWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  344

Query  364  C  362
            C
Sbjct  345  C  345



>ref|XP_002310628.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91078.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVS+ G VLE+CGL+
Sbjct  1035  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSKGGPVLELCGLN  1094

Query  364   CE  359
             C+
Sbjct  1095  CD  1096



>ref|XP_002310629.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
 gb|EEE91079.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
Length=1095

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVRINPFVS+ G VLE+CGL+
Sbjct  1034  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRINPFVSKGGPVLELCGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|KDO83761.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1089

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  1028  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  1087

Query  364   C  362
             C
Sbjct  1088  C  1088



>gb|KDO83760.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1091

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  1030  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  1089

Query  364   C  362
             C
Sbjct  1090  C  1090



>ref|XP_006411737.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
 gb|ESQ53190.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
Length=1084

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++GKQ+ +PTIIVVWSILLASI +LLWVR+NPFV++ G VLE+CGL+
Sbjct  1022  LWVIVHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLN  1081

Query  364   C  362
             C
Sbjct  1082  C  1082



>ref|XP_006473074.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
Length=1091

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  1030  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  1089

Query  364   C  362
             C
Sbjct  1090  C  1090



>ref|XP_006399471.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
 gb|ESQ40924.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
Length=1073

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1012  LWVIIHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1071

Query  364   C  362
             C
Sbjct  1072  C  1072



>ref|XP_006434481.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47721.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=1091

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  1030  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  1089

Query  364   C  362
             C
Sbjct  1090  C  1090



>ref|XP_006434482.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47722.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=825

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  764  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  823

Query  364  CE  359
            C 
Sbjct  824  CN  825



>ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Sesamum indicum]
Length=1090

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             +WVI+HLYPFLKG+ GKQ+ VPT+IV+WSILLASI +L+WVR+NPF+SR+G +LE+CGL+
Sbjct  1028  IWVIMHLYPFLKGLTGKQDRVPTVIVIWSILLASILTLVWVRVNPFISREGPILEICGLN  1087

Query  364   CE  359
             C+
Sbjct  1088  CD  1089



>gb|AFV91426.1| cellulose synthase CesA2, partial [Salix hybrid cultivar]
 gb|AFV91427.1| cellulose synthase CesA2, partial [Salix triandra x Salix viminalis]
 gb|AFV91428.1| cellulose synthase CesA2, partial [Salix hybrid cultivar]
 gb|AFV91429.1| cellulose synthase CesA2, partial [Salix hybrid cultivar]
 gb|AFV91434.1| cellulose synthase CesA2, partial [Salix x smithiana]
 gb|AFV91435.1| cellulose synthase CesA2, partial [Salix caprea]
 gb|AFV91436.1| cellulose synthase CesA2, partial [Salix viminalis]
 gb|AFV91440.1| cellulose synthase CesA2, partial [Salix aurita]
 gb|AFV91443.1| cellulose synthase CesA2, partial [Salix x erdingeri]
 gb|AFV91444.1| cellulose synthase CesA2, partial [Salix gracilistyla]
 gb|AFV91445.1| cellulose synthase CesA2, partial [Salix glabra]
 gb|AFV91447.1| cellulose synthase CesA2, partial [Salix x fragilis]
Length=56

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -3

Query  526  LYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCE  359
            LYPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+C+
Sbjct  1    LYPFLKGLLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLNCD  56



>gb|KDO83765.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
 gb|KDO83766.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=964

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  903  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  962

Query  364  C  362
            C
Sbjct  963  C  963



>gb|KDO83767.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=924

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
            LWVI+HLYPFLKG +GKQ+ +PTI++VW+ILLASIFSLLW R+NPFVS+  +VLEVCGLD
Sbjct  863  LWVILHLYPFLKGFLGKQDRLPTILLVWAILLASIFSLLWARVNPFVSKGDIVLEVCGLD  922

Query  364  CE  359
            C 
Sbjct  923  CN  924



>ref|XP_010491630.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Camelina sativa]
Length=1068

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQN +PTII+VWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1007  FWVILHLYPFLKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1066

Query  364   C  362
             C
Sbjct  1067  C  1067



>ref|XP_010452989.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Camelina sativa]
Length=1068

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQN +PTII+VWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1007  FWVILHLYPFLKGLLGKQNRMPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1066

Query  364   C  362
             C
Sbjct  1067  C  1067



>ref|XP_009150553.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Brassica rapa]
Length=1082

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTII+VWSIL+ASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1021  LWVVIHLYPFLKGLLGKQDRMPTIIIVWSILIASILTLLWVRVNPFVAKGGPVLEICGLD  1080

Query  364   C  362
             C
Sbjct  1081  C  1081



>emb|CDY08854.1| BnaA06g23700D [Brassica napus]
Length=1082

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWV++HLYPFLKG++GKQ+ +PTII+VWSIL+ASI +LLWVR+NPFV++ G VLE+CGLD
Sbjct  1021  LWVVIHLYPFLKGLLGKQDRMPTIIIVWSILIASILTLLWVRVNPFVAKGGPVLEICGLD  1080

Query  364   C  362
             C
Sbjct  1081  C  1081



>gb|AFS95066.1| cellulose synthase [Rosa hybrid cultivar]
Length=1094

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1032  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1091

Query  367   DC  362
             DC
Sbjct  1092  DC  1093



>ref|XP_004300066.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Fragaria vesca subsp. vesca]
Length=1094

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1032  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1091

Query  367   DC  362
             DC
Sbjct  1092  DC  1093



>ref|XP_010270654.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Nelumbo nucifera]
Length=1088

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1026  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1085

Query  367   DC  362
             DC
Sbjct  1086  DC  1087



>gb|KHG03006.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1059

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVI+HL+PFLKG++GKQ+ +PTII+VWSILLASI +L+WVRINPFVS+DG VLE+C L+
Sbjct  997   LWVIIHLFPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRINPFVSKDGPVLEICELN  1056

Query  364   CE  359
             C+
Sbjct  1057  CD  1058



>ref|XP_002277713.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Vitis vinifera]
 ref|XP_010664050.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Vitis vinifera]
Length=1091

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1029  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1088

Query  367   DC  362
             DC
Sbjct  1089  DC  1090



>ref|XP_009372681.1| PREDICTED: LOW QUALITY PROTEIN: probable cellulose synthase A 
catalytic subunit 5 [UDP-forming] [Pyrus x bretschneideri]
Length=1101

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVI+HLYPFLKG++G+QN  PTII+VWSI+LASIFSLLWVR++PF+++ D   LE CGL
Sbjct  1039  FWVIIHLYPFLKGLLGRQNRTPTIIIVWSIMLASIFSLLWVRVDPFLAKSDDPTLEECGL  1098

Query  367   DC  362
             DC
Sbjct  1099  DC  1100



>ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1084

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ+ VPTIIVVWSILLASI SLLWVRINPFVSRDGLVLEVCGLD
Sbjct  1023  LWVIVHLYPFLKGLMGKQSNVPTIIVVWSILLASILSLLWVRINPFVSRDGLVLEVCGLD  1082

Query  364   CE  359
             CE
Sbjct  1083  CE  1084



>ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1084

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG+MGKQ+ VPTIIVVWSILLASI SLLWVRINPFVSRDGLVLEVCGLD
Sbjct  1023  LWVIVHLYPFLKGLMGKQSNVPTIIVVWSILLASILSLLWVRINPFVSRDGLVLEVCGLD  1082

Query  364   CE  359
             CE
Sbjct  1083  CE  1084



>ref|XP_010645442.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Vitis vinifera]
Length=1094

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVR++PF+++ DG VLE CGL
Sbjct  1032  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPVLEECGL  1091

Query  367   DCE  359
             DC 
Sbjct  1092  DCH  1094



>ref|XP_008796456.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Phoenix dactylifera]
Length=1090

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG VLE CGL
Sbjct  1028  FWVIVHLYPFLKGLVGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPVLEECGL  1087

Query  367   DC  362
             DC
Sbjct  1088  DC  1089



>ref|XP_009101741.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Brassica rapa]
Length=1052

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  991   FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  1050

Query  367   DC  362
             DC
Sbjct  1051  DC  1052



>ref|XP_009101742.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Brassica rapa]
Length=1051

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  990   FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  1049

Query  367   DC  362
             DC
Sbjct  1050  DC  1051



>gb|ACN34934.1| unknown [Zea mays]
Length=294

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  232  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  291

Query  367  DCE  359
            DC 
Sbjct  292  DCN  294



>ref|NP_001146633.1| uncharacterized protein LOC100280232 [Zea mays]
 gb|ACL54432.1| unknown [Zea mays]
Length=294

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  232  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLAKDDGPLLEECGL  291

Query  367  DCE  359
            DC 
Sbjct  292  DCN  294



>ref|XP_010255731.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] isoform X1 [Nelumbo nucifera]
Length=1090

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1028  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPILEDCGL  1087

Query  367   DC  362
             DC
Sbjct  1088  DC  1089



>ref|XP_010255732.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] isoform X2 [Nelumbo nucifera]
Length=1089

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1027  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPILEDCGL  1086

Query  367   DC  362
             DC
Sbjct  1087  DC  1088



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
             LWVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVRI+PF SR       CG++
Sbjct  1023  LWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSRTSTAQGQCGIN  1082

Query  364   C  362
             C
Sbjct  1083  C  1083



>ref|NP_001289648.1| probable cellulose synthase A catalytic subunit 5 [Eucalyptus 
grandis]
 gb|AAY60848.1| cellulose synthase 6 [Eucalyptus grandis]
Length=1097

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1035  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1094

Query  367   DC  362
             DC
Sbjct  1095  DC  1096



>gb|AHL45025.1| cellulose synthase 3A [Linum usitatissimum]
Length=1060

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             LWVIVHLYPFLKG+MG+QN  PTI+VVWSILLASIFSLLWVRI+PF +R  G  ++ CG+
Sbjct  999   LWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRVTGPNVDQCGI  1058

Query  367   DC  362
             +C
Sbjct  1059  NC  1060



>gb|KDP36709.1| hypothetical protein JCGZ_08000 [Jatropha curcas]
Length=1089

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1027  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1086

Query  367   DC  362
             DC
Sbjct  1087  DC  1088



>gb|KCW70399.1| hypothetical protein EUGRSUZ_F03635 [Eucalyptus grandis]
Length=1097

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1035  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1094

Query  367   DC  362
             DC
Sbjct  1095  DC  1096



>emb|CDX94752.1| BnaC07g17610D [Brassica napus]
Length=1051

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  990   FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  1049

Query  367   DC  362
             DC
Sbjct  1050  DC  1051



>gb|AFV91432.1| cellulose synthase CesA2, partial [Salix dasyclados]
Length=55

 Score = 92.0 bits (227),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -3

Query  523  YPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCE  359
            YPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+C+
Sbjct  1    YPFLKGLLGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLNCD  55



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVR+NPFVS+ G VLEVCGL+
Sbjct  1034  FWVIMHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRVNPFVSKGGPVLEVCGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>ref|XP_008459950.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Cucumis melo]
Length=1040

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MGKQN  PTI+V+WS+LLASIFSL+WVRI+PF+ +  G VL+ CG+
Sbjct  979   FWVIVHLYPFLKGLMGKQNRTPTIVVLWSVLLASIFSLVWVRIDPFLPKQTGPVLKQCGV  1038

Query  367   DC  362
             DC
Sbjct  1039  DC  1040



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +L+WVR+NPFVS+ G VLEVCGL+
Sbjct  1034  FWVIMHLYPFLKGLLGKQDRMPTIILVWSILLASILTLMWVRVNPFVSKGGPVLEVCGLN  1093

Query  364   CE  359
             C+
Sbjct  1094  CD  1095



>gb|AAQ63935.1| cellulose synthase [Pinus radiata]
Length=1096

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI++VWSILLASIFSLLWVRI+PF +R  G  L+ CG+
Sbjct  1035  FWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTTRIKGPDLQQCGI  1094

Query  367   DC  362
             +C
Sbjct  1095  NC  1096



>gb|ACS68194.1| cellulose synthase 4.2 catalytic subunit [Brassica napus]
Length=1052

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  991   FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  1050

Query  367   DC  362
             DC
Sbjct  1051  DC  1052



>ref|XP_010045345.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Eucalyptus grandis]
Length=561

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVR++PF+++ DG +LE CGL
Sbjct  499  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPLLEECGL  558

Query  367  DCE  359
            DC 
Sbjct  559  DCN  561



>ref|XP_009617929.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] isoform X1 [Nicotiana tomentosiformis]
Length=1080

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSIL+ASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1018  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILVASIFSLLWVRIDPFLAKSDGPILEECGL  1077

Query  367   DC  362
             DC
Sbjct  1078  DC  1079



>ref|XP_009617930.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] isoform X2 [Nicotiana tomentosiformis]
Length=1077

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSIL+ASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1015  FWVIVHLYPFLKGLLGRQNRTPTIIIVWSILVASIFSLLWVRIDPFLAKSDGPILEECGL  1074

Query  367   DC  362
             DC
Sbjct  1075  DC  1076



>ref|NP_196549.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q8L778.2|CESA5_ARATH RecName: Full=Cellulose synthase A catalytic subunit 5 [UDP-forming]; 
Short=AtCesA5 [Arabidopsis thaliana]
 dbj|BAB09408.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED91458.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
Length=1069

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLD  365
              WVI+HLYPFLKG++GKQ+ +PTII+VWSILLASI +LLWVR+NPFV++ G +LE+CGLD
Sbjct  1008  FWVILHLYPFLKGLLGKQDRMPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLD  1067

Query  364   C  362
             C
Sbjct  1068  C  1068



>gb|AFV91448.1| cellulose synthase CesA2, partial [Populus tremula]
Length=55

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -3

Query  523  YPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCE  359
            YPFLKG++GKQ+ +PTIIVVWSILLAS+ +LLWVRINPFVS+ G+VLE+CGL+C+
Sbjct  1    YPFLKGLIGKQDRLPTIIVVWSILLASVLTLLWVRINPFVSKGGIVLEICGLNCD  55



>emb|CDY22315.1| BnaA06g36370D [Brassica napus]
Length=938

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
             WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  877  FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  936

Query  367  DC  362
            DC
Sbjct  937  DC  938



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   100 bits (249),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSLLWVRI+PFV R  G   + CGL
Sbjct  975   FWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLASIFSLLWVRIDPFVVRAKGPDTKACGL  1034

Query  367   DC  362
             +C
Sbjct  1035  NC  1036



>ref|XP_010239070.1| PREDICTED: probable cellulose synthase A catalytic subunit 3 
[UDP-forming] [Brachypodium distachyon]
Length=915

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544  LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
             WVIVHLYPFLKG++G+QN  PTI++VWSILLASIFSLLWVR++PF+++ DG VLE CGL
Sbjct  853  FWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRVDPFLAKNDGPVLEECGL  912

Query  367  DC  362
            DC
Sbjct  913  DC  914



>ref|XP_008796554.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Phoenix dactylifera]
Length=1089

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1027  FWVIVHLYPFLKGLVGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1086

Query  367   DC  362
             DC
Sbjct  1087  DC  1088



>ref|XP_010932185.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Elaeis guineensis]
Length=1090

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1028  FWVIVHLYPFLKGLVGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1087

Query  367   DC  362
             DC
Sbjct  1088  DC  1089



>ref|XP_007138849.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
 gb|ESW10843.1| hypothetical protein PHAVU_009G242700g [Phaseolus vulgaris]
Length=1048

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MGKQN  PTI+V+WSILLASIFSL+WVRI+PF+ +  G VL+ CG+
Sbjct  987   FWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLASIFSLIWVRIDPFLPKQTGPVLKQCGV  1046

Query  367   DC  362
             +C
Sbjct  1047  EC  1048



>gb|KHN47729.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MGKQN  PTI+V+WSILLASIFSL+WVRI+PF+ +  G VL+ CG+
Sbjct  989   FWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLASIFSLIWVRIDPFLPKQTGPVLKQCGV  1048

Query  367   DC  362
             +C
Sbjct  1049  EC  1050



>gb|KFK31669.1| hypothetical protein AALP_AA6G143600 [Arabis alpina]
Length=1051

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+++  G +L+ CG+
Sbjct  990   FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFLAKQTGPLLKQCGV  1049

Query  367   DC  362
             DC
Sbjct  1050  DC  1051



>ref|XP_010927484.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Elaeis guineensis]
Length=1089

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG++G+QN  PTII+VWSILLASIFSLLWVRI+PF+++ DG +LE CGL
Sbjct  1027  FWVIVHLYPFLKGLVGRQNRTPTIIIVWSILLASIFSLLWVRIDPFLAKSDGPLLEECGL  1086

Query  367   DC  362
             DC
Sbjct  1087  DC  1088



>ref|XP_003533679.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Glycine max]
 gb|KHN26614.1| Cellulose synthase A catalytic subunit 4 [UDP-forming] [Glycine 
soja]
Length=1050

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSRD-GLVLEVCGL  368
              WVIVHLYPFLKG+MGKQN  PTI+V+WSILLASIFSL+WVRI+PF+ +  G VL+ CG+
Sbjct  989   FWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLASIFSLIWVRIDPFLPKQTGPVLKQCGV  1048

Query  367   DC  362
             +C
Sbjct  1049  EC  1050



>ref|NP_001105672.1| cellulose synthase10 [Zea mays]
 gb|AAR23310.1| cellulose synthase catalytic subunit 10 [Zea mays]
Length=1078

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+ +  G +L+ CG+
Sbjct  1017  FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFIPKAKGPILKPCGV  1076

Query  367   DC  362
             +C
Sbjct  1077  EC  1078



>ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1074

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVI+HLYPFLKG+MG+QN  PTI+VVWSILLASIFSLLWVRI+PF +R  G  +E CG+
Sbjct  1013  FWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRVTGPDVEQCGI  1072

Query  367   DC  362
             +C
Sbjct  1073  NC  1074



>ref|XP_004487957.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Cicer arietinum]
Length=1018

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG+MGKQN  PTI+V+WSILLASIFSL+WVRI+PF+ + +G +L+ CG+
Sbjct  957   FWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLASIFSLIWVRIDPFLPKQNGPILKQCGV  1016

Query  367   DC  362
             +C
Sbjct  1017  EC  1018



>tpg|DAA49708.1| TPA: eukaryotic translation initiation factor 4E-2 [Zea mays]
Length=1395

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -3

Query  544   LWVIVHLYPFLKGMMGKQNGVPTIIVVWSILLASIFSLLWVRINPFVSR-DGLVLEVCGL  368
              WVIVHLYPFLKG+MG+QN  PTI+V+WSILLASIFSL+WVRI+PF+ +  G +L+ CG+
Sbjct  1334  FWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLASIFSLVWVRIDPFIPKAKGPILKPCGV  1393

Query  367   DC  362
             +C
Sbjct  1394  EC  1395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335