BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041D20

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002264842.2|  PREDICTED: uncharacterized protein LOC100243...    233   7e-71   Vitis vinifera
ref|XP_006362325.1|  PREDICTED: uncharacterized protein LOC102585892    231   3e-70   Solanum tuberosum [potatoes]
gb|KDP21813.1|  hypothetical protein JCGZ_00600                         228   4e-69   Jatropha curcas
ref|XP_009804785.1|  PREDICTED: uncharacterized protein LOC104249949    226   5e-68   Nicotiana sylvestris
ref|XP_011101977.1|  PREDICTED: uncharacterized protein LOC105180...    225   7e-68   Sesamum indicum [beniseed]
ref|XP_004249013.1|  PREDICTED: uncharacterized protein LOC101255446    225   1e-67   Solanum lycopersicum
ref|XP_009615227.1|  PREDICTED: uncharacterized protein LOC104107982    224   2e-67   Nicotiana tomentosiformis
ref|XP_011006222.1|  PREDICTED: uncharacterized protein LOC105112277    222   2e-66   Populus euphratica
ref|XP_010113031.1|  hypothetical protein L484_022756                   223   3e-66   
gb|KJB27583.1|  hypothetical protein B456_005G0011001                   216   5e-66   Gossypium raimondii
gb|KJB27581.1|  hypothetical protein B456_005G0011001                   216   5e-66   Gossypium raimondii
ref|XP_002519981.1|  conserved hypothetical protein                     220   1e-65   Ricinus communis
ref|XP_011101978.1|  PREDICTED: uncharacterized protein LOC105180...    219   3e-65   Sesamum indicum [beniseed]
ref|XP_004302492.1|  PREDICTED: uncharacterized protein LOC101292427    219   3e-65   Fragaria vesca subsp. vesca
emb|CDP06352.1|  unnamed protein product                                218   5e-65   Coffea canephora [robusta coffee]
gb|EYU42067.1|  hypothetical protein MIMGU_mgv1a006657mg                215   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_009337845.1|  PREDICTED: uncharacterized protein LOC103930264    215   7e-64   Pyrus x bretschneideri [bai li]
gb|KHG16695.1|  Retinal-binding                                         215   9e-64   Gossypium arboreum [tree cotton]
ref|XP_008370316.1|  PREDICTED: uncharacterized protein LOC103433803    214   2e-63   
ref|XP_007205211.1|  hypothetical protein PRUPE_ppa005889mg             213   3e-63   
ref|XP_008244213.1|  PREDICTED: uncharacterized protein LOC103342365    213   3e-63   Prunus mume [ume]
ref|XP_009370848.1|  PREDICTED: uncharacterized protein LOC103960157    213   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_007032238.1|  Uncharacterized protein isoform 1                  212   1e-62   
gb|KDO37186.1|  hypothetical protein CISIN_1g030723mg                   203   2e-62   Citrus sinensis [apfelsine]
gb|AFW77521.1|  hypothetical protein ZEAMMB73_436424                    211   2e-62   
ref|XP_008649464.1|  PREDICTED: uncharacterized protein LOC103630...    211   5e-62   Zea mays [maize]
gb|KHN24577.1|  hypothetical protein glysoja_014181                     209   8e-62   Glycine soja [wild soybean]
ref|XP_008649463.1|  PREDICTED: uncharacterized protein LOC103630...    211   1e-61   Zea mays [maize]
gb|EYU42068.1|  hypothetical protein MIMGU_mgv1a006657mg                209   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_006599750.1|  PREDICTED: uncharacterized protein LOC100795...    206   1e-60   Glycine max [soybeans]
ref|XP_003521546.1|  PREDICTED: uncharacterized protein LOC100778...    206   1e-60   Glycine max [soybeans]
ref|XP_003548341.1|  PREDICTED: uncharacterized protein LOC100795...    206   2e-60   Glycine max [soybeans]
ref|XP_006429679.1|  hypothetical protein CICLE_v10011748mg             205   5e-60   Citrus clementina [clementine]
ref|XP_010653095.1|  PREDICTED: uncharacterized protein LOC100243...    203   3e-59   Vitis vinifera
ref|XP_002323111.2|  hypothetical protein POPTR_0016s15030g             202   7e-59   
ref|XP_007134600.1|  hypothetical protein PHAVU_010G060400g             201   1e-58   Phaseolus vulgaris [French bean]
ref|XP_004510081.1|  PREDICTED: uncharacterized protein LOC101493...    201   1e-58   Cicer arietinum [garbanzo]
gb|EPS68255.1|  hypothetical protein M569_06516                         200   5e-58   Genlisea aurea
ref|XP_008463316.1|  PREDICTED: uncharacterized protein LOC103501...    199   6e-58   Cucumis melo [Oriental melon]
ref|XP_006279346.1|  hypothetical protein CARUB_v10012733mg             199   8e-58   Capsella rubella
dbj|BAD43397.1|  unnamed protein product                                194   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24699.1|  hypothetical protein AALP_AA8G013300                    198   1e-57   Arabis alpina [alpine rockcress]
ref|XP_010036049.1|  PREDICTED: uncharacterized protein LOC104425150    198   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010496822.1|  PREDICTED: uncharacterized protein LOC104773850    198   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009125386.1|  PREDICTED: uncharacterized protein LOC103850397    197   3e-57   Brassica rapa
ref|XP_010490476.1|  PREDICTED: uncharacterized protein LOC104768...    197   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010490477.1|  PREDICTED: uncharacterized protein LOC104768...    197   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008793389.1|  PREDICTED: uncharacterized protein LOC103709...    197   4e-57   Phoenix dactylifera
dbj|BAD43927.1|  unnamed protein product                                195   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626627.1|  hypothetical protein MTR_8g005040                  197   5e-57   Medicago truncatula
ref|XP_010278895.1|  PREDICTED: uncharacterized protein LOC104612935    197   5e-57   Nelumbo nucifera [Indian lotus]
ref|XP_004147520.1|  PREDICTED: uncharacterized protein LOC101218161    197   6e-57   Cucumis sativus [cucumbers]
ref|XP_008782734.1|  PREDICTED: uncharacterized protein LOC103702...    193   7e-57   
ref|XP_006398547.1|  hypothetical protein EUTSA_v10013603mg             196   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006654248.1|  PREDICTED: uncharacterized protein LOC102707586    196   1e-56   Oryza brachyantha
ref|XP_009130613.1|  PREDICTED: uncharacterized protein LOC103855...    196   2e-56   Brassica rapa
ref|XP_010921251.1|  PREDICTED: uncharacterized protein LOC105044...    196   2e-56   Elaeis guineensis
ref|XP_010543127.1|  PREDICTED: uncharacterized protein LOC104816...    196   2e-56   Tarenaya hassleriana [spider flower]
dbj|BAD43795.1|  unknown protein                                        195   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195721.5|  uncharacterized protein                               195   3e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43433.1|  unknown protein                                        195   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921254.1|  PREDICTED: uncharacterized protein LOC105044...    192   4e-56   
ref|XP_008782731.1|  PREDICTED: uncharacterized protein LOC103702...    194   8e-56   Phoenix dactylifera
ref|XP_010921253.1|  PREDICTED: uncharacterized protein LOC105044...    193   8e-56   
ref|NP_001055152.1|  Os05g0306000                                       194   1e-55   
ref|XP_010938084.1|  PREDICTED: uncharacterized protein LOC105057...    193   1e-55   Elaeis guineensis
ref|XP_010921250.1|  PREDICTED: uncharacterized protein LOC105044...    193   2e-55   Elaeis guineensis
gb|KJB27580.1|  hypothetical protein B456_005G0011001                   188   3e-55   Gossypium raimondii
ref|XP_003568677.1|  PREDICTED: uncharacterized protein LOC100826...    192   4e-55   Brachypodium distachyon [annual false brome]
ref|XP_004962482.1|  PREDICTED: uncharacterized protein LOC101772...    191   6e-55   Setaria italica
ref|XP_004962483.1|  PREDICTED: uncharacterized protein LOC101772...    191   7e-55   
ref|XP_004962481.1|  PREDICTED: uncharacterized protein LOC101772...    191   1e-54   Setaria italica
ref|XP_010673452.1|  PREDICTED: uncharacterized protein LOC104889827    190   2e-54   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ93195.1|  predicted protein                                      189   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH57023.1|  AT5G01010                                              187   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543126.1|  PREDICTED: uncharacterized protein LOC104816...    187   5e-53   Tarenaya hassleriana [spider flower]
gb|KDO37187.1|  hypothetical protein CISIN_1g030723mg                   177   2e-52   Citrus sinensis [apfelsine]
ref|XP_007032241.1|  Uncharacterized protein isoform 4                  185   2e-52   
ref|XP_009391656.1|  PREDICTED: uncharacterized protein LOC103977773    183   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001154687.1|  uncharacterized protein                            181   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190197.1|  uncharacterized protein                            181   1e-50   
ref|XP_007032239.1|  Uncharacterized protein isoform 2                  179   2e-50   
emb|CDY11168.1|  BnaA03g00040D                                          179   7e-50   Brassica napus [oilseed rape]
ref|XP_006429676.1|  hypothetical protein CICLE_v10011748mg             177   9e-50   
ref|XP_006429677.1|  hypothetical protein CICLE_v10011748mg             177   1e-49   
ref|NP_001154688.1|  uncharacterized protein                            174   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872981.1|  hypothetical protein ARALYDRAFT_486867             174   2e-48   
ref|XP_006429678.1|  hypothetical protein CICLE_v10011748mg             172   2e-47   
ref|XP_006842639.1|  hypothetical protein AMTR_s00077p00188630          172   2e-47   Amborella trichopoda
gb|EEE63181.1|  hypothetical protein OsJ_17990                          171   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010231533.1|  PREDICTED: uncharacterized protein LOC100826...    167   8e-46   
ref|XP_011101979.1|  PREDICTED: uncharacterized protein LOC105180...    166   2e-45   Sesamum indicum [beniseed]
dbj|BAH57287.1|  AT5G01010                                              144   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001765571.1|  predicted protein                                  150   3e-39   
ref|XP_008793391.1|  PREDICTED: uncharacterized protein LOC103709...    149   5e-39   
ref|XP_008463317.1|  PREDICTED: uncharacterized protein LOC103501...    147   3e-38   Cucumis melo [Oriental melon]
ref|XP_010938085.1|  PREDICTED: uncharacterized protein LOC105057...    145   1e-37   Elaeis guineensis
ref|XP_002980642.1|  hypothetical protein SELMODRAFT_154057             140   1e-35   
ref|XP_002991009.1|  hypothetical protein SELMODRAFT_161364             140   1e-35   
ref|XP_008793390.1|  PREDICTED: uncharacterized protein LOC103709...    125   3e-30   
ref|XP_004169546.1|  PREDICTED: uncharacterized protein LOC101223675    117   4e-30   
ref|XP_006398545.1|  hypothetical protein EUTSA_v10013603mg             124   5e-30   
gb|KDO37188.1|  hypothetical protein CISIN_1g030723mg                   105   4e-25   Citrus sinensis [apfelsine]
ref|XP_009130614.1|  PREDICTED: uncharacterized protein LOC103855...    101   6e-22   Brassica rapa
ref|XP_006398546.1|  hypothetical protein EUTSA_v10013603mg             100   1e-21   
ref|XP_007032243.1|  Uncharacterized protein isoform 6                  100   1e-21   
gb|EYU42069.1|  hypothetical protein MIMGU_mgv1a006657mg              98.2    8e-21   Erythranthe guttata [common monkey flower]
ref|XP_006296412.1|  hypothetical protein CARUB_v10025590mg           91.7    1e-20   
gb|KDO37189.1|  hypothetical protein CISIN_1g030723mg                 87.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_010543129.1|  PREDICTED: uncharacterized protein LOC104816...  90.5    3e-18   Tarenaya hassleriana [spider flower]
gb|EMS49914.1|  hypothetical protein TRIUR3_19770                     89.7    1e-17   Triticum urartu
ref|XP_010496718.1|  PREDICTED: uncharacterized protein LOC104773766  85.1    2e-16   
ref|XP_010543128.1|  PREDICTED: uncharacterized protein LOC104816...  82.0    5e-15   Tarenaya hassleriana [spider flower]
gb|EFN84723.1|  SEC14-like protein 2                                  68.2    2e-11   Harpegnathos saltator
ref|XP_011139122.1|  PREDICTED: SEC14-like protein 2                  67.0    1e-10   
ref|XP_004353064.1|  serpin, putative                                 65.1    5e-09   Acanthamoeba castellanii str. Neff
gb|AAF89109.1|AC074299_3  TEL1S.2                                     60.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001121498.2|  PREDICTED: SEC14-like protein 2-like             60.5    1e-07   
ref|XP_624865.3|  PREDICTED: SEC14-like protein 2-like                60.1    1e-07   Apis mellifera [bee]
gb|EFZ20476.1|  hypothetical protein SINV_14001                       60.1    2e-07   
ref|XP_011155993.1|  PREDICTED: SEC14-like protein 2                  60.1    2e-07   Solenopsis invicta [imported red fire ant]
ref|XP_003706144.1|  PREDICTED: SEC14-like protein 2-like             59.3    3e-07   Megachile rotundata
ref|XP_003698581.1|  PREDICTED: SEC14-like protein 2-like             59.3    3e-07   Apis florea [dwarf honeybee]
ref|XP_002602154.1|  hypothetical protein BRAFLDRAFT_234283           56.2    4e-07   Branchiostoma floridae
gb|EGI68383.1|  SEC14-like protein 2                                  58.5    5e-07   Acromyrmex echinatior
gb|KJE98138.1|  SEC14-like protein, variant                           58.9    5e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_011049938.1|  PREDICTED: SEC14-like protein 2                  58.5    5e-07   Acromyrmex echinatior
ref|XP_006609824.1|  PREDICTED: SEC14-like protein 2-like isoform X1  58.5    5e-07   Apis dorsata [rock honeybee]
ref|XP_004342753.1|  SEC14-like protein                               58.5    6e-07   Capsaspora owczarzaki ATCC 30864
gb|KJE98137.1|  SEC14-like protein                                    58.5    7e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_011334815.1|  PREDICTED: SEC14-like protein 2 isoform X2       57.0    2e-06   
ref|XP_011334812.1|  PREDICTED: SEC14-like protein 2 isoform X1       57.0    2e-06   Ooceraea biroi
ref|XP_003394555.1|  PREDICTED: LOW QUALITY PROTEIN: SEC14-like p...  55.8    4e-06   
gb|EFX85554.1|  hypothetical protein DAPPUDRAFT_300280                55.5    6e-06   Daphnia pulex
ref|XP_003486550.1|  PREDICTED: SEC14-like protein 2-like             53.9    2e-05   Bombus impatiens
emb|CDW51773.1|  CRAL TRIO domain containing protein                  53.5    3e-05   Trichuris trichiura
ref|XP_011307420.1|  PREDICTED: SEC14-like protein 2                  52.8    4e-05   Fopius arisanus
gb|EFN74196.1|  SEC14-like protein 2                                  53.1    4e-05   Camponotus floridanus
ref|XP_011259189.1|  PREDICTED: SEC14-like protein 2 isoform X1       52.8    4e-05   Camponotus floridanus
ref|XP_011259195.1|  PREDICTED: SEC14-like protein 2 isoform X2       52.8    5e-05   Camponotus floridanus
ref|XP_010231534.1|  PREDICTED: uncharacterized protein LOC100826...  52.4    6e-05   
ref|XP_008201186.1|  PREDICTED: SEC14-like protein 3                  52.4    7e-05   
ref|XP_007032240.1|  Uncharacterized protein isoform 3                52.0    8e-05   
gb|EFA12792.1|  hypothetical protein TcasGA2_TC002162                 52.0    8e-05   
gb|KFD58027.1|  hypothetical protein M513_01260                       51.6    1e-04   Trichuris suis
ref|XP_003724076.1|  PREDICTED: FYVE and coiled-coil domain-conta...  52.0    1e-04   Strongylocentrotus purpuratus [purple urchin]
ref|XP_780082.3|  PREDICTED: FYVE and coiled-coil domain-containi...  51.6    1e-04   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002116332.1|  hypothetical protein TRIADDRAFT_60316            50.1    4e-04   Trichoplax adhaerens
ref|XP_003387861.1|  PREDICTED: FYVE and coiled-coil domain-conta...  50.1    5e-04   
ref|XP_003747619.1|  PREDICTED: SEC14-like protein 2-like             49.7    6e-04   Galendromus occidentalis
ref|XP_003384214.1|  PREDICTED: SEC14-like protein 2                  48.1    7e-04   Amphimedon queenslandica
gb|EFX85397.1|  hypothetical protein DAPPUDRAFT_222659                49.3    8e-04   Daphnia pulex
ref|XP_001660574.1|  AAEL010027-PA                                    48.9    9e-04   
ref|XP_005278854.1|  PREDICTED: SEC14-like protein 2 isoform X1       48.9    0.001   Chrysemys picta bellii



>ref|XP_002264842.2| PREDICTED: uncharacterized protein LOC100243295 isoform X1 [Vitis 
vinifera]
 emb|CBI31130.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDAG IEA KN+EY+E+S+ AGKTHEVSL VE INSYIAWDFSL QG++
Sbjct  301  VFANSPFFISAEDAGPIEARKNDEYKEISIPAGKTHEVSLMVESINSYIAWDFSLAQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFSMEY ++SG KT ILPYRRYESDQGNFCTCMAGNYKL+WDNSYS+FF KVLRY
Sbjct  361  NV-DIGFSMEYTNASGDKTLILPYRRYESDQGNFCTCMAGNYKLIWDNSYSTFFKKVLRY  419

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPVVE  A+A  ++
Sbjct  420  KVDCIPPVVEPVAAATDVK  438



>ref|XP_006362325.1| PREDICTED: uncharacterized protein LOC102585892 [Solanum tuberosum]
Length=439

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFITAE+AG +EA K++EY+EVSV AGKTHEVSLTV+ INSYIAWDFSL+QGR
Sbjct  300  DVFANSPFFITAEEAGTLEARKSDEYKEVSVPAGKTHEVSLTVDAINSYIAWDFSLVQGR  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFSMEY D SG+KT ILPYRRY +DQGNFCTC++GNYKL+WDNSYS+FF KVLR
Sbjct  360  VDM-DIGFSMEYTDPSGQKTQILPYRRYGADQGNFCTCLSGNYKLIWDNSYSTFFKKVLR  418

Query  236  YKVDCIPPVVESSASANQLE  177
            YKVDCIPPVVE   S++Q++
Sbjct  419  YKVDCIPPVVEPELSSDQVD  438



>gb|KDP21813.1| hypothetical protein JCGZ_00600 [Jatropha curcas]
Length=439

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AG ++A  N+E++E+SV AGKTHEVSL V+ INSYIAWDFSLIQG++
Sbjct  301  VFANSPFFISAEVAGTLDARTNDEFKEISVPAGKTHEVSLAVDSINSYIAWDFSLIQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY D SGKKT ILPY+RYESDQGNFCT MAGNYKL+WDNSYSSFF KV+RY
Sbjct  361  NM-DIGFSVEYVDPSGKKTLILPYQRYESDQGNFCTVMAGNYKLIWDNSYSSFFKKVIRY  419

Query  233  KVDCIPPVVESSASANQLEG  174
            KVDCIPPVVE   S NQ+EG
Sbjct  420  KVDCIPPVVEPMQSTNQVEG  439



>ref|XP_009804785.1| PREDICTED: uncharacterized protein LOC104249949 [Nicotiana sylvestris]
Length=439

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFITAE+AGA++A K++EY+EVSV AGKTHEVSLTV+ INSYIAWDF+L+QGR
Sbjct  300  DVFANSPFFITAEEAGALDARKSDEYKEVSVPAGKTHEVSLTVDAINSYIAWDFALVQGR  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFSME+ D SG+KT ILPYRRY++DQGNFCT +AG+YKL+WDN+YS+FF KVLR
Sbjct  360  VDM-DIGFSMEFTDLSGQKTQILPYRRYDADQGNFCTVLAGHYKLIWDNAYSTFFKKVLR  418

Query  236  YKVDCIPPVVESSASANQLE  177
            YKVDCIPPVVE + S++Q++
Sbjct  419  YKVDCIPPVVEPALSSDQVD  438



>ref|XP_011101977.1| PREDICTED: uncharacterized protein LOC105180011 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG + A K+++Y+E+++ AG+THEVSLTVE INSYIAWDFSL+QG++
Sbjct  301  VFTNSPFFITAEDAGTLAARKDDDYKEINIPAGETHEVSLTVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +LQDIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RY
Sbjct  361  SLQDIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRY  420

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPV ES+  A
Sbjct  421  KVDCIPPVAESATHA  435



>ref|XP_004249013.1| PREDICTED: uncharacterized protein LOC101255446 [Solanum lycopersicum]
Length=435

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFITAE+AG +EA K++EY+EVSV AGK+HEVSLTV+ INSYIAWDFSL+QGR
Sbjct  300  DVFANSPFFITAEEAGTLEARKSDEYKEVSVPAGKSHEVSLTVDAINSYIAWDFSLVQGR  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFSMEY D SG+KT ILPYRRY +DQGNFCTC++GNYKL+WDNSYS+FF KVLR
Sbjct  360  VDM-DIGFSMEYTDPSGQKTQILPYRRYGADQGNFCTCLSGNYKLIWDNSYSTFFKKVLR  418

Query  236  YKVDCIPPVVESSASAN  186
            +KVDCIPPVVE   S++
Sbjct  419  FKVDCIPPVVEPVLSSD  435



>ref|XP_009615227.1| PREDICTED: uncharacterized protein LOC104107982 [Nicotiana tomentosiformis]
Length=439

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFITAE+AGA++A K++EY+EVSV AGKTHEVSLTV+ INSYIAWDF+L+QGR
Sbjct  300  DVFANSPFFITAEEAGALDARKSDEYKEVSVPAGKTHEVSLTVDAINSYIAWDFALVQGR  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFSME+ + SG+KT ILPYRRY++DQGNFCT +AG+YKL+WDNSYS+FF KVLR
Sbjct  360  VDM-DIGFSMEFTNLSGQKTQILPYRRYDADQGNFCTVLAGHYKLIWDNSYSTFFKKVLR  418

Query  236  YKVDCIPPVVESSASANQLE  177
            YKVDCIPPVVE + S++Q++
Sbjct  419  YKVDCIPPVVEPALSSDQVD  438



>ref|XP_011006222.1| PREDICTED: uncharacterized protein LOC105112277 [Populus euphratica]
Length=435

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+EA  N++Y+E++V AGKTHEVSL+VE +NSYIAWDFSLIQG++
Sbjct  297  VFANSPFFISAEAAGALEARNNDDYKEINVPAGKTHEVSLSVESVNSYIAWDFSLIQGKI  356

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E  D SGKKT ILPYRRYESDQGNF TC++GNYKL+WDNSYS+FF KVLRY
Sbjct  357  NM-DIGFSVECTDPSGKKTLILPYRRYESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRY  415

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPVVE   SA ++E
Sbjct  416  KVDCIPPVVEPVQSAGEME  434



>ref|XP_010113031.1| hypothetical protein L484_022756 [Morus notabilis]
 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis]
Length=503

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN++Y+E+SV AGK+HEV L+V+ +NSYIAWDFS++QG++
Sbjct  365  VFANSPFFISAEVAGALEGRKNDDYKEISVPAGKSHEVLLSVDSLNSYIAWDFSVVQGKI  424

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +L DIGFS+EY +SSG+KT ILPYRRYE+DQGNFCTCMAGNYKL+WDNSY+SFF KVLR+
Sbjct  425  SL-DIGFSVEYTNSSGEKTLILPYRRYEADQGNFCTCMAGNYKLIWDNSYASFFKKVLRF  483

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPVVES  S NQ+E
Sbjct  484  KVDCIPPVVESPPSDNQVE  502



>gb|KJB27583.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=294

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA  +E  KN+EY+E++V AGK++EVSLTVE INSYIAWDFSL+QG++
Sbjct  153  VFANSPFFISAEDASMLEMGKNDEYKEITVPAGKSYEVSLTVESINSYIAWDFSLVQGKM  212

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRY
Sbjct  213  NM-DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRY  271

Query  233  KVDCIPPVVESSASANQ  183
            KVDCIPPV+E S   ++
Sbjct  272  KVDCIPPVLEESEKGSE  288



>gb|KJB27581.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
 gb|KJB27582.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=301

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA  +E  KN+EY+E++V AGK++EVSLTVE INSYIAWDFSL+QG++
Sbjct  160  VFANSPFFISAEDASMLEMGKNDEYKEITVPAGKSYEVSLTVESINSYIAWDFSLVQGKM  219

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRY
Sbjct  220  NM-DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRY  278

Query  233  KVDCIPPVVESSASANQ  183
            KVDCIPPV+E S   ++
Sbjct  279  KVDCIPPVLEESEKGSE  295



>ref|XP_002519981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42305.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE AGA+    N+E++E+SV AGKTHEVSL V+ +NSYIAWDFSLIQG++
Sbjct  301  VFANAPFFISAEVAGALAGRTNDEFKEISVPAGKTHEVSLVVDSVNSYIAWDFSLIQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY D SGK++ ILPYRRYESDQGNF T  AGNYKL+WDNSYS+FF KVLRY
Sbjct  361  NV-DIGFSVEYMDPSGKRSLILPYRRYESDQGNFSTVTAGNYKLIWDNSYSAFFKKVLRY  419

Query  233  KVDCIPPVVESSASANQLEG  174
            KVDCIPPVVE   S +Q+EG
Sbjct  420  KVDCIPPVVEPLQSTDQVEG  439



>ref|XP_011101978.1| PREDICTED: uncharacterized protein LOC105180011 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG + A K+++Y+E+++ AG+THEVSLTVE INSYIAWDFSL+QG++
Sbjct  301  VFTNSPFFITAEDAGTLAARKDDDYKEINIPAGETHEVSLTVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +L DIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RY
Sbjct  361  SL-DIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRY  419

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPV ES+  A
Sbjct  420  KVDCIPPVAESATHA  434



>ref|XP_004302492.1| PREDICTED: uncharacterized protein LOC101292427 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA +   N++Y+E+SVAAGKTHEVSLTV+ INSYIAWDFSL+QG++
Sbjct  302  VFANSPFFISAEVAGASDGGNNDDYKEISVAAGKTHEVSLTVDSINSYIAWDFSLVQGKM  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY ++SG+K+ ILPY+RYESDQGNFCTC AG YKLVWDNSYSSFF KVLR+
Sbjct  362  NL-DIGFSVEYTNASGEKSLILPYKRYESDQGNFCTCEAGKYKLVWDNSYSSFFKKVLRF  420

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPVVE+   A + E
Sbjct  421  KVDCIPPVVETVPRATEAE  439



>emb|CDP06352.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAGA+EA  N++++E+++ AGK +EVSL+V+ INSYI WDFSL+QGR+
Sbjct  301  VFANSPFFITAEDAGALEARNNDDFKEINIPAGKIYEVSLSVDSINSYIGWDFSLVQGRM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY D++G+KT ILPY RYESDQGNFCTCMAGNY+LVWDNS+S+FF KVLRY
Sbjct  361  NM-DIGFSVEYTDAAGQKTLILPYGRYESDQGNFCTCMAGNYRLVWDNSFSAFFGKVLRY  419

Query  233  KVDCIPPVVESSAS  192
            KVDCIPPVVE  +S
Sbjct  420  KVDCIPPVVEPVSS  433



>gb|EYU42067.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=436

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG +   K+++Y+E+SV AG  HEVSLTVE +NSYIAWDFSL+QG+L
Sbjct  302  VFTNSPFFITAEDAGTLSIRKDDDYKEISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKL  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+QDIGFS+E  + SG+KT ILPY+RYE++QGNFCTC+ GNYKL+WDNSYSSFF KVLRY
Sbjct  362  NVQDIGFSVECTNLSGEKTLILPYQRYEANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRY  421

Query  233  KVDCIPPVVES  201
            KVDCIPPVV+S
Sbjct  422  KVDCIPPVVDS  432



>ref|XP_009337845.1| PREDICTED: uncharacterized protein LOC103930264 [Pyrus x bretschneideri]
Length=440

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI AE AGA+E   N++YQE SV AGKTHEV L V+ INSYIAWDF+L+QG++
Sbjct  302  VFANSPFFIPAEVAGALEGRNNDDYQETSVPAGKTHEVLLAVDAINSYIAWDFALVQGKI  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY +SSG+K+ ILPY+RY+SDQGNFCTC AGNYKL+WDNSYS+FF KVLR+
Sbjct  362  NL-DIGFSVEYTNSSGEKSLILPYQRYDSDQGNFCTCEAGNYKLIWDNSYSNFFKKVLRF  420

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPV ES   AN++E
Sbjct  421  KVDCIPPVAESVQPANEVE  439



>gb|KHG16695.1| Retinal-binding [Gossypium arboreum]
Length=442

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA  +E  KN+EY+E++V AGK++EVSLTVE INSYIAWDFSL+QG++
Sbjct  301  VFANSPFFISAEDASMLEMRKNDEYKEITVPAGKSYEVSLTVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            ++ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF K LRY
Sbjct  361  SM-DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRY  419

Query  233  KVDCIPPVVESSASANQ  183
            KVDCIPPV+E S   ++
Sbjct  420  KVDCIPPVLEESEKGSE  436



>ref|XP_008370316.1| PREDICTED: uncharacterized protein LOC103433803 [Malus domestica]
Length=440

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI AE AGA++   N++YQE SV AGK HEVSL V+ INSYIAWDFSL+QG++
Sbjct  302  VFANSPFFIPAEVAGALQGRNNDDYQETSVPAGKIHEVSLAVDAINSYIAWDFSLVQGKI  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC AGNYKL+WDNSYSSFF KVLRY
Sbjct  362  NL-DIGFSVEYTNPSGQKSLILPYRRFESDQGNFCTCEAGNYKLIWDNSYSSFFKKVLRY  420

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPV E    A + E
Sbjct  421  KVDCIPPVTEPVEPATEAE  439



>ref|XP_007205211.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
 gb|EMJ06410.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
Length=438

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E   N++Y+E+SV AGKTHEVSL+V+ INSYIAWDFSL+QG++
Sbjct  299  VFANSPFFISAEVAGALEGRNNDDYKEISVPAGKTHEVSLSVDAINSYIAWDFSLVQGKI  358

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF K LRY
Sbjct  359  NL-DIGFSVEYTNPSGEKSLILPYRRFESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRY  417

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPV E  A A
Sbjct  418  KVDCIPPVAEPVAPA  432



>ref|XP_008244213.1| PREDICTED: uncharacterized protein LOC103342365 [Prunus mume]
Length=440

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E   N++Y+E+SV AGKTHEVSL+V+ +NSYIAWDFSL+QG++
Sbjct  302  VFANSPFFISAEVAGALEGRNNDDYKEISVPAGKTHEVSLSVDAVNSYIAWDFSLVQGKI  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF K LRY
Sbjct  362  NL-DIGFSVEYTNPSGEKSLILPYRRFESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRY  420

Query  233  KVDCIPPVVESSASANQ  183
            KVDCIPPV E  A A +
Sbjct  421  KVDCIPPVAEPVAPATE  437



>ref|XP_009370848.1| PREDICTED: uncharacterized protein LOC103960157 [Pyrus x bretschneideri]
Length=440

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI AE AGA++   N++YQE SV AGK HEVSL V+ INSYIAWDFSL+QG++
Sbjct  302  VFANSPFFIPAEVAGALQGRNNDDYQETSVPAGKIHEVSLAVDAINSYIAWDFSLVQGKI  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+EY + SG+K+ ILPYRR+ESDQGNFCTC  GNYKL+WDNSYSSFF KVLRY
Sbjct  362  NL-DIGFSVEYTNPSGQKSLILPYRRFESDQGNFCTCEVGNYKLIWDNSYSSFFKKVLRY  420

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPV E    A ++E
Sbjct  421  KVDCIPPVTEPVEPATEVE  439



>ref|XP_007032238.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03164.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA   E  K++EY E++V AGK++EVSL VE INSYIAWDFSL+QG++
Sbjct  301  VFANSPFFISAEDASMFETRKSDEYNEITVPAGKSYEVSLAVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K LRY
Sbjct  361  NM-DIGFSVEYTNTVGEKTLILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRY  419

Query  233  KVDCIPPVVESSASANQLEG  174
            KVDCIPPV++ SA +N++EG
Sbjct  420  KVDCIPPVLD-SAESNEVEG  438



>gb|KDO37186.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=172

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  35   VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  94

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +  DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY
Sbjct  95   S-TDIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRY  153

Query  233  KVDCIPPVVESSASANQLE  177
            +VDCIPPVVE     N+ E
Sbjct  154  RVDCIPPVVEPMQPTNEAE  172



>gb|AFW77521.1| hypothetical protein ZEAMMB73_436424 [Zea mays]
Length=412

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA++A K++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  274  VFVNAPFFISAEDAGAVDARKSDEYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  333

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLR
Sbjct  334  NMVLDIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLR  393

Query  236  YKVDCIPPVVESSASANQL  180
            YKVD +PPVVE + SA +L
Sbjct  394  YKVDAVPPVVEPALSATEL  412



>ref|XP_008649464.1| PREDICTED: uncharacterized protein LOC103630158 isoform X2 [Zea 
mays]
Length=499

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA++A K++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  363  VFVNAPFFISAEDAGAVDARKSDEYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  422

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLRY
Sbjct  423  NM-DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLRY  481

Query  233  KVDCIPPVVESSASANQL  180
            KVD +PPVVE + SA +L
Sbjct  482  KVDAVPPVVEPALSATEL  499



>gb|KHN24577.1| hypothetical protein glysoja_014181 [Glycine soja]
Length=434

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE AGA+EA KN++Y+E++V AGKT+EV L+V+ +NSYIAWDFSL+QG++
Sbjct  301  VFANAPFFISAEVAGALEARKNDDYKEINVPAGKTYEVLLSVDAVNSYIAWDFSLVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRY
Sbjct  361  NM-DIGFSLEFVSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRY  419

Query  233  KVDCIPPVVESSAS  192
            K+DCIPPV ES  S
Sbjct  420  KIDCIPPVTESVQS  433



>ref|XP_008649463.1| PREDICTED: uncharacterized protein LOC103630158 isoform X1 [Zea 
mays]
Length=501

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA++A K++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  363  VFVNAPFFISAEDAGAVDARKSDEYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  422

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLR
Sbjct  423  NMVLDIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLR  482

Query  236  YKVDCIPPVVESSASANQL  180
            YKVD +PPVVE + SA +L
Sbjct  483  YKVDAVPPVVEPALSATEL  501



>gb|EYU42068.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=435

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG +   K+++Y+E+SV AG  HEVSLTVE +NSYIAWDFSL+QG+L
Sbjct  302  VFTNSPFFITAEDAGTLSIRKDDDYKEISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKL  361

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E  + SG+KT ILPY+RYE++QGNFCTC+ GNYKL+WDNSYSSFF KVLRY
Sbjct  362  NV-DIGFSVECTNLSGEKTLILPYQRYEANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRY  420

Query  233  KVDCIPPVVES  201
            KVDCIPPVV+S
Sbjct  421  KVDCIPPVVDS  431



>ref|XP_006599750.1| PREDICTED: uncharacterized protein LOC100795582 isoform X2 [Glycine 
max]
Length=408

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE AGA+EA KN++Y+E++V AGKT+EV L+V+ +NSYIAWDFSL+QG++
Sbjct  275  VFANAPFFISAEVAGALEARKNDDYKEINVPAGKTYEVLLSVDAVNSYIAWDFSLVQGKI  334

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LPY RYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRY
Sbjct  335  NM-DIGFSLEFVSPTGEKTLMLPYGRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRY  393

Query  233  KVDCIPPVVESSAS  192
            K+DCIPPV ES  S
Sbjct  394  KIDCIPPVTESVQS  407



>ref|XP_003521546.1| PREDICTED: uncharacterized protein LOC100778827 isoform 1 [Glycine 
max]
 gb|KHN42120.1| hypothetical protein glysoja_021610 [Glycine soja]
Length=434

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE AGA+EA KN++Y+E++V AGKT+EV L+V+ +NSYIAWDFSL+QG +
Sbjct  301  VFANAPFFISAEVAGALEARKNDDYKEINVPAGKTYEVLLSVDAVNSYIAWDFSLVQGTI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRY
Sbjct  361  NM-DIGFSLEFLSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRY  419

Query  233  KVDCIPPVVESSAS  192
            K+DCIPPV +S  S
Sbjct  420  KIDCIPPVTDSVQS  433



>ref|XP_003548341.1| PREDICTED: uncharacterized protein LOC100795582 isoform X1 [Glycine 
max]
Length=434

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE AGA+EA KN++Y+E++V AGKT+EV L+V+ +NSYIAWDFSL+QG++
Sbjct  301  VFANAPFFISAEVAGALEARKNDDYKEINVPAGKTYEVLLSVDAVNSYIAWDFSLVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LPY RYESDQGNFCT MAG+YKL+WDN+YS+FF KVLRY
Sbjct  361  NM-DIGFSLEFVSPTGEKTLMLPYGRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRY  419

Query  233  KVDCIPPVVESSAS  192
            K+DCIPPV ES  S
Sbjct  420  KIDCIPPVTESVQS  433



>ref|XP_006429679.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 ref|XP_006481275.1| PREDICTED: uncharacterized protein LOC102624894 [Citrus sinensis]
 gb|ESR42919.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=438

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  301  VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +  DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY
Sbjct  361  S-TDIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRY  419

Query  233  KVDCIPPVVESSASANQLE  177
            +VDCIPPVVE     N+ E
Sbjct  420  RVDCIPPVVEPMQPTNEAE  438



>ref|XP_010653095.1| PREDICTED: uncharacterized protein LOC100243295 isoform X2 [Vitis 
vinifera]
 emb|CAQ58613.1| Unknown gene [Vitis vinifera]
Length=432

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDAG IEA KN+EY+E+S+ AGKTHEVSL VE INSYIAWDFSL QG++
Sbjct  301  VFANSPFFISAEDAGPIEARKNDEYKEISIPAGKTHEVSLMVESINSYIAWDFSLAQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFSMEY ++SG KT ILPYRRYESDQGNFCTCMAGNYKL+WDNSYS+FF K L  
Sbjct  361  NV-DIGFSMEYTNASGDKTLILPYRRYESDQGNFCTCMAGNYKLIWDNSYSTFFKKNLVV  419

Query  233  KVDC  222
             +DC
Sbjct  420  FLDC  423



>ref|XP_002323111.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
 gb|EEF04872.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
Length=435

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+EA  N++Y+E++V AGKT+EVSL+VE +NSYIAWDFSLIQG++
Sbjct  297  VFANSPFFISAEAAGALEAGNNDDYKEINVPAGKTYEVSLSVESVNSYIAWDFSLIQGKI  356

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E  D +GKKT ILPYRRYESDQGNF TC++GNYKL+WDNSYS+FF KVLRY
Sbjct  357  NM-DIGFSVECTDPTGKKTLILPYRRYESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRY  415

Query  233  KVDCIPPVVESSASANQLE  177
            KVDCIPPVVE   SA ++E
Sbjct  416  KVDCIPPVVEPVQSAGEME  434



>ref|XP_007134600.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
 gb|ESW06594.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
Length=445

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE  GA+EA KN++Y+E+++ AGKT+EV L+V+ +NSYIAWDFSL+QG++
Sbjct  301  VFANAPFFISAEVVGALEARKNDDYKEINIPAGKTYEVLLSVDVVNSYIAWDFSLVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LP RRYESDQGNFCT MAG+YKL+WDN+YS+FF KV+RY
Sbjct  361  NM-DIGFSLEFVSPTGEKTLMLPSRRYESDQGNFCTLMAGSYKLIWDNTYSTFFKKVIRY  419

Query  233  KVDCIPPVVESSAS-ANQLEG  174
            K+DCIPPV E   S +N+ EG
Sbjct  420  KIDCIPPVTEPVQSDSNKNEG  440



>ref|XP_004510081.1| PREDICTED: uncharacterized protein LOC101493369 isoform X1 [Cicer 
arietinum]
Length=434

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI A+ AGA+E  KN++Y+E SV AGKT+EV L+V+ +NSYIAWDFSL+QG++
Sbjct  301  VFANSPFFIPADVAGAMEVRKNDDYKETSVPAGKTYEVILSVDSVNSYIAWDFSLVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+KT +LPYRRYESDQGNFCT MAG+YKL+WDN++S+FF KVLRY
Sbjct  361  NM-DIGFSLEFSSPTGEKTLMLPYRRYESDQGNFCTLMAGSYKLIWDNTHSTFFRKVLRY  419

Query  233  KVDCIPPVVE  204
            KVDCIPPV E
Sbjct  420  KVDCIPPVTE  429



>gb|EPS68255.1| hypothetical protein M569_06516, partial [Genlisea aurea]
Length=463

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 117/163 (72%), Gaps = 34/163 (21%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF+N+PFFITA++AGA+ A KNEEY+E+S+AAG+THEV+L V+ INSY+AWDFSL+QG++
Sbjct  301  VFLNSPFFITADEAGALAARKNEEYKEISIAAGETHEVTLNVDSINSYVAWDFSLVQGKM  360

Query  413  NL----------------------------------QDIGFSMEYEDSSGKKTPILPYRR  336
            +L                                  QD+GFS+E  D SGK T ILPYRR
Sbjct  361  SLVCFFFFFGFPIFAEVLFWDHCVLASFGNEYYFFRQDVGFSIECTDLSGKTTKILPYRR  420

Query  335  YESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVV  207
            YE+DQGNFC C+ GNYKL+WDNSY++FF KVLRYKVDCIPPVV
Sbjct  421  YEADQGNFCACLLGNYKLIWDNSYAAFFRKVLRYKVDCIPPVV  463



>ref|XP_008463316.1| PREDICTED: uncharacterized protein LOC103501503 isoform X1 [Cucumis 
melo]
Length=436

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+A+ A A    K++ Y+E+SV AGKT+EVSL+VE INSYIAWDFSL+QG++
Sbjct  300  VFNNAPFFISADVACAANERKSDSYKEISVPAGKTYEVSLSVESINSYIAWDFSLVQGKM  359

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E E   G KT ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRY
Sbjct  360  NM-DIGFSVECESPGGVKTLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRY  418

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPVVE    A
Sbjct  419  KVDCIPPVVEPVQPA  433



>ref|XP_006279346.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
 gb|EOA12244.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
Length=434

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG +    NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGPRDNEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRR+E+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYINASGEKTLILPYRRFEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVESSAS  192
            YKVDCIPPVVE   S
Sbjct  419  YKVDCIPPVVEPEPS  433



>dbj|BAD43397.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43553.1| unnamed protein product, partial [Arabidopsis thaliana]
Length=282

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  144  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  203

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  204  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  262

Query  236  YKVDCIPPVVE  204
            YKVDCI PVVE
Sbjct  263  YKVDCIAPVVE  273



>gb|KFK24699.1| hypothetical protein AALP_AA8G013300 [Arabis alpina]
Length=427

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  295  DVFANSPFFISADTAGILGSRENEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  354

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  ++G+KT ILPYRRYE+DQGNF T MAGNYKLVWDNS+S+FF K LR
Sbjct  355  MSM-DIGFSVEYISATGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSFSTFFKKTLR  413

Query  236  YKVDCIPPVVESS  198
            YKVDCIPPVVE S
Sbjct  414  YKVDCIPPVVEPS  426



>ref|XP_010036049.1| PREDICTED: uncharacterized protein LOC104425150 [Eucalyptus grandis]
 gb|KCW47571.1| hypothetical protein EUGRSUZ_K01318 [Eucalyptus grandis]
Length=439

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVN+PFFI+A +AGA+EA +N++Y+E+S+ AGK HEVS  V+ +NSYIAWDFSL+QG++
Sbjct  301  VFVNSPFFISAAEAGALEAGQNDDYKEISIPAGKIHEVSFMVDSLNSYIAWDFSLVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGFS+E    SG+KT ILPYRRYESDQGNFCTC+AGNYKLVWDNSYS+FF K LRY
Sbjct  361  NL-DIGFSVECISPSGEKTLILPYRRYESDQGNFCTCIAGNYKLVWDNSYSTFFKKALRY  419

Query  233  KVDCIPPVVESSASANQLEG  174
            KVDCIPPVVE   S ++ E 
Sbjct  420  KVDCIPPVVEPVQSMSEEEA  439



>ref|XP_010496822.1| PREDICTED: uncharacterized protein LOC104773850 [Camelina sativa]
Length=434

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRDNEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYIGASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFNKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCIPPVVE
Sbjct  419  YKVDCIPPVVE  429



>ref|XP_009125386.1| PREDICTED: uncharacterized protein LOC103850397 [Brassica rapa]
 emb|CDY04819.1| BnaAnng00010D [Brassica napus]
Length=440

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYI WDFSL+QG+
Sbjct  300  DVFANSPFFISADAAGILGSRENEEYKEIIVQAGRTYEVSLMVESENSYIGWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCIPPVVE
Sbjct  419  YKVDCIPPVVE  429



>ref|XP_010490476.1| PREDICTED: uncharacterized protein LOC104768250 isoform X1 [Camelina 
sativa]
 ref|XP_010490478.1| PREDICTED: uncharacterized protein LOC104768250 isoform X3 [Camelina 
sativa]
Length=434

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRDNEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG++T ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYISASGEQTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCIPPVVE
Sbjct  419  YKVDCIPPVVE  429



>ref|XP_010490477.1| PREDICTED: uncharacterized protein LOC104768250 isoform X2 [Camelina 
sativa]
Length=434

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRDNEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG++T ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYISASGEQTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCIPPVVE
Sbjct  419  YKVDCIPPVVE  429



>ref|XP_008793389.1| PREDICTED: uncharacterized protein LOC103709697 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF I+AEDAGA E+ K++EY+E  +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  301  VFANSPFLISAEDAGAAESRKSDEYKETMIPPGKTHEVILTVESVNSYIAWDFALIQGTL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +L DIGF +EY   SG+ T ILPY+RYESDQGNFCT +AG+YKL+WDNSYS+FF K LRY
Sbjct  361  SL-DIGFRVEYVSPSGEITMILPYQRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRY  419

Query  233  KVDCIPPVVES  201
            KVD IPPVVES
Sbjct  420  KVDAIPPVVES  430



>dbj|BAD43927.1| unnamed protein product [Arabidopsis thaliana]
Length=358

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  220  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  279

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  280  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  338

Query  236  YKVDCIPPVVE  204
            YKVDCI PVVE
Sbjct  339  YKVDCIAPVVE  349



>ref|XP_003626627.1| hypothetical protein MTR_8g005040 [Medicago truncatula]
 gb|ABE93045.1| Proteinase inhibitor I4, serpin; emp24/gp25L/p24 [Medicago truncatula]
 gb|AET01103.1| serpin, putative [Medicago truncatula]
Length=428

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI A+ AGA+E  KN++Y+E+SV AGKT EV L+V+ +NSYIAWDFSL+QG++
Sbjct  295  VFANSPFFIPADVAGAVEIRKNDDYKEISVPAGKTFEVILSVDSVNSYIAWDFSLVQGKI  354

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E+   +G+K  +LPYRRYES+QGNFCT MAG+YKL+WDN++S+FF KVLRY
Sbjct  355  NM-DIGFSLEFASPTGEKILMLPYRRYESEQGNFCTLMAGSYKLIWDNTHSTFFRKVLRY  413

Query  233  KVDCIPPVVE  204
            KVDCIPPV E
Sbjct  414  KVDCIPPVAE  423



>ref|XP_010278895.1| PREDICTED: uncharacterized protein LOC104612935 [Nelumbo nucifera]
Length=432

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+A+DAG+ EA ++++Y+E  + AGKT+EVSL VE INSYIAWDFSL QG+ 
Sbjct  301  VFANSPFFISAQDAGSAEARRSDDYKETIIPAGKTYEVSLMVESINSYIAWDFSLGQGKT  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
             + DIGFS+EY + SG+KT ILPYRRYESDQGNFCTCMAG YKL+WDNSYS+FF KVL Y
Sbjct  361  AM-DIGFSVEYINPSGEKTMILPYRRYESDQGNFCTCMAGCYKLIWDNSYSTFFKKVLCY  419

Query  233  KVDCIPPVVESS  198
            KVDCIPPV + +
Sbjct  420  KVDCIPPVADPT  431



>ref|XP_004147520.1| PREDICTED: uncharacterized protein LOC101218161 [Cucumis sativus]
 gb|KGN53967.1| hypothetical protein Csa_4G197820 [Cucumis sativus]
Length=436

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+A+ A A    K++ Y+E+SV AGKT+EVSL+VE INSYIAWDFSL+QG++
Sbjct  300  VFNNAPFFISADVACAANERKSDSYKEISVPAGKTYEVSLSVESINSYIAWDFSLVQGKM  359

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGFS+E E   G K  ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRY
Sbjct  360  NM-DIGFSVECESPGGVKRLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRY  418

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPVVE    A
Sbjct  419  KVDCIPPVVEPVQPA  433



>ref|XP_008782734.1| PREDICTED: uncharacterized protein LOC103702180 isoform X2 [Phoenix 
dactylifera]
Length=312

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED G  E+ K++EY+E  +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  175  VFANSPFLVSAEDVGTAESRKSDEYKETIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  234

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRY
Sbjct  235  NL-DIGFHVEYVSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRY  293

Query  233  KVDCIPPVVES  201
            KVD +PPVVE+
Sbjct  294  KVDAVPPVVET  304



>ref|XP_006398547.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ40000.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=432

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYI WDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRENEEYKEIIVQAGRTYEVSLMVESENSYIGWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDN+YS+FF K LR
Sbjct  360  ISM-DIGFSVEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNAYSTFFKKTLR  418

Query  236  YKVDCIPPVVESS  198
            YKVDCIPPVV+ +
Sbjct  419  YKVDCIPPVVQPT  431



>ref|XP_006654248.1| PREDICTED: uncharacterized protein LOC102707586 [Oryza brachyantha]
Length=437

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 111/136 (82%), Gaps = 2/136 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA E+  ++EY+E  + AGKTHEV L+VE INSYIAWDFSL QG L
Sbjct  300  VFVNAPFFISAEDAGA-ESRNSDEYKETIIPAGKTHEVILSVEAINSYIAWDFSLQQGAL  358

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LR
Sbjct  359  NMVLDIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLR  418

Query  236  YKVDCIPPVVESSASA  189
            YKVD +PPVV  + +A
Sbjct  419  YKVDAVPPVVTPAEAA  434



>ref|XP_009130613.1| PREDICTED: uncharacterized protein LOC103855392 isoform X1 [Brassica 
rapa]
Length=432

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGTLGSRENEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLVQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGF +EY  +SG+KT ILPY RYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFCVEYISASGEKTLILPYHRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVESS  198
            YKVDCIPPVVE +
Sbjct  419  YKVDCIPPVVEPT  431



>ref|XP_010921251.1| PREDICTED: uncharacterized protein LOC105044884 isoform X2 [Elaeis 
guineensis]
Length=438

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED GA E+ K++EY+E+ +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  301  VFANSPFLMSAEDVGAAESRKSDEYKEIIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRY
Sbjct  361  NL-DIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRY  419

Query  233  KVDCIPPVVES  201
            KVD +PPVVE+
Sbjct  420  KVDAVPPVVET  430



>ref|XP_010543127.1| PREDICTED: uncharacterized protein LOC104816146 isoform X2 [Tarenaya 
hassleriana]
Length=437

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            NVF N+PFFI+A+ AGA  + +NEEY+E+ V AG+T EVSLTVE +NSYIAWDFS++QG+
Sbjct  300  NVFANSPFFISADVAGASGSRENEEYKEIIVQAGRTCEVSLTVESVNSYIAWDFSVVQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGF +E   +SG+KT ILPY+RYE+DQGNF TCM GNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFRVECIGASGEKTLILPYQRYEADQGNFSTCMPGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVESSASANQLEG  174
            YKVDCIPPVVE    A +L+G
Sbjct  419  YKVDCIPPVVE----ATELKG  435



>dbj|BAD43795.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCI PVVE
Sbjct  419  YKVDCIAPVVE  429



>ref|NP_195721.5| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42982.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43305.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43143.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43301.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43345.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43526.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43539.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43565.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43716.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43767.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43772.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43786.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43808.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44005.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44013.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44023.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44099.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44270.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44410.1| unknown protein [Arabidopsis thaliana]
 gb|AED90282.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=438

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCI PVVE
Sbjct  419  YKVDCIAPVVE  429



>dbj|BAD43433.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43633.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43683.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43717.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43821.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LR
Sbjct  360  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVDCI PVVE
Sbjct  419  YKVDCIAPVVE  429



>ref|XP_010921254.1| PREDICTED: uncharacterized protein LOC105044884 isoform X4 [Elaeis 
guineensis]
Length=362

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED GA E+ K++EY+E+ +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  214  VFANSPFLMSAEDVGAAESRKSDEYKEIIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  273

Query  413  NL----------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  264
            NL          +DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSY
Sbjct  274  NLVISETPGEIIRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSY  333

Query  263  SSFFCKVLRYKVDCIPPVVES  201
            S+FF K LRYKVD +PPVVE+
Sbjct  334  STFFKKSLRYKVDAVPPVVET  354



>ref|XP_008782731.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782732.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782733.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED G  E+ K++EY+E  +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  301  VFANSPFLVSAEDVGTAESRKSDEYKETIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            NL DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRY
Sbjct  361  NL-DIGFHVEYVSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRY  419

Query  233  KVDCIPPVVES  201
            KVD +PPVVE+
Sbjct  420  KVDAVPPVVET  430



>ref|XP_010921253.1| PREDICTED: uncharacterized protein LOC105044884 isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED GA E+ K++EY+E+ +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  248  VFANSPFLMSAEDVGAAESRKSDEYKEIIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  307

Query  413  NL----------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  264
            NL          +DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSY
Sbjct  308  NLVISETPGEIIRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSY  367

Query  263  SSFFCKVLRYKVDCIPPVVES  201
            S+FF K LRYKVD +PPVVE+
Sbjct  368  STFFKKSLRYKVDAVPPVVET  388



>ref|NP_001055152.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAF17066.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAG92466.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78947.1| hypothetical protein OsI_19396 [Oryza sativa Indica Group]
Length=439

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA E+  +++Y+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  302  VFVNAPFFISAEDAGA-ESRNSDDYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  360

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LR
Sbjct  361  NMVLDIGFHVEYISPSGQKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLR  420

Query  236  YKVDCIPPVVESSASA  189
            YKVD +PPVV  +  A
Sbjct  421  YKVDAVPPVVAPAEPA  436



>ref|XP_010938084.1| PREDICTED: uncharacterized protein LOC105057244 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            V  N+PF I+AEDAGA ++ K+ EY+E  +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  301  VVANSPFLISAEDAGAADSRKSVEYKETIIPPGKTHEVILTVESVNSYIAWDFALIQGTL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +L DIGF MEY   SG+ T ILPYRRYESDQGNFCT +AG+YKL+WDNSYS+FF K LRY
Sbjct  361  SL-DIGFRMEYVSPSGEVTLILPYRRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRY  419

Query  233  KVDCIPPVVE  204
            KVD IPPVVE
Sbjct  420  KVDAIPPVVE  429



>ref|XP_010921250.1| PREDICTED: uncharacterized protein LOC105044884 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF ++AED GA E+ K++EY+E+ +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  301  VFANSPFLMSAEDVGAAESRKSDEYKEIIIPPGKTHEVVLTVESVNSYIAWDFALIQGTL  360

Query  413  NL----------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  264
            NL          +DIGF +EY   SG+ T ILPYRRYESDQGNFCT + G+YKL+WDNSY
Sbjct  361  NLVISETPGEIIRDIGFHVEYLSPSGEITLILPYRRYESDQGNFCTILVGSYKLIWDNSY  420

Query  263  SSFFCKVLRYKVDCIPPVVES  201
            S+FF K LRYKVD +PPVVE+
Sbjct  421  STFFKKSLRYKVDAVPPVVET  441



>gb|KJB27580.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=279

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA  +E  KN+EY+E++V AGK++EVSLTVE INSYIAWDFSL+QG++
Sbjct  160  VFANSPFFISAEDASMLEMGKNDEYKEITVPAGKSYEVSLTVESINSYIAWDFSLVQGKM  219

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKV  243
            N+ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAGNYKL+WDNSYS+FF KV
Sbjct  220  NM-DIGFSVEYTNNGGEKTLILPYRRYESDQGNFSTCMAGNYKLIWDNSYSAFFKKV  275



>ref|XP_003568677.1| PREDICTED: uncharacterized protein LOC100826543 isoform X1 [Brachypodium 
distachyon]
Length=437

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA ++  ++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  300  VFVNAPFFISAEDAGA-DSRTSDEYRETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  358

Query  413  -NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
              L DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K LR
Sbjct  359  GTLLDIGFHVEYISLSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVESS  198
            YKVD +PPVVE +
Sbjct  419  YKVDAVPPVVEPA  431



>ref|XP_004962482.1| PREDICTED: uncharacterized protein LOC101772803 isoform X2 [Setaria 
italica]
Length=437

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA +A K++EY+E  + AGKTHEV L+VE INSYIAWDFSL QG L
Sbjct  301  VFVNAPFFISAEDAGAADARKSDEYKETIIPAGKTHEVILSVEAINSYIAWDFSLQQGAL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRY
Sbjct  361  NM-DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRY  419

Query  233  KVD  225
            KVD
Sbjct  420  KVD  422



>ref|XP_004962483.1| PREDICTED: uncharacterized protein LOC101772803 isoform X3 [Setaria 
italica]
Length=437

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA +A K++EY+E  + AGKTHEV L+VE INSYIAWDFSL QG L
Sbjct  301  VFVNAPFFISAEDAGAADARKSDEYKETIIPAGKTHEVILSVEAINSYIAWDFSLQQGAL  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+ DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LRY
Sbjct  361  NM-DIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLRY  419

Query  233  KVD  225
            KVD
Sbjct  420  KVD  422



>ref|XP_004962481.1| PREDICTED: uncharacterized protein LOC101772803 isoform X1 [Setaria 
italica]
Length=439

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA +A K++EY+E  + AGKTHEV L+VE INSYIAWDFSL QG L
Sbjct  301  VFVNAPFFISAEDAGAADARKSDEYKETIIPAGKTHEVILSVEAINSYIAWDFSLQQGAL  360

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K LR
Sbjct  361  NMVLDIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKSLR  420

Query  236  YKVD  225
            YKVD
Sbjct  421  YKVD  424



>ref|XP_010673452.1| PREDICTED: uncharacterized protein LOC104889827 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+A++ GAI+ S+N++Y+E+ + AG THEV L+V+ +NSYIAWDF+L Q ++
Sbjct  297  VFANSPFFISADEVGAID-SRNDDYKEIGIPAGTTHEVVLSVDSVNSYIAWDFTLEQSKM  355

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
             L DIGFS+E  +SSG+KT ILPYRR ESDQGNFCTCMAG YKL+WDNSYS+FF K L Y
Sbjct  356  KL-DIGFSVECTNSSGEKTLILPYRRCESDQGNFCTCMAGTYKLIWDNSYSTFFRKALLY  414

Query  233  KVDCIPPVVESS  198
            KVDCIPPVVE +
Sbjct  415  KVDCIPPVVEPA  426



>dbj|BAJ93195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA ++ KN+EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  300  VFVNAPFFISAEDAGA-DSRKNDEYRETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  358

Query  413  N-LQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            + L DIGF +EY   S +KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K LR
Sbjct  359  STLLDIGFHVEYISPSQEKTLILPYRRYEADQGNFCTVFAGSYKLVWDNSYSTFFKKTLR  418

Query  236  YKVDCIPPVVE  204
            YKVD +P V E
Sbjct  419  YKVDAVPSVTE  429



>dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana]
Length=448

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 11/141 (8%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTP----------ILPYRRYESDQGNFCTCMAGNYKLVWDNS  267
            +++ DIGFS+EY ++SG+KT           ILPYRRYE+DQGNF T MAGNYKLVWDNS
Sbjct  360  ISM-DIGFSVEYINASGEKTVSLLINFQTLLILPYRRYEADQGNFSTLMAGNYKLVWDNS  418

Query  266  YSSFFCKVLRYKVDCIPPVVE  204
            YS+FF K LRYKVDCI PVVE
Sbjct  419  YSTFFKKTLRYKVDCIAPVVE  439



>ref|XP_010543126.1| PREDICTED: uncharacterized protein LOC104816146 isoform X1 [Tarenaya 
hassleriana]
Length=448

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 117/152 (77%), Gaps = 16/152 (11%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHE-----------VSLTVEDINSY  450
            NVF N+PFFI+A+ AGA  + +NEEY+E+ V AG+T E           VSLTVE +NSY
Sbjct  300  NVFANSPFFISADVAGASGSRENEEYKEIIVQAGRTCESYLCQETWRNAVSLTVESVNSY  359

Query  449  IAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDN  270
            IAWDFS++QG++++ DIGF +E   +SG+KT ILPY+RYE+DQGNF TCM GNYKLVWDN
Sbjct  360  IAWDFSVVQGKISM-DIGFRVECIGASGEKTLILPYQRYEADQGNFSTCMPGNYKLVWDN  418

Query  269  SYSSFFCKVLRYKVDCIPPVVESSASANQLEG  174
            SYS+FF K LRYKVDCIPPVVE    A +L+G
Sbjct  419  SYSTFFKKTLRYKVDCIPPVVE----ATELKG  446



>gb|KDO37187.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=158

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  35   VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  94

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +  DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  95   S-TDIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLR  152



>ref|XP_007032241.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY03167.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 18/140 (13%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA   E  K++EY E++V AGK++EVSL VE INSYIAWDFSL+QG++
Sbjct  301  VFANSPFFISAEDASMFETRKSDEYNEITVPAGKSYEVSLAVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            N+                  ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K LRY
Sbjct  361  NML-----------------ILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRY  403

Query  233  KVDCIPPVVESSASANQLEG  174
            KVDCIPPV++ SA +N++EG
Sbjct  404  KVDCIPPVLD-SAESNEVEG  422



>ref|XP_009391656.1| PREDICTED: uncharacterized protein LOC103977773 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKN-EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQG  420
             V+ N+PFFI AEDAGA E+ K+ ++Y+E  +  GKTHE++LTVE INSYIAWDFSLIQG
Sbjct  301  KVYANSPFFIRAEDAGATESRKSYDDYKETIIPPGKTHEITLTVESINSYIAWDFSLIQG  360

Query  419  RLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVL  240
             L+  DIGF +EY + SG  T ILPYRRY SDQGNFCT +AG+YKL WDNSYS+F  K L
Sbjct  361  TLS-HDIGFHVEYVNPSGDVTLILPYRRYVSDQGNFCTILAGSYKLKWDNSYSTFSKKSL  419

Query  239  RYKVDCIPPVVES  201
            RYKVD +PPVV++
Sbjct  420  RYKVDAVPPVVDT  432



>ref|NP_001154687.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90283.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=479

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 40/171 (23%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNL----------------------------------------QDIGFSMEYEDSSGKKT  357
            +++                                        QDIGFS+EY ++SG+KT
Sbjct  360  ISMLPYIRFLLLYLLLFLPDSGYLCFHTYFCCLSSVYISVVFYQDIGFSVEYINASGEKT  419

Query  356  PILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVE  204
             ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  420  LILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  470



>ref|NP_001190197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90285.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=472

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 40/171 (23%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  293  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  352

Query  416  LNL----------------------------------------QDIGFSMEYEDSSGKKT  357
            +++                                        QDIGFS+EY ++SG+KT
Sbjct  353  ISMLPYIRFLLLYLLLFLPDSGYLCFHTYFCCLSSVYISVVFYQDIGFSVEYINASGEKT  412

Query  356  PILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVE  204
             ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  413  LILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  463



>ref|XP_007032239.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY03165.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA   E  K++EY E++V AGK++EVSL VE INSYIAWDFSL+QG++
Sbjct  301  VFANSPFFISAEDASMFETRKSDEYNEITVPAGKSYEVSLAVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKV  243
            N+ DIGFS+EY ++ G+KT ILPYRRYESDQGNF TCMAG+YKL+WDNSYS+FF K+
Sbjct  361  NM-DIGFSVEYTNTVGEKTLILPYRRYESDQGNFSTCMAGHYKLIWDNSYSTFFKKL  416



>emb|CDY11168.1| BnaA03g00040D [Brassica napus]
Length=474

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 112/174 (64%), Gaps = 41/174 (24%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGTLGSRENEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLVQGK  359

Query  416  LNL-----------------------------------------QDIGFSMEYEDSSGKK  360
            +++                                          DIGF +EY  +SG+K
Sbjct  360  ISMVLLFEPQFVSPLYNLKSFDCFSCLYHRLSLSAYYRYNIVYADDIGFCVEYISASGEK  419

Query  359  TPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESS  198
            T ILPY RYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE +
Sbjct  420  TLILPYHRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVEPT  473



>ref|XP_006429676.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42916.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=424

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  301  VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +  DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  361  S-TDIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLR  418



>ref|XP_006429677.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42917.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=422

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 17/139 (12%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  301  VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            +                 T ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY
Sbjct  361  S-----------------TLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRY  403

Query  233  KVDCIPPVVESSASANQLE  177
            +VDCIPPVVE     N+ E
Sbjct  404  RVDCIPPVVEPMQPTNEAE  422



>ref|NP_001154688.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56815.1| AT5G01010 [Arabidopsis thaliana]
 gb|AED90284.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=429

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF KV R
Sbjct  360  ISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKVGR  418

Query  236  Y  234
            Y
Sbjct  419  Y  419



>ref|XP_002872981.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49240.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG+
Sbjct  295  DVFANSPFFISADTAGILGSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGK  354

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            +++ DIGFS+EY  +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF KV R
Sbjct  355  ISM-DIGFSLEYISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKVGR  413

Query  236  Y  234
            Y
Sbjct  414  Y  414



>ref|XP_006429678.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42918.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=437

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  301  VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCK  246
            +  DIGFS+EY + SG+KT ILPYRR+ESDQGNFCT + GNYKL+WDN+YS+FF K
Sbjct  361  S-TDIGFSLEYTNESGEKTLILPYRRHESDQGNFCTVLVGNYKLLWDNTYSTFFKK  415



>ref|XP_006842639.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
 gb|ERN04314.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
Length=440

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+AE+AGA EAS+ EEY+E  + AGKT+E+ L V+ +NSYIAWDF + QG++
Sbjct  301  VFANAPFFISAEEAGAAEASRGEEYKETLIPAGKTYEILLAVDSVNSYIAWDFLVTQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
            ++ DIGFS+EY   SG  T ILPY+RYESDQGNFCT  AG+YKL+WDNSYS+FF K LRY
Sbjct  361  SM-DIGFSVEYISPSGITTLILPYQRYESDQGNFCTVKAGSYKLIWDNSYSTFFKKNLRY  419

Query  233  KVDCIPPVVE  204
            KVD IPPV E
Sbjct  420  KVDAIPPVAE  429



>gb|EEE63181.1| hypothetical protein OsJ_17990 [Oryza sativa Japonica Group]
Length=431

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 2/120 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA E+  +++Y+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  302  VFVNAPFFISAEDAGA-ESRNSDDYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  360

Query  413  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYSSFF K L+
Sbjct  361  NMVLDIGFHVEYISPSGQKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSSFFKKGLQ  420



>ref|XP_010231533.1| PREDICTED: uncharacterized protein LOC100826543 isoform X2 [Brachypodium 
distachyon]
Length=423

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA ++  ++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  300  VFVNAPFFISAEDAGA-DSRTSDEYRETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  358

Query  413  -NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVL  240
              L DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  AG+YKLVWDNSYS+FF K +
Sbjct  359  GTLLDIGFHVEYISLSGEKTLILPYRRYEADQGNFCTVSAGSYKLVWDNSYSTFFKKCM  417



>ref|XP_011101979.1| PREDICTED: uncharacterized protein LOC105180011 isoform X3 [Sesamum 
indicum]
Length=411

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 96/135 (71%), Gaps = 26/135 (19%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG + A K+++Y+E+++ AG+THE                       
Sbjct  301  VFTNSPFFITAEDAGTLAARKDDDYKEINIPAGETHE-----------------------  337

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               DIGFS+E  D SGKKT ILPYRRYESDQGNFCTC++G+YKL+WDNSYSSFF KV+RY
Sbjct  338  ---DIGFSVECTDLSGKKTLILPYRRYESDQGNFCTCVSGSYKLIWDNSYSSFFKKVMRY  394

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPV ES+  A
Sbjct  395  KVDCIPPVAESATHA  409



>dbj|BAH57287.1| AT5G01010 [Arabidopsis thaliana]
Length=98

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -2

Query  470  VEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGN  291
            VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGN
Sbjct  2    VESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGN  60

Query  290  YKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASANQL  180
            YKLVWDNSYS+FF K LRYKVDCI PVVE       L
Sbjct  61   YKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPL  97



>ref|XP_001765571.1| predicted protein [Physcomitrella patens]
 gb|EDQ69621.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFIT E+AG I AS +++Y+E ++AAGKTHEV L V+   + +AWDF L  G+ 
Sbjct  302  VFKNSPFFITPEEAG-IAASADQDYKEATIAAGKTHEVILPVKYEGALVAWDFRLTSGK-  359

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               DIGFS+E  DSS    P+ PY+RYE+ QG+F +   GNY+LVWDN+YS+F+ K LRY
Sbjct  360  ---DIGFSVELVDSSRATRPMFPYQRYETHQGSFQSPCVGNYRLVWDNTYSNFYRKYLRY  416

Query  233  KVDCIPPVVESS  198
            KVD IPPV+E +
Sbjct  417  KVDEIPPVLEEA  428



>ref|XP_008793391.1| PREDICTED: uncharacterized protein LOC103709697 isoform X3 [Phoenix 
dactylifera]
Length=413

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 87/131 (66%), Gaps = 26/131 (20%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF I+AEDAGA E+ K++EY+E  +  GKTHE                       
Sbjct  301  VFANSPFLISAEDAGAAESRKSDEYKETMIPPGKTHE-----------------------  337

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               DIGF +EY   SG+ T ILPY+RYESDQGNFCT +AG+YKL+WDNSYS+FF K LRY
Sbjct  338  ---DIGFRVEYVSPSGEITMILPYQRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRY  394

Query  233  KVDCIPPVVES  201
            KVD IPPVVES
Sbjct  395  KVDAIPPVVES  405



>ref|XP_008463317.1| PREDICTED: uncharacterized protein LOC103501503 isoform X2 [Cucumis 
melo]
Length=411

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 89/135 (66%), Gaps = 26/135 (19%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF NAPFFI+A+ A A    K++ Y+E+SV AGKT+E                       
Sbjct  300  VFNNAPFFISADVACAANERKSDSYKEISVPAGKTYE-----------------------  336

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               DIGFS+E E   G KT ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRY
Sbjct  337  ---DIGFSVECESPGGVKTLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRY  393

Query  233  KVDCIPPVVESSASA  189
            KVDCIPPVVE    A
Sbjct  394  KVDCIPPVVEPVQPA  408



>ref|XP_010938085.1| PREDICTED: uncharacterized protein LOC105057244 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 26/130 (20%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            V  N+PF I+AEDAGA ++ K+ EY+E  +  GKTHE                       
Sbjct  301  VVANSPFLISAEDAGAADSRKSVEYKETIIPPGKTHE-----------------------  337

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               DIGF MEY   SG+ T ILPYRRYESDQGNFCT +AG+YKL+WDNSYS+FF K LRY
Sbjct  338  ---DIGFRMEYVSPSGEVTLILPYRRYESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRY  394

Query  233  KVDCIPPVVE  204
            KVD IPPVVE
Sbjct  395  KVDAIPPVVE  404



>ref|XP_002980642.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
 gb|EFJ18293.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
Length=429

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKN-EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            VF ++PF I+AE+AG         +++E  ++ GKTHEV L V+   SY+AW+F L  G+
Sbjct  295  VFEHSPFLISAEEAGTNGGKTMVNDFKETVISTGKTHEVLLPVDSEGSYVAWEFKLTSGK  354

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
                D+GFS+EY  S+G K  +LPY+RY+S QGNF +   G+YKLVWDNSYS+F+ K +R
Sbjct  355  ----DVGFSVEYISSNGAKMQMLPYQRYDSHQGNFYSPGVGSYKLVWDNSYSTFYRKTVR  410

Query  236  YKVDCIPPVVESSASANQ  183
            YKVD IPPV ++    +Q
Sbjct  411  YKVDAIPPVADAQKLEDQ  428



>ref|XP_002991009.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
 gb|EFJ07817.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
Length=429

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKN-EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            VF ++PF I+AE+AG         +++E  ++ GKTHEV L V+   SY+AW+F L  G+
Sbjct  295  VFEHSPFLISAEEAGTNGGKTMVNDFKETVISTGKTHEVLLPVDSEGSYVAWEFKLTSGK  354

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLR  237
                D+GFS+EY  S+G K  +LPY+RY+S QGNF +   G+YKLVWDNSYS+F+ K +R
Sbjct  355  ----DVGFSVEYISSNGAKMQMLPYQRYDSHQGNFYSPGVGSYKLVWDNSYSTFYRKTVR  410

Query  236  YKVDCIPPVVESSASANQ  183
            YKVD IPPV ++    +Q
Sbjct  411  YKVDAIPPVADAQKLEDQ  428



>ref|XP_008793390.1| PREDICTED: uncharacterized protein LOC103709697 isoform X2 [Phoenix 
dactylifera]
Length=419

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PF I+AEDAGA E+ K++EY+E  +  GKTHEV LTVE +NSYIAWDF+LIQG L
Sbjct  263  VFANSPFLISAEDAGAAESRKSDEYKETMIPPGKTHEVILTVESVNSYIAWDFALIQGTL  322

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYESDQ  321
            +L DIGF +EY   SG+ T ILPY+RYESDQ
Sbjct  323  SL-DIGFRVEYVSPSGEITMILPYQRYESDQ  352


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 5/58 (9%)
 Frame = -3

Query  355  QSYLTDAMNLIKATSAHAWLEITNSYGTILIHHSSARSCVTRWTVYLQLWSHRLRLIN  182
            Q Y +D     +  SA +W + TNSYG I I H S R+C TRW +Y  LW+ R  L+N
Sbjct  346  QRYESD-----QEISAQSWPDPTNSYGIIPIRHFSKRACGTRWMLYPLLWNRRSFLLN  398



>ref|XP_004169546.1| PREDICTED: uncharacterized protein LOC101223675 [Cucumis sativus]
Length=78

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  404  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVD  225
            DIGFS+E E   G K  ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  4    DIGFSVECESPGGVKRLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVD  63

Query  224  CIPPVVESSASANQ  183
            CIPPVVE    A +
Sbjct  64   CIPPVVEPVQPAAE  77



>ref|XP_006398545.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39998.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=412

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 88/116 (76%), Gaps = 5/116 (4%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYI WDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRENEEYKEIIVQAGRTYEVSLMVESENSYIGWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFC  249
            +++ DIGFS+EY  +SG+KT ILPYRRYE+DQ +   C+   +KL++ N +    C
Sbjct  360  ISM-DIGFSVEYISASGEKTLILPYRRYEADQVS-AMCI---WKLLYANGWKLQTC  410



>gb|KDO37188.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=114

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  35   VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  94

Query  413  NLQDIGFSMEYEDSSGKKT  357
            +  DIGFS+EY + SG+KT
Sbjct  95   S-TDIGFSLEYTNESGEKT  112



>ref|XP_009130614.1| PREDICTED: uncharacterized protein LOC103855392 isoform X2 [Brassica 
rapa]
Length=387

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGTLGSRENEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLVQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKT  357
            +++ DIGF +EY  +SG+KT
Sbjct  360  ISM-DIGFCVEYISASGEKT  378



>ref|XP_006398546.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39999.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=418

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + + +NEEY+E+ V AG+T+EVSL VE  NSYI WDFSL+QG+
Sbjct  300  DVFANSPFFISADTAGILGSRENEEYKEIIVQAGRTYEVSLMVESENSYIGWDFSLMQGK  359

Query  416  LNLQDIGFSMEYEDSSGKKT  357
            +++ DIGFS+EY  +SG+KT
Sbjct  360  ISM-DIGFSVEYISASGEKT  378



>ref|XP_007032243.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY03169.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
Length=372

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 17/89 (19%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AEDA   E  K++EY E++V AGK++EVSL VE INSYIAWDFSL+QG++
Sbjct  301  VFANSPFFISAEDASMFETRKSDEYNEITVPAGKSYEVSLAVESINSYIAWDFSLVQGKM  360

Query  413  NLQDIGFSMEYEDSSGKKTPILPYRRYES  327
            N+                  ILPYRRYES
Sbjct  361  NML-----------------ILPYRRYES  372



>gb|EYU42069.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=382

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFITAEDAG +   K+++Y+E+SV AG  HEVSLTVE +NSYIAWDFSL+QG+L
Sbjct  302  VFTNSPFFITAEDAGTLSIRKDDDYKEISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKL  361

Query  413  NL  408
            N+
Sbjct  362  NV  363



>ref|XP_006296412.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
 gb|EOA29310.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
Length=55

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  404  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFCKV  243
            DIGFS+EY  +SG+KT ILPYRR+E++QGNF T MAGNYKLVWDNSYS+FF KV
Sbjct  1    DIGFSVEYISASGEKTLILPYRRFEAEQGNFSTLMAGNYKLVWDNSYSTFFKKV  54



>gb|KDO37189.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=111

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VF N+PFFI+AE AGA+E  KN+EY+E+++ AGK  EVS +V+ +NSYIAWDFS++QG++
Sbjct  35   VFANSPFFISAEAAGALETRKNDEYKEITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKI  94

Query  413  N  411
            +
Sbjct  95   S  95



>ref|XP_010543129.1| PREDICTED: uncharacterized protein LOC104816146 isoform X4 [Tarenaya 
hassleriana]
Length=373

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 60/74 (81%), Gaps = 2/74 (3%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            NVF N+PFFI+A+ AGA  + +NEEY+E+ V AG+T EVSLTVE +NSYIAWDFS++QG+
Sbjct  300  NVFANSPFFISADVAGASGSRENEEYKEIIVQAGRTCEVSLTVESVNSYIAWDFSVVQGK  359

Query  416  LNLQD--IGFSMEY  381
            ++++   +GF + +
Sbjct  360  ISMEPSALGFGLSF  373



>gb|EMS49914.1| hypothetical protein TRIUR3_19770 [Triticum urartu]
Length=402

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  414
            VFVNAPFFI+AEDAGA ++ KN+EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  304  VFVNAPFFISAEDAGA-DSRKNDEYRETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  362

Query  413  N  411
            +
Sbjct  363  S  363



>ref|XP_010496718.1| PREDICTED: uncharacterized protein LOC104773766, partial [Camelina 
sativa]
Length=303

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
            +VF N+PFFI+A+ AG + +  NEEY+E+ V AG+T+EVSL VE  NSYIAWDFSL+QG+
Sbjct  207  DVFANSPFFISADTAGILGSRDNEEYKEIIVQAGRTYEVSLMVESENSYIAWDFSLMQGK  266

Query  416  LNL  408
            +++
Sbjct  267  ISM  269



>ref|XP_010543128.1| PREDICTED: uncharacterized protein LOC104816146 isoform X3 [Tarenaya 
hassleriana]
Length=384

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 13/85 (15%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHE-----------VSLTVEDINSY  450
            NVF N+PFFI+A+ AGA  + +NEEY+E+ V AG+T E           VSLTVE +NSY
Sbjct  300  NVFANSPFFISADVAGASGSRENEEYKEIIVQAGRTCESYLCQETWRNAVSLTVESVNSY  359

Query  449  IAWDFSLIQGRLNLQD--IGFSMEY  381
            IAWDFS++QG+++++   +GF + +
Sbjct  360  IAWDFSVVQGKISMEPSALGFGLSF  384



>gb|EFN84723.1| SEC14-like protein 2 [Harpegnathos saltator]
Length=125

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
            NE+Y  V +  G+  E  ++  ++ S ++W+F     R    DI F +  +D+SG KT +
Sbjct  10   NEDYTTVVIRKGRKIEFDVSASEVGSILSWEF-----RSEGHDIKFGILRKDTSGTKTEV  64

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            +P RR   ++S++     C +   Y +V+DN+YS    K + Y V  +PP+ E+ AS +
Sbjct  65   IPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKVHYSVRVLPPMQETEASTS  123



>ref|XP_011139122.1| PREDICTED: SEC14-like protein 2 [Harpegnathos saltator]
Length=190

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
            NE+Y  V +  G+  E  ++  ++ S ++W+F     R    DI F +  +D+SG KT +
Sbjct  75   NEDYTTVVIRKGRKIEFDVSASEVGSILSWEF-----RSEGHDIKFGILRKDTSGTKTEV  129

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            +P RR   ++S++     C +   Y +V+DN+YS    K + Y V  +PP+ E+ AS +
Sbjct  130  IPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKVHYSVRVLPPMQETEASTS  188



>ref|XP_004353064.1| serpin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23536.1| serpin, putative [Acanthamoeba castellanii str. Neff]
Length=490

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 15/128 (12%)
 Frame = -2

Query  596  NVFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGR  417
             +  N+PFF+T E  G +     E  +EV VA  K HE  + VE     +AW+F L + +
Sbjct  335  KILENSPFFVTKEQVGGLSGPGEE--KEVLVA--KVHEEKIAVE-AGDEVAWEF-LTKNK  388

Query  416  LNLQDIGFSMEYEDSSGKKTPILPYR-RYESD----QGNFCTCMAGNYKLVWDNSYSSFF  252
                DI F + +     K   I+  + RYES      GN    +AG YKLVWDNSYS   
Sbjct  389  ----DIDFFVTFTKDGTKNEQIVKAKERYESHVNKVTGNHGCGVAGTYKLVWDNSYSWLT  444

Query  251  CKVLRYKV  228
             K L YKV
Sbjct  445  KKQLVYKV  452



>gb|AAF89109.1|AC074299_3 TEL1S.2 [Arabidopsis thaliana]
Length=88

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL  408
            NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL QG++ +
Sbjct  28   NEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLTQGKITM  68



>ref|XP_001121498.2| PREDICTED: SEC14-like protein 2-like [Apis mellifera]
Length=335

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
             E +  V++  G   E+++T  +I S ++W+F     R    DI F +  +D +G +  +
Sbjct  220  KENFTTVTIKKGGKLELNMTALEIGSLLSWEF-----RTENHDIKFGIVKKDDNGMQKEV  274

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            +P RR   ++ D+    TC +   Y +V+DN+YS    K + Y V  IPP
Sbjct  275  IPMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  324



>ref|XP_624865.3| PREDICTED: SEC14-like protein 2-like [Apis mellifera]
Length=391

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
             E +  V++  G   E+++T  +I S ++W+F     R    DI F +  +D +G +  +
Sbjct  276  KENFTTVTIKKGGKLELNMTALEIGSLLSWEF-----RTENHDIKFGIVKKDDNGMQKEV  330

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            +P RR   ++ D+    TC +   Y +V+DN+YS    K + Y V  IPP
Sbjct  331  IPMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  380



>gb|EFZ20476.1| hypothetical protein SINV_14001 [Solenopsis invicta]
Length=361

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 10/117 (9%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ G KT 
Sbjct  247  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGIKTE  301

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSA  195
            ++P RR   ++SD+    TC     Y +V+DN+YS    K + Y V  +PP  E++ 
Sbjct  302  VIPIRRVASHQSDEIGILTCETQTTYSVVFDNTYSFLRNKKVHYSVRMLPPAREAAT  358



>ref|XP_011155993.1| PREDICTED: SEC14-like protein 2 [Solenopsis invicta]
Length=390

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 10/117 (9%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ G KT 
Sbjct  276  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGIKTE  330

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSA  195
            ++P RR   ++SD+    TC     Y +V+DN+YS    K + Y V  +PP  E++ 
Sbjct  331  VIPIRRVASHQSDEIGILTCETQTTYSVVFDNTYSFLRNKKVHYSVRMLPPAREAAT  387



>ref|XP_003706144.1| PREDICTED: SEC14-like protein 2-like [Megachile rotundata]
Length=393

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = -2

Query  527  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  348
            ++Y  V++  G   E+ ++  ++ S ++W+F     R    DI F +  +D++G+K  ++
Sbjct  279  QDYTTVTIRKGGKLELDMSASEMGSLLSWEF-----RTEDHDIRFGILKKDTNGEKKEVI  333

Query  347  PYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVV  207
            P +R   ++ ++    TC +   Y +V+DNSYS    K + Y +  IPP V
Sbjct  334  PMKRVAAHQLEEIGILTCEVPATYSVVFDNSYSILRNKKIHYSIRVIPPAV  384



>ref|XP_003698581.1| PREDICTED: SEC14-like protein 2-like [Apis florea]
Length=391

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
             E +  V++  G   E+++T  ++ SY +W+F     R    DI F +  +D +G +  +
Sbjct  276  KENFTTVTIKKGGKLELNITALEMGSYYSWEF-----RTENHDIKFGIVKKDDNGMQKEV  330

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            +P RR   ++ D+    TC +   Y +++DN+YS    K + Y V  IPP
Sbjct  331  IPIRRVAAHQLDEIGILTCEVPSTYSIIFDNTYSIMRNKKIHYSVKVIPP  380



>ref|XP_002602154.1| hypothetical protein BRAFLDRAFT_234283 [Branchiostoma floridae]
 gb|EEN58166.1| hypothetical protein BRAFLDRAFT_234283, partial [Branchiostoma 
floridae]
Length=128

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = -2

Query  515  EVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP--ILPY  342
            E+SV AG++  + + VE     + W+F     +   ++IGFS+ Y++S   +    ++P 
Sbjct  21   EMSVKAGRSFALPILVEAPGIVLCWEF-----QTEPKNIGFSVTYKESEAHEDSQVLIPM  75

Query  341  RRYESD----QGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSA  195
             +  S     QG      AG Y L++DNSYS F  K L YK+    PV E+S+
Sbjct  76   CKCNSHRQAVQGELIAKRAGVYTLMFDNSYSRFTSKKLTYKLQVKRPVTEASS  128



>gb|EGI68383.1| SEC14-like protein 2 [Acromyrmex echinatior]
Length=375

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 10/111 (9%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ GKK  
Sbjct  263  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGKKIE  317

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            ++P RR   ++SD+    TC     Y +V+DN+YS    K + Y V  +PP
Sbjct  318  VIPIRRVASHQSDEIGLLTCETPTTYYVVFDNTYSILRNKKVHYSVRMLPP  368



>gb|KJE98138.1| SEC14-like protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=528

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -2

Query  545  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  387
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  385  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  440

Query  386  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCI  219
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  441  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  497



>ref|XP_011049938.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049939.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049940.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049941.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
Length=388

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 10/111 (9%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ GKK  
Sbjct  276  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGKKIE  330

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            ++P RR   ++SD+    TC     Y +V+DN+YS    K + Y V  +PP
Sbjct  331  VIPIRRVASHQSDEIGLLTCETPTTYYVVFDNTYSILRNKKVHYSVRMLPP  381



>ref|XP_006609824.1| PREDICTED: SEC14-like protein 2-like isoform X1 [Apis dorsata]
 ref|XP_006609825.1| PREDICTED: SEC14-like protein 2-like isoform X2 [Apis dorsata]
 ref|XP_006609826.1| PREDICTED: SEC14-like protein 2-like isoform X3 [Apis dorsata]
Length=391

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
             E +  V++  G   E+++T  +  S ++W+F     R    DI F +  +D++G +  +
Sbjct  276  KENFTTVTIKKGGKLELNMTALETGSLLSWEF-----RTENHDIKFGIVKKDNNGMQKEV  330

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            +P RR   ++ D+    TC +   Y +V+DN+YS    K + Y V  IPP
Sbjct  331  IPMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  380



>ref|XP_004342753.1| SEC14-like protein [Capsaspora owczarzaki ATCC 30864]
Length=629

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -2

Query  545  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  387
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  486  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  541

Query  386  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCI  219
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  542  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  598



>gb|KJE98137.1| SEC14-like protein [Capsaspora owczarzaki ATCC 30864]
Length=644

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -2

Query  545  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  387
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  501  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  556

Query  386  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCI  219
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  557  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  613



>ref|XP_011334815.1| PREDICTED: SEC14-like protein 2 isoform X2 [Cerapachys biroi]
Length=342

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  +   ++   ++W+F     R    DI F +  +D++ G +T 
Sbjct  227  NEDYTTVIVRKGGKLEFDIDTSEVGCILSWEF-----RSEDHDIKFGILKKDTANGTRTE  281

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            ++P RR   ++SD+    TC     Y +V+DNSYS    K + Y V  +PP  +   +  
Sbjct  282  VIPLRRVASHQSDEVGVLTCETPATYSIVFDNSYSLLRNKKVHYAVRVLPPAEQQKVTVK  341



>ref|XP_011334812.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 ref|XP_011334813.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 ref|XP_011334814.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 gb|EZA56876.1| SEC14-like protein [Cerapachys biroi]
Length=391

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            NE+Y  V V  G   E  +   ++   ++W+F     R    DI F +  +D++ G +T 
Sbjct  276  NEDYTTVIVRKGGKLEFDIDTSEVGCILSWEF-----RSEDHDIKFGILKKDTANGTRTE  330

Query  353  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            ++P RR   ++SD+    TC     Y +V+DNSYS    K + Y V  +PP  +   +  
Sbjct  331  VIPLRRVASHQSDEVGVLTCETPATYSIVFDNSYSLLRNKKVHYAVRVLPPAEQQKVTVK  390



>ref|XP_003394555.1| PREDICTED: LOW QUALITY PROTEIN: SEC14-like protein 2-like [Bombus 
terrestris]
Length=394

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 9/110 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
             E +  V++  G   E+ +   ++ S ++W+F     R    DI F +  +D +G +  +
Sbjct  279  KENFTTVTIKKGGKLELDIPASEMGSLLSWEF-----RTENHDIKFGIVKKDYNGTQKEV  333

Query  350  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            +P RR   ++ D+    TC +   Y +++DN+YS    K + Y V  IPP
Sbjct  334  IPMRRVAAHQLDEIGILTCEVPSTYSIIFDNTYSIIRNKKIHYSVKVIPP  383



>gb|EFX85554.1| hypothetical protein DAPPUDRAFT_300280 [Daphnia pulex]
Length=389

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 10/99 (10%)
 Frame = -2

Query  512  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  333
            +S+A G   ++   V+D N+ + WDF   +G     DIGF++ Y   SG+  P +PY R 
Sbjct  286  LSIANGSKEQLQFQVKDANTLLKWDFQSEEG-----DIGFAV-YRKKSGELIPFVPYDRV  339

Query  332  E----SDQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKV  228
            +     ++G      AG+Y L +DNS+S F  K + Y +
Sbjct  340  DCQMSPEEGEIHCEYAGHYVLEFDNSFSYFRSKKIWYSI  378



>ref|XP_003486550.1| PREDICTED: SEC14-like protein 2-like [Bombus impatiens]
Length=394

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 56/120 (47%), Gaps = 9/120 (8%)
 Frame = -2

Query  527  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  348
            E +  V++  G   E+ +   ++ S ++W+F     R    DI F +  +D +G +  ++
Sbjct  280  ENFTTVTIKKGGKLELDIPASEMGSLLSWEF-----RTENHDIRFGIVKKDYNGTQKEVI  334

Query  347  PYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASANQL  180
            P RR   ++ D+     C +   Y +++DN+YS    K + Y V  IPP      +   L
Sbjct  335  PMRRVAAHQLDEIGILICEVPSTYSIIFDNTYSIIRNKKIHYSVKVIPPTESQEITPTTL  394



>emb|CDW51773.1| CRAL TRIO domain containing protein [Trichuris trichiura]
Length=329

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 14/114 (12%)
 Frame = -2

Query  542  EASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEY---EDS  372
            E++  E Y EV+V AG  H V ++V++  S + W +     +   +DIGF++ +   E++
Sbjct  216  ESNDKESYTEVTVYAGHNHLVEISVDEAGSELYWKY-----KTTGEDIGFAVYFTDNEEA  270

Query  371  SGKKT--PILPYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKV  228
            +  KT  P+ PY R+E      +G      AG Y + +DN YS F  K L Y +
Sbjct  271  TDIKTMEPLFPYIRFECALVPIEGALVCEKAGRYIVEFDNCYSWFSAKELSYVI  324



>ref|XP_011307420.1| PREDICTED: SEC14-like protein 2 [Fopius arisanus]
Length=241

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 52/111 (47%), Gaps = 9/111 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
            NE++  V V  G   ++    E + S ++W+F     R    DI F +    + G+K  +
Sbjct  125  NEDFTTVIVKKGDKMKIDFVPEKLGSILSWEF-----RSENHDIRFGVLRRGTGGEKVEL  179

Query  350  LPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFCKVLRYKVDCIPPV  210
            +P RR   ++ D+    TC   G Y +V+DNSYS    K + Y V    P 
Sbjct  180  IPVRRVAAHQLDEVGVLTCEEPGTYSVVFDNSYSLLRNKKIHYNVRLAEPT  230



>gb|EFN74196.1| SEC14-like protein 2 [Camponotus floridanus]
Length=448

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  332  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  386

Query  353  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            ++P R+   ++SD+    TC     Y +V+DN+YS    K L Y V  +PP  E    A+
Sbjct  387  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  446



>ref|XP_011259189.1| PREDICTED: SEC14-like protein 2 isoform X1 [Camponotus floridanus]
Length=433

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  317  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  371

Query  353  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            ++P R+   ++SD+    TC     Y +V+DN+YS    K L Y V  +PP  E    A+
Sbjct  372  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  431



>ref|XP_011259195.1| PREDICTED: SEC14-like protein 2 isoform X2 [Camponotus floridanus]
Length=394

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  354
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  278  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  332

Query  353  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASAN  186
            ++P R+   ++SD+    TC     Y +V+DN+YS    K L Y V  +PP  E    A+
Sbjct  333  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  392



>ref|XP_010231534.1| PREDICTED: uncharacterized protein LOC100826543 isoform X3 [Brachypodium 
distachyon]
Length=339

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHE  483
            VFVNAPFFI+AEDAGA ++  ++EY+E  + AGKTHE
Sbjct  300  VFVNAPFFISAEDAGA-DSRTSDEYRETIIPAGKTHE  335



>ref|XP_008201186.1| PREDICTED: SEC14-like protein 3, partial [Tribolium castaneum]
Length=389

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 54/114 (47%), Gaps = 9/114 (8%)
 Frame = -2

Query  539  ASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK  360
            +S   ++    +  G+  ++   V +  S++ W+F     R    DI F +   D+ G  
Sbjct  255  SSTTRQFTTAVIKKGEKLKLDFIVVEEGSFLKWEF-----RTEAHDIRFGISLIDAEGNV  309

Query  359  TPILPYRR---YESDQGNFCTCMA-GNYKLVWDNSYSSFFCKVLRYKVDCIPPV  210
            TP++ ++R   ++ D+     C A   Y + +DN+YS    K + Y++   PP+
Sbjct  310  TPVIHHKRVAAHQIDESGVIACQAPATYTVTFDNTYSLLRSKKIHYEIHIAPPL  363



>ref|XP_007032240.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY03166.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=343

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  593  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEV  480
            VF N+PFFI+AEDA   E  K++EY E++V AGK++EV
Sbjct  301  VFANSPFFISAEDASMFETRKSDEYNEITVPAGKSYEV  338



>gb|EFA12792.1| hypothetical protein TcasGA2_TC002162 [Tribolium castaneum]
Length=409

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 9/125 (7%)
 Frame = -2

Query  539  ASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK  360
            +S   ++    +  G+  ++   V +  S++ W+F     R    DI F +   D+ G  
Sbjct  275  SSTTRQFTTAVIKKGEKLKLDFIVVEEGSFLKWEF-----RTEAHDIRFGISLIDAEGNV  329

Query  359  TPILPYRR---YESDQGNFCTCMA-GNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSAS  192
            TP++ ++R   ++ D+     C A   Y + +DN+YS    K + Y++   PP+ +    
Sbjct  330  TPVIHHKRVAAHQIDESGVIACQAPATYTVTFDNTYSLLRSKKIHYEIHIAPPLGKLDIL  389

Query  191  ANQLE  177
             N+ E
Sbjct  390  PNEDE  394



>gb|KFD58027.1| hypothetical protein M513_01260 [Trichuris suis]
 gb|KFD70789.1| hypothetical protein M514_01260 [Trichuris suis]
Length=383

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 56/114 (49%), Gaps = 14/114 (12%)
 Frame = -2

Query  542  EASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGK  363
            E++  E Y EV+V AG  H V ++V++  S + W +     +   +DIGF++ + D+   
Sbjct  270  ESNDKESYTEVTVYAGHNHLVEVSVDEAGSELYWKY-----KTTGEDIGFAVYFTDNEEA  324

Query  362  K-----TPILPYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKV  228
                   P+ PY R+E      +G      AG Y + +DN YS F  K L Y +
Sbjct  325  TDIKVMEPLFPYIRFECALVPIEGALVCEKAGRYIVEFDNCYSWFSAKELSYVI  378



>ref|XP_003724076.1| PREDICTED: FYVE and coiled-coil domain-containing protein 1-like 
isoform 1 [Strongylocentrotus purpuratus]
Length=1575

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 12/109 (11%)
 Frame = -2

Query  518   QEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP---IL  348
             +EV+VAA + H + + + D+   + W+F       + + IGFS+ ++DSS   +P   ++
Sbjct  1468  EEVTVAAYQKHNLPVAINDVGLMLCWEFV-----SSPKSIGFSVIFQDSSDSTSPHEELI  1522

Query  347   PYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
             P  +  S     QG       G Y L++DN +S F  KV++Y +    P
Sbjct  1523  PLCKCNSHQHAVQGELLARKPGVYTLIFDNKFSRFTSKVVKYSLHIKRP  1571



>ref|XP_780082.3| PREDICTED: FYVE and coiled-coil domain-containing protein 1-like 
isoform 2 [Strongylocentrotus purpuratus]
Length=1599

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 12/109 (11%)
 Frame = -2

Query  518   QEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP---IL  348
             +EV+VAA + H + + + D+   + W+F       + + IGFS+ ++DSS   +P   ++
Sbjct  1492  EEVTVAAYQKHNLPVAINDVGLMLCWEFV-----SSPKSIGFSVIFQDSSDSTSPHEELI  1546

Query  347   PYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
             P  +  S     QG       G Y L++DN +S F  KV++Y +    P
Sbjct  1547  PLCKCNSHQHAVQGELLARKPGVYTLIFDNKFSRFTSKVVKYSLHIKRP  1595



>ref|XP_002116332.1| hypothetical protein TRIADDRAFT_60316 [Trichoplax adhaerens]
 gb|EDV21365.1| hypothetical protein TRIADDRAFT_60316 [Trichoplax adhaerens]
Length=368

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -2

Query  545  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFS----MEYE  378
            + +   E+Y  V++A G T ++   +    + + W+F     +    +IGF     +E E
Sbjct  249  VNSRSEEDYSTVTIARGDTLKLQFDINIPGTLMKWEF-----KTENHNIGFGVVKVIENE  303

Query  377  DSSGKKTPILPYRRYES----DQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
            D + +   ++P  R       ++GN+    AG Y L +DNS+S    K L Y +D +PP
Sbjct  304  DGTIENYEVIPIARRSCQSTLEEGNYYCEDAGTYILCFDNSFSWLTGKSLHYAIDILPP  362



>ref|XP_003387861.1| PREDICTED: FYVE and coiled-coil domain-containing protein 1-like 
[Amphimedon queenslandica]
Length=1147

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 36/122 (30%), Positives = 60/122 (49%), Gaps = 14/122 (11%)
 Frame = -2

Query  566   TAEDAGAIEASKNEEYQEVS---VAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIG  396
             + E +G I  +     +EV+   V  GKTH V++ V    + + W F+        + I 
Sbjct  1025  SGEASGKIPGTPGSVIREVNDMEVEGGKTHTVTVMVRTPRTVVLWQFN-----SQPKGIA  1079

Query  395   FSMEYEDSSGKKT--PILPYRRYESDQ----GNFCTCMAGNYKLVWDNSYSSFFCKVLRY  234
               ++Y++S   +T   +LP RR  S +    G +    AG Y L++ N++S F  +VL Y
Sbjct  1080  VGLKYQESHETETQVEVLPLRRVMSHKTVLTGEYVAQKAGIYSLIFSNAHSKFSGRVLSY  1139

Query  233   KV  228
             KV
Sbjct  1140  KV  1141



>ref|XP_003747619.1| PREDICTED: SEC14-like protein 2-like [Metaseiulus occidentalis]
Length=401

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 14/126 (11%)
 Frame = -2

Query  527  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  348
            E  + + ++   +H++ L VE+  S I W F     R N  D+GF++  + + G     +
Sbjct  279  ENAKTIKLSKRSSHKIELPVENEGSVINWTF-----RTNGHDLGFALLRKKNDGSLEGCV  333

Query  347  PYRRYESD---QGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVE-----SSA  195
            P  R +     +  F TC ++G Y   +DNSYS F  K + + V+  PP  E     S A
Sbjct  334  PSTRVDCHVLPEEGFYTCNVSGTYIFKFDNSYSWFTDKTVTFDVNVAPPSDELEKTSSVA  393

Query  194  SANQLE  177
              NQ++
Sbjct  394  LENQIK  399



>ref|XP_003384214.1| PREDICTED: SEC14-like protein 2 [Amphimedon queenslandica]
Length=171

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 16/116 (14%)
 Frame = -2

Query  527  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK----  360
            ++ + V+V  G  H++ + V+   + I W++  +       DIGF + ++ +  K+    
Sbjct  4    DDMETVTVGRGSFHQIEIDVDTKGTLIRWEYLSVG-----YDIGFGLFFKRNDKKRRSRS  58

Query  359  ---TPILPYRRYESD---QGNFCTC-MAGNYKLVWDNSYSSFFCKVLRYKVDCIPP  213
               T I+P +R ES    +  F  C   G Y L +DN+YS    K +RY V  +PP
Sbjct  59   NEVTTIIPSKRSESHVIPETGFHECEHEGIYILKFDNTYSWTRTKEVRYSVQSLPP  114



>gb|EFX85397.1| hypothetical protein DAPPUDRAFT_222659 [Daphnia pulex]
Length=398

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 9/111 (8%)
 Frame = -2

Query  512  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  333
            +   AG   ++   ++  NS + W+F    G     DIGF + Y+ +      ++P  R 
Sbjct  291  IIAGAGGFKKLKYKIDVANSILRWEFMTEGG-----DIGFKVYYKSAEEGIVELVPLSRI  345

Query  332  ES----DQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSAS  192
            ES    ++G F +   G Y +V+DN++S    K +RY V   PPV  S  +
Sbjct  346  ESHLVTEEGEFVSEKPGKYVVVFDNTFSILRPKKVRYYVVVDPPVPGSPTA  396



>ref|XP_001660574.1| AAEL010027-PA [Aedes aegypti]
 gb|EAT38039.1| AAEL010027-PA [Aedes aegypti]
Length=410

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 12/121 (10%)
 Frame = -2

Query  530  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  351
            N  + E  +  G   ++    ED   ++ W+F     R    DI F ++  +   ++  I
Sbjct  282  NLTFTETEIKKGGKLKLVFDCEDSGCFLKWEF-----RTFDHDIKFGIKCVNKKTQENEI  336

Query  350  -LPYRR---YESDQGNFCTCMAG-NYKLVWDNSYSSFFCKVLRYKVDCIPPV--VESSAS  192
             +P +R   ++ D+  F TC  G  Y +++DNSYS F  K +RY V    P+  +E +AS
Sbjct  337  EVPLKRVASHQVDESGFITCQPGCTYSVLFDNSYSYFKTKKIRYSVLMTTPLSEIEQTAS  396

Query  191  A  189
            A
Sbjct  397  A  397



>ref|XP_005278854.1| PREDICTED: SEC14-like protein 2 isoform X1 [Chrysemys picta bellii]
Length=411

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 58/122 (48%), Gaps = 15/122 (12%)
 Frame = -2

Query  512  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYE------DSSGKKTPI  351
            V V+ G +H+V   +      + W F + +G     D+GF +  +        +G+ T +
Sbjct  282  VVVSRGSSHQVEYEILFPGCVLRWQF-MSEG----ADVGFGVYLKTRIGERQRAGEMTEV  336

Query  350  LPYRRYES----DQGNFCTCMAGNYKLVWDNSYSSFFCKVLRYKVDCIPPVVESSASANQ  183
            LP +RY +    + G+    MAG Y L +DN+YS    K + Y V+ + P  +S     Q
Sbjct  337  LPNQRYNAHLVPEDGSLTCSMAGVYVLRFDNTYSYLHAKKVNYTVEVLLPDKKSEEQIQQ  396

Query  182  LE  177
            LE
Sbjct  397  LE  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510