BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041D07

Length=476
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     146   1e-37   Solanum tuberosum [potatoes]
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          146   2e-37   Solanum lycopersicum
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     144   9e-37   Solanum tuberosum [potatoes]
emb|CDP16685.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     142   7e-36   Nicotiana tomentosiformis
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     141   1e-35   Solanum lycopersicum
emb|CAN82189.1|  hypothetical protein VITISV_031114                     141   1e-35   Vitis vinifera
ref|NP_001268190.1|  uncharacterized protein LOC100260066               141   2e-35   Vitis vinifera
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     140   2e-35   Nicotiana sylvestris
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               140   2e-35   Nicotiana tabacum [American tobacco]
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    140   2e-35   Vitis vinifera
gb|KDO43321.1|  hypothetical protein CISIN_1g0039662mg                  136   7e-35   Citrus sinensis [apfelsine]
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          139   9e-35   Eucalyptus grandis [rose gum]
gb|KEH22046.1|  ClC chloride channel family protein                     138   1e-34   Medicago truncatula
gb|KHN10806.1|  Chloride channel protein CLC-b                          136   6e-34   Glycine soja [wild soybean]
gb|KDO43317.1|  hypothetical protein CISIN_1g0039662mg                  135   6e-34   Citrus sinensis [apfelsine]
ref|NP_001236494.1|  chloride channel                                   136   8e-34   
gb|KHN01525.1|  Chloride channel protein CLC-b                          136   8e-34   Glycine soja [wild soybean]
gb|KHN24330.1|  Chloride channel protein CLC-b                          135   1e-33   Glycine soja [wild soybean]
ref|XP_007031847.1|  Chloride channel B isoform 1                       134   1e-33   
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    135   1e-33   Glycine max [soybeans]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    135   1e-33   Glycine max [soybeans]
ref|XP_006447085.1|  hypothetical protein CICLE_v10014341mg             133   2e-33   
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             134   4e-33   Citrus clementina [clementine]
ref|XP_007031848.1|  Chloride channel B isoform 2                       134   5e-33   
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         133   7e-33   Jatropha curcas
ref|XP_002300101.1|  Chloride channel protein CLC-a                     133   8e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002509531.1|  chloride channel clc, putative                     133   9e-33   Ricinus communis
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          133   1e-32   Populus euphratica
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             132   1e-32   Phaseolus vulgaris [French bean]
gb|KHG13135.1|  Chloride channel CLC-b -like protein                    132   2e-32   Gossypium arboreum [tree cotton]
gb|KJB76409.1|  hypothetical protein B456_012G087500                    132   2e-32   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    132   2e-32   Gossypium raimondii
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     131   5e-32   Sesamum indicum [beniseed]
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     130   8e-32   Cicer arietinum [garbanzo]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             130   9e-32   Prunus persica
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             130   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010111585.1|  Chloride channel protein CLC-b                     130   1e-31   Morus notabilis
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          129   3e-31   Prunus mume [ume]
gb|KHF97413.1|  Chloride channel CLC-b -like protein                    127   1e-30   Gossypium arboreum [tree cotton]
ref|XP_010556277.1|  PREDICTED: chloride channel protein CLC-b          126   1e-30   
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     126   2e-30   Sesamum indicum [beniseed]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    125   4e-30   Gossypium raimondii
ref|NP_001267676.1|  chloride channel protein CLC-b-like                125   6e-30   Cucumis sativus [cucumbers]
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     124   1e-29   Tarenaya hassleriana [spider flower]
gb|KEH25446.1|  ClC chloride channel family protein                     124   2e-29   Medicago truncatula
gb|KEH25445.1|  ClC chloride channel family protein                     123   2e-29   Medicago truncatula
ref|XP_003618847.1|  Chloride channel protein CLC-a                     124   2e-29   
gb|AES75065.2|  ClC chloride channel family protein                     124   2e-29   Medicago truncatula
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             123   3e-29   Capsella rubella
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             122   8e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     121   1e-28   
emb|CDX83663.1|  BnaC07g24030D                                          121   1e-28   
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY13685.1|  BnaA06g32380D                                          121   2e-28   Brassica napus [oilseed rape]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          121   2e-28   Brassica rapa
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                121   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     121   2e-28   Fragaria vesca subsp. vesca
ref|XP_008341308.1|  PREDICTED: chloride channel protein CLC-b          116   2e-28   
emb|CDY28488.1|  BnaC02g36720D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     120   3e-28   Brassica rapa
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     120   3e-28   
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          120   4e-28   Nelumbo nucifera [Indian lotus]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    119   5e-28   Arabis alpina [alpine rockcress]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    119   9e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    119   1e-27   
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     119   1e-27   
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    118   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    118   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     118   2e-27   
ref|XP_010678326.1|  PREDICTED: chloride channel protein CLC-b-li...    117   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008441632.1|  PREDICTED: chloride channel protein CLC-b-like     112   3e-27   
ref|NP_189353.1|  chloride channel protein CLC-b                        117   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     117   4e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002875360.1|  CLC-B                                              117   4e-27   
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     117   4e-27   
ref|NP_001031990.1|  chloride channel protein CLC-a                     116   5e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15925.1|  BnaA04g11860D                                          116   7e-27   Brassica napus [oilseed rape]
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          116   7e-27   Brassica rapa
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             116   7e-27   Eutrema salsugineum [saltwater cress]
gb|ADD09860.1|  chloride channel A                                      116   7e-27   Eutrema halophilum
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          115   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          115   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          115   1e-26   Camelina sativa [gold-of-pleasure]
gb|AAB17007.1|  voltage-gated chloride channel                          115   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11722.1|  BnaC06g13300D                                          115   2e-26   Brassica napus [oilseed rape]
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             115   2e-26   Capsella rubella
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     115   2e-26   Camelina sativa [gold-of-pleasure]
emb|CDY34173.1|  BnaA02g28670D                                          115   3e-26   Brassica napus [oilseed rape]
ref|XP_002868624.1|  ATCLC-A                                            115   3e-26   
ref|NP_198905.1|  chloride channel protein CLC-a                        115   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          115   3e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAA96057.1|  CLC-a chloride channel protein                         115   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    114   6e-26   Arabis alpina [alpine rockcress]
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     113   8e-26   Brassica rapa
emb|CDX67478.1|  BnaA07g15180D                                          113   8e-26   
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                113   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     112   2e-25   Cucumis melo [Oriental melon]
emb|CDX99630.1|  BnaC04g33870D                                          112   2e-25   
gb|EMS65031.1|  Chloride channel protein CLC-b                          109   8e-25   Triticum urartu
dbj|BAJ96369.1|  predicted protein                                      110   9e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      110   9e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      110   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91019.1|  predicted protein                                      110   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    110   1e-24   Setaria italica
gb|EMT27070.1|  Chloride channel protein CLC-b                          108   1e-24   
gb|EEE53145.1|  hypothetical protein OsJ_35963                          109   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     109   3e-24   Oryza brachyantha
gb|EMT23598.1|  hypothetical protein F775_52599                         108   3e-24   
gb|ABA98017.1|  Chloride channel protein CLC-a, putative, expressed     108   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69202.1|  hypothetical protein OsI_38195                          108   3e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001066692.1|  Os12g0438600                                       108   5e-24   
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          107   1e-23   Sorghum bicolor [broomcorn]
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     107   2e-23   Zea mays [maize]
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     106   2e-23   Brachypodium distachyon [annual false brome]
gb|KJB76408.1|  hypothetical protein B456_012G087500                    104   1e-22   Gossypium raimondii
ref|XP_007031850.1|  Chloride channel B isoform 4                       104   2e-22   
ref|XP_006848425.1|  hypothetical protein AMTR_s00013p00233550        93.2    8e-19   
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...  93.6    9e-19   
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g           86.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                79.7    4e-14   Medicago truncatula
emb|CBI27719.3|  unnamed protein product                              79.3    5e-14   Vitis vinifera
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...  79.3    6e-14   
ref|NP_001268085.1|  uncharacterized protein LOC100259734             79.3    6e-14   Vitis vinifera
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like   79.3    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...  78.2    1e-13   Cicer arietinum [garbanzo]
gb|KJB40519.1|  hypothetical protein B456_007G067500                  78.2    1e-13   Gossypium raimondii
ref|NP_001183936.1|  chloride channel protein                         78.2    1e-13   Zea mays [maize]
gb|KHG07842.1|  Chloride channel CLC-c -like protein                  77.8    2e-13   Gossypium arboreum [tree cotton]
gb|AFB33948.1|  hypothetical protein CL1659Contig1_02                 71.2    5e-13   Abies alba [abete-blanco]
ref|XP_007048601.1|  Chloride channel C                               76.6    5e-13   
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...  75.9    9e-13   Eucalyptus grandis [rose gum]
ref|XP_010057599.1|  PREDICTED: putative chloride channel-like pr...  75.5    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like   75.5    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010099521.1|  Chloride channel protein CLC-c                   72.0    1e-12   
ref|XP_011084086.1|  PREDICTED: putative chloride channel-like pr...  75.1    1e-12   
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...  75.5    1e-12   Solanum lycopersicum
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270        75.5    1e-12   Amborella trichopoda
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like   75.5    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...  75.1    2e-12   Sesamum indicum [beniseed]
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...  74.7    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960        74.7    2e-12   Amborella trichopoda
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like   74.7    2e-12   
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...  74.3    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like   73.9    4e-12   Cicer arietinum [garbanzo]
gb|AEW08796.1|  hypothetical protein CL1659Contig1_02                 68.9    4e-12   Pinus lambertiana
ref|XP_010240516.1|  PREDICTED: putative chloride channel-like pr...  73.9    4e-12   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  73.9    4e-12   
emb|CDP10469.1|  unnamed protein product                              73.9    4e-12   Coffea canephora [robusta coffee]
gb|AFB33961.1|  hypothetical protein CL1659Contig1_02                 68.9    5e-12   Pinus mugo [mountain pine]
gb|ADD09861.1|  chloride channel C                                    73.6    5e-12   Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg           73.6    5e-12   Eutrema salsugineum [saltwater cress]
gb|KDP42489.1|  hypothetical protein JCGZ_00286                       73.6    5e-12   Jatropha curcas
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...  73.2    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFB33956.1|  hypothetical protein CL1659Contig1_02                 68.2    7e-12   Pinus cembra [Arve]
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c        73.2    7e-12   Fragaria vesca subsp. vesca
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...  73.2    8e-12   Solanum tuberosum [potatoes]
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...  73.2    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like   73.2    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like   72.4    1e-11   Phoenix dactylifera
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...  72.4    1e-11   Nicotiana tomentosiformis
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...  72.4    1e-11   Nicotiana sylvestris
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...  72.4    1e-11   Nicotiana tomentosiformis
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...  72.4    1e-11   Nicotiana sylvestris
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c        72.4    1e-11   Brassica rapa
gb|EPS68170.1|  hypothetical protein M569_06601                       72.4    1e-11   Genlisea aurea
emb|CDX91539.1|  BnaC02g16210D                                        72.0    2e-11   
gb|KJB46914.1|  hypothetical protein B456_008G001200                  72.0    2e-11   Gossypium raimondii
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like   72.0    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW93911.1|  chloride channel 1                                    72.0    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27046.1|  Chloride channel protein CLC-c                        72.0    2e-11   
gb|KHG08138.1|  Chloride channel CLC-c -like protein                  71.6    2e-11   Gossypium arboreum [tree cotton]
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...  71.6    2e-11   Elaeis guineensis
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like   71.6    2e-11   Elaeis guineensis
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                 71.6    3e-11   Citrus sinensis [apfelsine]
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g          71.6    3e-11   
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g          71.2    3e-11   Glycine soja [wild soybean]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...  71.2    3e-11   Glycine max [soybeans]
gb|EEC78120.1|  hypothetical protein OsI_17660                        69.3    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c        71.2    3e-11   Brassica rapa
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...  71.2    3e-11   Phoenix dactylifera
emb|CDY21447.1|  BnaC03g27500D                                        71.2    3e-11   Brassica napus [oilseed rape]
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg           71.2    3e-11   Capsella rubella
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like   71.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...  71.2    3e-11   Phoenix dactylifera
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like   71.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c        70.9    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like   70.9    4e-11   Nicotiana tomentosiformis
gb|AFG64985.1|  hypothetical protein CL1659Contig1_02                 66.2    4e-11   Pinus taeda
gb|AEW08797.1|  hypothetical protein CL1659Contig1_02                 66.2    4e-11   Pinus radiata
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  70.9    4e-11   
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...  70.9    4e-11   Populus euphratica
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like   70.9    4e-11   Nicotiana sylvestris
ref|XP_002865761.1|  CLC-C                                            70.9    5e-11   
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...  70.5    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c        70.5    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002530769.1|  chloride channel clc, putative                   70.5    6e-11   Ricinus communis
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...  70.5    6e-11   Elaeis guineensis
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like   70.1    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g           70.5    7e-11   Phaseolus vulgaris [French bean]
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...  70.1    7e-11   Fragaria vesca subsp. vesca
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...  70.1    7e-11   Fragaria vesca subsp. vesca
ref|NP_199800.1|  chloride channel protein CLC-c                      70.1    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905340.1|  PREDICTED: putative chloride channel-like pr...  70.1    8e-11   Elaeis guineensis
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...  70.1    8e-11   
gb|ACF78606.1|  unknown                                               69.7    8e-11   Zea mays [maize]
ref|NP_001170245.1|  uncharacterized protein LOC100384199             69.3    8e-11   
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...  70.1    8e-11   Brachypodium distachyon [annual false brome]
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg           70.1    8e-11   Citrus clementina [clementine]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                 70.1    8e-11   Citrus sinensis [apfelsine]
ref|NP_001169702.1|  uncharacterized protein LOC100383583             68.6    8e-11   
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like   69.7    9e-11   Populus euphratica
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg           69.7    9e-11   
ref|XP_006385193.1|  Chloride channel protein CLC-c                   69.7    1e-10   
emb|CDX83179.1|  BnaA03g23270D                                        69.7    1e-10   
ref|XP_002527858.1|  chloride channel clc, putative                   69.7    1e-10   
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...  69.7    1e-10   Citrus sinensis [apfelsine]
gb|KDO42565.1|  hypothetical protein CISIN_1g003885mg                 69.3    1e-10   Citrus sinensis [apfelsine]
ref|XP_006431488.1|  hypothetical protein CICLE_v10000336mg           69.3    1e-10   
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...  69.7    1e-10   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg           69.7    1e-10   Prunus persica
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g          69.7    1e-10   Triticum urartu
ref|NP_001130407.2|  chloride channel G                               69.7    1e-10   
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  69.7    1e-10   Cucumis melo [Oriental melon]
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c        69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like   69.3    1e-10   
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like   69.3    1e-10   Oryza brachyantha
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...  69.3    1e-10   
ref|XP_006470993.1|  PREDICTED: chloride channel protein CLC-c-li...  68.9    1e-10   Citrus sinensis [apfelsine]
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like   69.3    1e-10   Nicotiana sylvestris
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like   69.3    2e-10   Nicotiana tomentosiformis
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...  69.3    2e-10   Setaria italica
ref|XP_003592890.1|  Chloride channel protein CLC-c                   68.9    2e-10   Medicago truncatula
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...  68.9    2e-10   Eucalyptus grandis [rose gum]
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250        68.9    2e-10   Sorghum bicolor [broomcorn]
gb|EMT05380.1|  Chloride channel protein CLC-c                        65.1    2e-10   
ref|NP_001268053.1|  uncharacterized protein LOC100245380             68.9    2e-10   Vitis vinifera
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...  68.6    2e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                  68.9    2e-10   
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...  68.6    2e-10   Eucalyptus grandis [rose gum]
gb|KJB53990.1|  hypothetical protein B456_009G015100                  68.6    2e-10   Gossypium raimondii
tpg|DAA35720.1|  TPA: chloride channel G                              68.9    2e-10   
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870            68.6    2e-10   
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530        68.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_004133731.1|  PREDICTED: chloride channel protein CLC-c-li...  68.6    2e-10   
ref|XP_004155280.1|  PREDICTED: chloride channel protein CLC-c-like   68.2    2e-10   
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like   68.6    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_006381102.1|  chloride channel-like family protein             68.6    3e-10   
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...  68.6    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...  68.6    3e-10   Cucumis sativus [cucumbers]
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870            68.6    3e-10   
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1         68.6    3e-10   Zea mays [maize]
gb|EAY94258.1|  hypothetical protein OsI_16029                        68.6    3e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE61792.1|  hypothetical protein OsJ_16396                        68.6    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KHG01487.1|  Putative chloride channel-like protein CLC-g          68.2    3e-10   Gossypium arboreum [tree cotton]
gb|EEE60792.1|  hypothetical protein OsJ_14377                        68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KJB64678.1|  hypothetical protein B456_010G060300                  68.2    3e-10   Gossypium raimondii
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...  68.2    3e-10   
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...  68.2    3e-10   Sesamum indicum [beniseed]
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like   68.2    3e-10   
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...  68.2    3e-10   Populus euphratica
dbj|BAB97267.1|  chloride channel                                     68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570        68.2    4e-10   Sorghum bicolor [broomcorn]
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...  67.8    4e-10   Oryza brachyantha
ref|NP_001267998.1|  uncharacterized protein LOC100255837             67.8    4e-10   Vitis vinifera
emb|CAN62616.1|  hypothetical protein VITISV_036165                   67.8    4e-10   Vitis vinifera
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g           67.8    5e-10   Phaseolus vulgaris [French bean]
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...  67.8    5e-10   Setaria italica
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...  67.8    5e-10   Vitis vinifera
gb|AIY56605.1|  CLC                                                   67.8    5e-10   Arachis hypogaea [goober]
ref|XP_003619757.1|  Chloride channel protein CLC-c                   67.8    5e-10   
emb|CBI29647.3|  unnamed protein product                              67.4    6e-10   Vitis vinifera
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c        67.4    6e-10   Tarenaya hassleriana [spider flower]
ref|NP_001275140.1|  chloride channel protein CLC-c-like              67.4    6e-10   Solanum tuberosum [potatoes]
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...  67.4    6e-10   Vitis vinifera
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like   67.4    7e-10   Solanum lycopersicum
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like   67.4    7e-10   
ref|XP_010657886.1|  PREDICTED: uncharacterized protein LOC100245...  67.0    7e-10   
gb|AES75975.2|  chloride channel ClC1 protein                         67.4    7e-10   
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g          67.4    7e-10   
ref|XP_010099780.1|  Chloride channel protein CLC-c                   67.0    7e-10   
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like   67.0    8e-10   
gb|ABB86548.1|  chloride channel-like protein Osclc                   67.0    9e-10   
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like   67.0    9e-10   
emb|CAJ86158.1|  H0413E07.11                                          67.0    9e-10   
emb|CAD41919.2|  OSJNBa0033G05.20                                     66.6    1e-09   
dbj|BAD16425.1|  chloride channel                                     66.6    1e-09   
gb|KEH26640.1|  chloride channel ClC1 protein                         66.6    1e-09   
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like   66.6    1e-09   
ref|NP_001047143.2|  Os02g0558100                                     66.6    1e-09   
dbj|BAB97268.1|  chloride channel                                     66.6    1e-09   
ref|XP_006587398.1|  PREDICTED: chloride channel protein CLC-c-li...  66.6    1e-09   
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c        66.6    1e-09   
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...  66.6    1e-09   
gb|KHM99790.1|  Chloride channel protein CLC-c                        66.6    1e-09   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...  66.6    1e-09   
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...  66.6    1e-09   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...  66.6    1e-09   
gb|KHN24457.1|  Chloride channel protein CLC-c                        66.2    1e-09   
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like   66.2    1e-09   
ref|XP_006599665.1|  PREDICTED: chloride channel protein CLC-c-li...  66.2    1e-09   
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like   66.2    1e-09   
gb|AAQ56538.1|  putative chloride channel                             66.2    2e-09   
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like   66.2    2e-09   
emb|CDO97645.1|  unnamed protein product                              66.2    2e-09   
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...  66.2    2e-09   
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...  65.9    2e-09   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...  65.9    2e-09   
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...  65.9    2e-09   
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like   65.9    2e-09   
gb|AFW70592.1|  hypothetical protein ZEAMMB73_317914                  65.5    2e-09   
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg              65.9    2e-09   
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...  65.5    2e-09   
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                   65.5    2e-09   
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890        65.5    2e-09   
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like   65.5    3e-09   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...  65.5    3e-09   
gb|KDP44103.1|  hypothetical protein JCGZ_05570                       65.1    3e-09   
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...  65.1    4e-09   
ref|XP_006385076.1|  Chloride channel protein CLC-c                   64.7    4e-09   
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g          64.7    4e-09   
ref|XP_006389435.1|  chloride channel-like family protein             64.7    5e-09   
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like   64.7    5e-09   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like   64.3    5e-09   
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...  64.3    6e-09   
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg           64.3    6e-09   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...  64.3    6e-09   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...  64.3    6e-09   
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like   64.3    7e-09   
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg              64.3    7e-09   
ref|XP_004512645.1|  PREDICTED: chloride channel protein CLC-c-li...  63.9    8e-09   
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...  63.9    8e-09   
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                  63.9    9e-09   
ref|XP_008379004.1|  PREDICTED: chloride channel protein CLC-c        63.5    9e-09   
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                  63.5    1e-08   
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899           63.5    1e-08   
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like   63.5    1e-08   
ref|NP_001105216.1|  LOC542114                                        63.5    1e-08   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...  63.5    1e-08   
gb|EMS67360.1|  Chloride channel protein CLC-c                        63.5    1e-08   
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480        63.2    1e-08   
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...  63.2    1e-08   
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c        63.2    2e-08   
gb|KEH32756.1|  chloride channel ClC1 protein                         63.2    2e-08   
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...  62.8    2e-08   
ref|NP_198313.2|  putative chloride channel-like protein CLC-g        62.8    2e-08   
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...  62.8    2e-08   
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg           62.8    2e-08   
emb|CDY12393.1|  BnaC08g08120D                                        62.0    4e-08   
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576           61.6    5e-08   
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906           61.6    5e-08   
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like   61.6    5e-08   
gb|ADF30876.1|  chloride channel protein                              61.6    5e-08   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...  61.2    6e-08   
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...  61.2    7e-08   
ref|XP_010554105.1|  PREDICTED: chloride channel protein CLC-b-like   56.6    8e-08   
dbj|BAJ92873.1|  predicted protein                                    60.8    8e-08   
ref|XP_006388253.1|  hypothetical protein POPTR_0261s002201g          59.7    1e-07   
gb|KJB40520.1|  hypothetical protein B456_007G067500                  60.1    1e-07   
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...  60.1    2e-07   
tpg|DAA56573.1|  TPA: chloride channel protein                        59.7    2e-07   
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c        59.7    2e-07   
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...  59.7    2e-07   
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...  59.7    2e-07   
gb|EPS73799.1|  hypothetical protein M569_00956                       59.7    2e-07   
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c        59.3    2e-07   
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg           59.3    3e-07   
gb|EEC71893.1|  hypothetical protein OsI_04638                        59.3    3e-07   
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...  59.3    3e-07   
dbj|BAD82092.1|  putative chloride channel                            59.3    3e-07   
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...  59.3    3e-07   
gb|EEE55755.1|  hypothetical protein OsJ_04269                        59.3    3e-07   
emb|CDY47559.1|  BnaA08g07280D                                        58.9    3e-07   
gb|KCW82961.1|  hypothetical protein EUGRSUZ_C04346                   58.5    4e-07   
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...  57.8    8e-07   
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like   57.8    8e-07   
gb|KDP30234.1|  hypothetical protein JCGZ_17016                       57.8    9e-07   
ref|XP_006370817.1|  hypothetical protein POPTR_0019s00230g           57.0    1e-06   
gb|EMT28663.1|  Chloride channel protein CLC-c                        57.4    1e-06   
ref|XP_002325287.2|  hypothetical protein POPTR_0019s00230g           57.0    1e-06   
gb|KCW82974.1|  hypothetical protein EUGRSUZ_C04362                   56.6    2e-06   
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg           56.6    2e-06   
gb|KHG02940.1|  Putative chloride channel-like protein CLC-g          56.6    2e-06   
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...  56.6    2e-06   
gb|EMS55037.1|  Chloride channel protein CLC-c                        56.2    2e-06   
gb|EMS50378.1|  Chloride channel protein CLC-c                        56.2    2e-06   
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...  55.8    3e-06   
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g     55.8    3e-06   
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...  54.7    9e-06   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...  54.3    1e-05   
ref|XP_001756485.1|  predicted protein                                53.9    1e-05   
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...  51.6    7e-05   
emb|CDM85188.1|  unnamed protein product                              48.9    6e-04   



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   146 bits (369),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/103 (71%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSW+DLAE+WGKI +VAV   EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  673  EWEVREKFSWIDLAERWGKIEDVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  732

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL VFPHL
Sbjct  733  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHL  775



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   146 bits (368),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 73/103 (71%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSW+DLAE+WGKI +VAV   EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  673  EWEVREKFSWIDLAERWGKIEDVAVTKSEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  732

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL VFPHL
Sbjct  733  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILTVFPHL  775



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   144 bits (364),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEV EKF+W+DLAE+WGKI ++AV  DEM M+V LHPL  TTP +  ES+SVAKAM  F
Sbjct  662  DWEVEEKFTWIDLAERWGKIEDIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAF  721

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  M++ PK QAAG FPV GIL RQD R  NIL VFPHLA
Sbjct  722  RQVGLRHMIIVPKYQAAGVFPVVGILTRQDLRACNILNVFPHLA  765



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WVDLAE+WGKI +V V  DEM M+V LHPLT TTP++  ES+S AKAM LF
Sbjct  675  EWEVREKFTWVDLAERWGKIDDVTVTKDEMEMYVDLHPLTNTTPYTVLESMSAAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  M++ PK QA+G  PV GIL RQD R  NIL  FPHLA
Sbjct  735  RQVGLRHMIIIPKYQASGVSPVVGILTRQDLRAHNILSAFPHLA  778



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   142 bits (357),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W+DLAE+ GKI +V V  DEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  674  EWEVREKFTWIDLAERGGKIEDVVVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLF  733

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL VFPHL
Sbjct  734  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHL  776



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   141 bits (356),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  471  WEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            WEV EKF+W+DLAE+WGKI ++AV  DEM M+V LHPL  TTP +  ES+SVAKAM  FR
Sbjct  652  WEVEEKFTWIDLAERWGKIEDIAVTKDEMEMYVDLHPLINTTPHTVVESLSVAKAMVAFR  711

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            QVGL  M++ PK QAAG FPV GIL RQD R  NIL V PHLA
Sbjct  712  QVGLRHMIIVPKYQAAGVFPVVGILTRQDLRACNILNVIPHLA  754



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W++LAE+ GK   VAV NDEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  641  EWEVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  700

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL  FPHLA
Sbjct  701  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLA  744



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W++LAE+ GK   VAV NDEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  677  EWEVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL  FPHLA
Sbjct  737  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLA  780



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W+DLAE+ GKI +V V  DEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  674  EWEVREKFTWIDLAERGGKIEDVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLF  733

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL VFPHL
Sbjct  734  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHL  776



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W+DLAE+ GKI +V V  DEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  674  EWEVREKFTWIDLAERGGKIEDVLVTKDEMEMYVDLHPLTNTTPYTVVESLSVAKAMVLF  733

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL VFPHL
Sbjct  734  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHL  776



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+W++LAE+ GK   VAV NDEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  677  EWEVREKFTWIELAEREGKFEEVAVTNDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL  FPHLA
Sbjct  737  RQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAYNILTAFPHLA  780



>gb|KDO43321.1| hypothetical protein CISIN_1g0039662mg [Citrus sinensis]
Length=447

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSWV+LAE+ GKI  VAV ++EM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  336  EWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLF  395

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK +AAG  PV GIL RQD R  NIL  FPHL
Sbjct  396  RQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL  438



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   139 bits (349),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVRE+FSW+DLAE+ GKI  VAV  DEM M+V LHP T TTP++  ES+SVAKAM LF
Sbjct  676  DWEVRERFSWIDLAEREGKIEEVAVTRDEMEMYVDLHPFTNTTPYTVVESMSVAKAMVLF  735

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QAAG  PV G+L RQD R  NIL  FPHLA
Sbjct  736  RQVGLRHMLILPKYQAAGVSPVVGVLTRQDLRAYNILAAFPHLA  779



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ GKI  VA+  +EM MFV LHPLT TTPF+  ESISVAKAM LF
Sbjct  684  EWEVREKFTWVELAEREGKIEEVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILF  743

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  744  RQVGLRHLLVVPKYQASGVCPVIGILTRQDLLAYNILTVFPHLA  787



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  662  EWEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMTLF  721

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  722  RQVGLRHLLVVPKYQASGISPVIGILTRQDLLAQNILTVFPHLA  765



>gb|KDO43317.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43318.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43319.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
 gb|KDO43320.1| hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]
Length=595

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSWV+LAE+ GKI  VAV ++EM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  484  EWEVREKFSWVELAEREGKIEEVAVTSEEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLF  543

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK +AAG  PV GIL RQD R  NIL  FPHL
Sbjct  544  RQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL  586



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   136 bits (342),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I +VAV  +EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  675  EWEVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  735  RQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHLA  778



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   136 bits (342),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I +VAV  +EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  675  EWEVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  735  RQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHLA  778



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  661  EWEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  720

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  721  RQVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLA  764



>ref|XP_007031847.1| Chloride channel B isoform 1 [Theobroma cacao]
 ref|XP_007031849.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02773.1| Chloride channel B isoform 1 [Theobroma cacao]
 gb|EOY02775.1| Chloride channel B isoform 1 [Theobroma cacao]
Length=606

 Score =   134 bits (337),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WVDLAE+  KI  VAV  DEM M+  LHPLT TTP++  ES+SVAKAM LF
Sbjct  494  EWEVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLF  553

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NIL  FPHLA
Sbjct  554  RQVGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILTAFPHLA  597



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  668  EWEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  728  RQVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLA  771



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  678  EWEVREKFTWVELAEREGSIEEVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  738  RQVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNILTVFPHLA  781



>ref|XP_006447085.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 gb|ESR60325.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=605

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSWV+LAE+ GKI  VAV + EM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  494  EWEVREKFSWVELAEREGKIEEVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLF  553

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK +AAG  PV GIL RQD R  NIL  FPHL
Sbjct  554  RQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL  596



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKFSWV+LAE+ GKI  VAV + EM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  672  EWEVREKFSWVELAEREGKIEEVAVTSAEMEMYIDLHPLTNTTPYTVIESMSVAKAMVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK +AAG  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLVVPKYEAAGVSPVVGILTRQDLRAFNILTAFPHL  774



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   134 bits (336),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WVDLAE+  KI  VAV  DEM M+  LHPLT TTP++  ES+SVAKAM LF
Sbjct  675  EWEVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NIL  FPHLA
Sbjct  735  RQVGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILTAFPHLA  778



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 70/104 (67%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE REKFSWVDLAE+ GKI  V V   EM MFV LHPLT TTP++  ES+SVAKAM LF
Sbjct  676  EWEAREKFSWVDLAEREGKIEEVPVTRAEMEMFVDLHPLTNTTPYTVVESMSVAKAMVLF  735

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QAAG  PV GIL RQD    NIL  FPHLA
Sbjct  736  RQVGLRHLLIVPKYQAAGVPPVVGILTRQDLMAYNILTAFPHLA  779



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF WV+LAE+ G I  VAV  +EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  673  EWEVREKFDWVELAERDGTIEEVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  732

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL  FPHL
Sbjct  733  RQVGLRHMLILPKYQAAGVPPVVGILTRQDLRAHNILLAFPHL  775



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   133 bits (335),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVR+KF+WVDLAE+  KI  VAV  DEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  675  EWEVRQKFTWVDLAERELKIEEVAVTRDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK +A+G  PV GIL RQD R  NIL  FPHLA
Sbjct  735  RQVGLRHLLIVPKYEASGVPPVVGILTRQDLRAYNILSAFPHLA  778



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF WV+LAE+ G I  VAV  +EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  673  EWEVREKFDWVELAERDGTIEEVAVTRNEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  732

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD R  NIL  FPHL
Sbjct  733  RQVGLRHMLILPKYQAAGVPPVVGILTRQDLRAHNILLAFPHL  775



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+WV+LAE+ G I +VAV  +EM MFV LHPLT TTPF+  ES+SVAKA+ LF
Sbjct  674  DWEVREKFTWVELAEREGNIEDVAVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKALVLF  733

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHL
Sbjct  734  RQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILTVFPHL  776



>gb|KHG13135.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=717

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+  KI  VAV  DEM M+V LHPLT TTPF+  ES+SVAKA+ LF
Sbjct  609  EWEVREKFNWVELAERELKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESMSVAKALVLF  668

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NIL  FPHL
Sbjct  669  RQVGLRHLLIVPKYQGAGVAPVVGILTRQDLRAYNILSAFPHL  711



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+  KI  VAV  DEM M+V LHPLT TTPF+  ES+SVAKA+ LF
Sbjct  677  EWEVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NIL  FPHL
Sbjct  737  RQVGLRHLLIVPKYQGAGVTPVVGILTRQDLRAYNILSAFPHL  779



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+  KI  VAV  DEM M+V LHPLT TTPF+  ES+SVAKA+ LF
Sbjct  677  EWEVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NIL  FPHL
Sbjct  737  RQVGLRHLLIVPKYQGAGVAPVVGILTRQDLRAYNILSAFPHL  779



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ +DLAE+ GKI  V V  DEM M+V LHPL+ TTP++  ES+SVAKAM LF
Sbjct  675  EWEVREKFTSIDLAERGGKIEEVTVTKDEMEMYVDLHPLSNTTPYTVVESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG +PV GIL RQD R  NIL   P L
Sbjct  735  RQVGLRHMLILPKYQAAGVYPVVGILTRQDLRAHNILSALPQL  777



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   130 bits (328),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE REKF+WV+LAE+ G I  VA+  +EM MFV LHPLT TTPF+  ESISVAKAM LF
Sbjct  680  EWEAREKFTWVELAEREGNIEEVAITREEMEMFVDLHPLTNTTPFTVLESISVAKAMILF  739

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
             QVGL  +L+ PK QA+G  PV GIL RQD    NIL VFPHLA
Sbjct  740  HQVGLRHLLVVPKYQASGVCPVIGILTRQDLLAHNILTVFPHLA  783



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   130 bits (327),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ GKI  VAV ++EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  679  EWEVREKFTWVELAEREGKIEEVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLF  738

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQ+GL  +L+ PK +AAG  PV GIL RQD    NIL  FPHL
Sbjct  739  RQLGLRHLLIVPKYEAAGVPPVVGILTRQDLIAYNILNAFPHL  781



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVR+KF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  679  DWEVRQKFTWVELAEREGSIEGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  738

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK QA+G  PV GIL RQD    NI  VFPHLA
Sbjct  739  RQVGLRHLLVVPKYQASGVSPVIGILTRQDLLAHNISTVFPHLA  782



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   130 bits (326),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 66/104 (63%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ VDLAE+ G I  V V  DEM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  676  EWEVREKFTSVDLAEREGTIEEVVVTRDEMDMYIDLHPLTNTTPYTVVESMSVAKAMVLF  735

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R VGL  ML+ PK +AAG  P+ GIL RQD R  NIL  FPHLA
Sbjct  736  RAVGLRHMLIVPKYEAAGVPPIVGILTRQDLRAHNILSAFPHLA  779



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   129 bits (323),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+ GKI  VAV ++EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  679  EWEVREKFTWVELAEREGKIEEVAVTSEEMEMYVDLHPLTNTTPYTVMESMSVAKAMVLF  738

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQ+GL  +L+ PK  AAG  PV GIL RQD    NIL  FPHL
Sbjct  739  RQLGLRHLLIVPKYVAAGVPPVVGILTRQDLIAYNILNAFPHL  781



>gb|KHF97413.1| Chloride channel CLC-b -like protein [Gossypium arboreum]
Length=721

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEV++KF+WV+L+E+  KI  VAV +DEM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  609  DWEVQKKFNWVELSERELKIEQVAVAHDEMEMYIDLHPLTNTTPYTVVESMSVAKAMVLF  668

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK Q AG   V GIL RQD R  NIL VFPHLA
Sbjct  669  RQVGLRHMLIVPKYQGAGVPAVVGILTRQDLRAYNILTVFPHLA  712



>ref|XP_010556277.1| PREDICTED: chloride channel protein CLC-b [Tarenaya hassleriana]
Length=653

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+WV+LAE+      VAV + +M M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  542  DWEVREKFTWVELAEREDNFEEVAVTSADMQMYVDLHPLTNTTPYTVVESMSVAKAMVLF  601

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QAAG  PV GIL RQD R  NIL  FPHL
Sbjct  602  RQVGLRHLLIVPKIQAAGMSPVLGILTRQDLRAYNILQAFPHL  644



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ +DLAE+   I  V V  DEM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  675  EWEVREKFTSIDLAERGATIEEVTVTKDEMEMYVDLHPLTNTTPYTVVESMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  ML+ PK QAAG  PV GIL RQD    NIL  FPHL
Sbjct  735  RQVGLRHMLILPKYQAAGVSPVVGILTRQDLIAHNILSAFPHL  777



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   125 bits (315),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEV+EKF+WV+L+E+  KI  VAV +DEM M++ LHPLT TTP++  ES+SVAKAM LF
Sbjct  676  DWEVQEKFNWVELSERELKIEQVAVTHDEMEMYMDLHPLTNTTPYTVVESMSVAKAMVLF  735

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK Q AG   V GIL RQD R  NI  VFPHLA
Sbjct  736  RQVGLRHMLIVPKYQGAGVPAVVGILTRQDLRAYNISTVFPHLA  779



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   125 bits (314),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 64/104 (62%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+WV+LAE+ GKI  + V  +EM M+V LHPLT TTP++  ES+SVAKA+ LF
Sbjct  677  DWEVREKFTWVELAEREGKIEELVVTKEEMEMYVDLHPLTNTTPYTVLESMSVAKALVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK +AAG  PV GIL RQD R  NIL  FP LA
Sbjct  737  RQVGLRHLLIVPKYEAAGVPPVIGILTRQDLRPYNILSAFPDLA  780



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   124 bits (312),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+WV+LAE+        V + EM M+V LHPLT TTP++  ES+SVAKAM LF
Sbjct  670  DWEVREKFTWVELAEREDNFEEATVTSSEMQMYVDLHPLTNTTPYTVVESMSVAKAMVLF  729

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QAAG  PV GIL RQD R  NIL  FPHL
Sbjct  730  RQVGLRHLLIVPKIQAAGMCPVVGILTRQDLRAYNILQAFPHL  772



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NV-AVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKFSWV+LAE+   I +V  V  +EM MFV LHPLT TTPF+  ES+SVAKA  L
Sbjct  609  EWEVREKFSWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARIL  668

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FRQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHL
Sbjct  669  FRQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHL  712



>gb|KEH25445.1| ClC chloride channel family protein [Medicago truncatula]
Length=646

 Score =   123 bits (309),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NV-AVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKFSWV+LAE+   I +V  V  +EM MFV LHPLT TTPF+  ES+SVAKA  L
Sbjct  533  EWEVREKFSWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARIL  592

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FRQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHL
Sbjct  593  FRQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHL  636



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NV-AVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKFSWV+LAE+   I +V  V  +EM MFV LHPLT TTPF+  ES+SVAKA  L
Sbjct  667  EWEVREKFSWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARIL  726

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FRQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHL
Sbjct  727  FRQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHL  770



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NV-AVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKFSWV+LAE+   I +V  V  +EM MFV LHPLT TTPF+  ES+SVAKA  L
Sbjct  662  EWEVREKFSWVELAEREENIEDVIGVTKEEMEMFVDLHPLTNTTPFTVLESMSVAKARIL  721

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FRQVGL  ML+ PK QA+G  PV GIL RQD    NIL VFPHL
Sbjct  722  FRQVGLRHMLVVPKYQASGVSPVIGILTRQDLLAYNILPVFPHL  765



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  668  EWEVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  728  RQVGLRHLLIVPKIQASGMCPVVGILTRQDLRAHNILQAFPHL  770



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  667  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  726

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QA G  PV GIL RQD R  NIL  FPHL
Sbjct  727  RQVGLRHLLIVPKIQATGMSPVVGILTRQDLRAHNILQAFPHL  769



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWG-KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKF+ VDLA+K G KI  + +  DEM M++ LHP T  TP++  E++SVAKAM L
Sbjct  675  EWEVREKFTSVDLAQKKGPKIEEIVLTEDEMDMYIDLHPFTNATPYTVLETMSVAKAMVL  734

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FRQV L  +L+ PK Q AG  PV GIL RQD R  NILG FPHL
Sbjct  735  FRQVALRHLLIVPKYQGAGISPVVGILTRQDLRAHNILGAFPHL  778



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ P+ QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLIVPRIQASGRSPVVGILTRQDLRACNILQAFPHL  774



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   121 bits (304),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVR  F+ VDLAEK  K+ +V +  +EM M+V LHP T TTP++  ES+SVAKA+ LF
Sbjct  670  EWEVRAAFTSVDLAEKGQKVEHVKLTEEEMDMYVDLHPFTNTTPYTVVESMSVAKAVVLF  729

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK Q AG  PV GIL RQD R  NILG FPHLA
Sbjct  730  RQVGLRHLLVIPKYQGAGISPVVGILTRQDLRAHNILGAFPHLA  773



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ P+ QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLIVPRIQASGRSPVIGILTRQDLRAYNILQAFPHL  774



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ P+ QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLIVPRIQASGRSPVIGILTRQDLRAYNILQAFPHL  774



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEV EKF+ +DLAE+   I  V V  DEM M+V LHPLT TTP++  ESISVAKAM LF
Sbjct  676  EWEVIEKFTCMDLAERGATIEEVTVSKDEMEMYVDLHPLTNTTPYTVVESISVAKAMVLF  735

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQ+ L  ML+ PK QAAG  PV GIL RQD    NIL  FPHL
Sbjct  736  RQLALRHMLILPKYQAAGVSPVVGILTRQDLIAHNILSAFPHL  778



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 65/103 (63%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+  KI  VAV +DEM M+V LHPLT TTP +  E++SVAKAM LF
Sbjct  678  EWEVREKFTAVELAERELKIEEVAVTSDEMEMYVDLHPLTNTTPHTVLETMSVAKAMVLF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK +AAG  PV GIL RQD    NIL  FPHL
Sbjct  738  RQVGLRHLLILPKYEAAGVPPVVGILTRQDLIAYNILNAFPHL  780



>ref|XP_008341308.1| PREDICTED: chloride channel protein CLC-b [Malus domestica]
Length=283

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EW+VREKF+ V+LAE+  KI  VAV  DEM M+V LHPLT  TP++  E +SVAKAM LF
Sbjct  171  EWKVREKFTSVELAEREWKIEEVAVTKDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLF  230

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ P  +A+   PV GIL RQD    NIL  FPHLA
Sbjct  231  RQVGLRHLLVVPNYEASQVPPVVGILTRQDLIAYNILNAFPHLA  274



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +G  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLIVPKIQVSGMSPVVGILTRQDLRAYNILQAFPHL  774



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +G  PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLWHLLIVPKIQVSGMSPVVGILTRQDLRAYNILQAFPHL  774



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWG-KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            EWEVREKF+ VDLA K G K+  + +  DEM M++ LHP T TTP++  E++SVAKA+ L
Sbjct  683  EWEVREKFTSVDLARKKGPKLEEMVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVL  742

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            FRQV L  +L+ PK Q AG  PV GIL RQD R  NILG FPHLA
Sbjct  743  FRQVALRHLLIIPKYQGAGISPVVGILTRQDLRAHNILGAFPHLA  787



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   120 bits (300),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EW+VREKF+   LAE+  KI  VA+  DEM M+V LHPLT TTP++  ES+SVAKA+ LF
Sbjct  670  EWKVREKFTSAVLAERGRKIEEVAITEDEMEMYVDLHPLTNTTPYTVVESMSVAKAIVLF  729

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  ML+ PK +AAG  PV GIL RQD R  NIL  F HLA
Sbjct  730  RQVGLRQMLIIPKYRAAGISPVVGILTRQDLRASNILSAFSHLA  773



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   119 bits (299),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  667  EWEVREKFPWDELAEREDNFDDVAISSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  726

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQ+GL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  727  RQLGLRHLLIVPKIQASGMSPVVGILTRQDLRAYNILQAFPHL  769



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   119 bits (298),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+L E+      VA+   EM M+V LHP T  TP++  E +SVAKAM LF
Sbjct  719  EWEVREKFTWVELTERDLNFEQVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLF  778

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQV L  ML+ PK   +G +P+ GIL RQD R  NI  VFPHLA
Sbjct  779  RQVALRHMLIVPKYHGSGIYPITGILTRQDLRAHNIQNVFPHLA  822



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE   KI  VAV  DEM M+V LHPLT  TP++  E +SVAKAM LF
Sbjct  678  EWEVREKFTSVELAEXEAKIEEVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ PK +A+G  P+ GIL RQD    NIL  FPHL 
Sbjct  738  RQVGLRHLLIVPKYEASGVPPLVGILTRQDLIAYNILNAFPHLT  781



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  632  EWEVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  691

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +G  PV GIL RQD R  NIL  FP L
Sbjct  692  RQVGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQL  734



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  668  EWEVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +G  PV GIL RQD R  NIL  FP L
Sbjct  728  RQVGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQL  770



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVRE+F  VDLA+K  KI  V +  DEM M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  682  EWEVREQFMSVDLAQKGPKIQEVVLTEDEMDMYIDLHPFTNTTPYTVVETMSVAKAVVLF  741

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQV L  +L+ PK Q AG  P+ GIL RQD    NILG FPHLA
Sbjct  742  RQVALRHLLIVPKYQGAGISPIVGILTRQDLIAHNILGAFPHLA  785



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  632  EWEVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  691

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q++G  PV GIL RQD R  NIL  FP +
Sbjct  692  RQVGLRHLLIVPKIQSSGLCPVVGILTRQDLRAHNILQAFPQM  734



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  668  EWEVREKFPWDELAEREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q++G  PV GIL RQD R  NIL  FP +
Sbjct  728  RQVGLRHLLIVPKIQSSGLCPVVGILTRQDLRAHNILQAFPQM  770



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+ GKI  VAV +DEM M+V LHPLT  TP++  E +SVAKAM LF
Sbjct  675  EWEVREKFTSVELAEREGKIEEVAVKSDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQVGL  +L+ P  +A+   PV GIL RQD    NIL  FPHLA
Sbjct  735  RQVGLRHLLVVPNYEASRLPPVVGILTRQDLIAYNILNAFPHLA  778



>ref|XP_010678326.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=655

 Score =   117 bits (293),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+L E+      VA+   EM M+V LHP T  TP++  E +SVAKAM LF
Sbjct  543  EWEVREKFTWVELTERDLNFEQVAISKHEMEMYVDLHPFTNKTPYTVVEDMSVAKAMVLF  602

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQV L  ML+ PK   +G +P+ GIL RQD R  NI  VFPHLA
Sbjct  603  RQVALRHMLIVPKYHGSGIYPITGILTRQDLRAHNIQNVFPHLA  646



>ref|XP_008441632.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=205

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+ GKI    V  +EM M+V LHPLT TT ++  ES+SVAKA+ LF
Sbjct  2    EWEVREKFTLVELAEREGKIEEFVVTKEEMEMYVDLHPLTNTTSYTVMESMSVAKALVLF  61

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVG+  +L+ PK +AA    V GIL  QD R  NIL   P L
Sbjct  62   RQVGIRHLLIVPKYEAARVLLVIGILTWQDLRSYNILSAIPDL  104



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  669  EWEVREKFPWDELAEREDNFDDVAITSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLF  728

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QA+G  PV GIL RQD R  NIL  FP L
Sbjct  729  RQVGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPLL  771



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+      VA+   EM M+V LHP T  TP++  E +S AKAM LF
Sbjct  692  EWEVREKFTWVELAERDLDFEQVAISKREMEMYVDLHPFTNKTPYTVVEDMSAAKAMVLF  751

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQV L  +L+ PK Q AG +PV GIL RQD R  NI  VFPH+A
Sbjct  752  RQVALRHLLIVPKYQGAGIYPVIGILTRQDLRAHNIQTVFPHIA  795



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  668  EWEVREKFPWDELAEREDNFDDVAIRSAEMEMYVDLHPLTNTTPYTVMENMSVAKALVLF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK QA+G  PV GIL RQD R  NIL  FP L
Sbjct  728  RQVGLRHLLIVPKIQASGMCPVVGILTRQDLRAYNILQAFPLL  770



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVRE F+ VDL +K  KI  V +  DEM M++ LHP   TTP++  E++SVAKA+ LF
Sbjct  677  EWEVRESFTSVDLTQKGPKIQEVVLTEDEMDMYIDLHPFANTTPYTVVETMSVAKAVVLF  736

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            RQV L  +L+ PK Q AG  P+ GIL RQD +  NILG FPHLA
Sbjct  737  RQVALRHLLIVPKYQGAGIPPIVGILTRQDLKAHNILGAFPHLA  780



>ref|NP_001031990.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 gb|AED94613.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=643

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  532  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  591

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  592  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  634



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTAVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTAVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LA +     +VA+ + EM MFV LHPLT TTP++  E++SVAKA+ LF
Sbjct  668  EWEVREKFPWDELAGREDNFDDVAITSSEMEMFVDLHPLTNTTPYTVMENMSVAKALVLF  727

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +G  PV GIL RQD R  NIL  FP L
Sbjct  728  RQVGLRHLLIVPKIQTSGLCPVVGILTRQDLRAHNILQAFPQL  770



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  662  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  721

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  722  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  764



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  659  DWEVREKFTPVELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  718

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  719  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  761



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  666  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  725

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  726  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  768



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM  +V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTAVELAEREDNFDDVAITSSEMQFYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF W +LAE+     +VA+ + EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  672  EWEVREKFPWDELAEREDNFDDVAITSSEMQMYVDLHPLTNTTPYTVMENMSVAKALVLF  731

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            RQVGL  +L+ PK Q +   PV GIL RQD R  NIL  FPHL
Sbjct  732  RQVGLRHLLIVPKIQMS---PVVGILTRQDLRAYNILQAFPHL  771



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  664  EWEVREKFTPVELAEREDNFDDVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  723

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  724  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  766



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   114 bits (284),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+      VA+ + EM ++V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDEVAITSSEMQLYVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  767



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   113 bits (283),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+ V+LAE+     +V + + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  659  DWEVREKFTPVELAEREDNFDDVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  718

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  719  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  761



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   113 bits (283),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVREKF+ V+LAE+     +V + + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  659  DWEVREKFTPVELAEREDNFDDVGITSSEMQMYVDLHPLTNTTPYTVVQSMSVAKALVLF  718

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FPHL
Sbjct  719  RSVGLRHLLIVPKIQASGMSPVIGILTRQDLRAYNILQAFPHL  761



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQ  289
            EVRE F+  DLAE+ GKI +V V +DEM MFV L+PL  TTP+S  ES+SVAKAM LFR+
Sbjct  673  EVREIFTSADLAERGGKIEDVIVSDDEMEMFVDLYPLINTTPYSVIESMSVAKAMVLFRE  732

Query  288  VGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            VGL  ML+ PK QA+G  PV GIL RQD    NIL  FP L
Sbjct  733  VGLRHMLILPKYQASGVAPVVGILTRQDLIAHNILCAFPQL  773



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   112 bits (281),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -3

Query  456  KFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLC  277
            KF+WV+LAE+ GKI  + V  +EM M+V LHPLT TTP++  ES+SVAKA+ LFRQVGL 
Sbjct  683  KFTWVELAEREGKIEELVVTKEEMEMYVDLHPLTNTTPYTVMESMSVAKALVLFRQVGLR  742

Query  276  PMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
             +L+ PK +AAG  PV GIL RQD R  NIL  FP LA
Sbjct  743  HLLIVPKYEAAGVPPVIGILTRQDLRPYNILSAFPDLA  780



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE+     +VA+ + EM M+V LHPLT TTP++  +S+SVAKA+ LF
Sbjct  665  EWEVREKFTPVELAEREDNFDDVAITSSEMQMWVDLHPLTNTTPYTVVQSMSVAKALVLF  724

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            R VGL  +L+ PK QA+G  PV GIL RQD R  NIL  FP L
Sbjct  725  RSVGLRHLLVVPKIQASGMSPVIGILTRQDLRAYNILQAFPRL  767



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI  + +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  409  EWEARERFSSVELADKNCKIDGLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  468

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  469  RSVALRHMLIMPKYQGPEISPLVGILTRQDLRAHNILGAFPHLA  512



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  678  EWEARERFSSVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  738  RSVALRHMLIMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLA  781



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  678  EWEARERFSSVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  738  RSVALRHMLIMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLA  781



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  678  EWEARERFSSVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  737

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  738  RSVALRHMLIMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLA  781



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  673  EWEARERFSSVELADKNCKIDDIELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  732

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  733  RSVALRHMLIMPKYQGPEISPIVGILTRQDLRAHNILGAFPHLA  776



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS  +LAEK G I +V +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  685  EWEARERFSSTELAEKAGSIDDVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLF  744

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R   L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  745  RTCALRHMLIIPKFQGLEISPIMGILTRQDLRAHNILGAFPHLA  788



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M+V LHP T TTP++  E++SVAKA+ LF
Sbjct  428  EWEARERFSSVELADKNCKIDDLELTPEELEMYVDLHPFTNTTPYTVVETMSVAKAVVLF  487

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHL+
Sbjct  488  RSVALRHMLIMPKYQGPEISPLVGILTRQDLRAHNILGAFPHLS  531



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE FS  +LA+K G +  + +  +EMGM+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  607  EWEAREMFSSAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLF  666

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD    NILG FPHLA
Sbjct  667  RSVALRHMLIMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLA  710



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+F+  +LA+K G +  +    +EM M+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  675  EWEARERFTSAELADKAGDVDGLDFSPEEMAMYVDLHPLTNTTPYTVVETMSVAKAVVLF  734

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  735  RSVALRHMLIMPKFQGPEISPIVGILTRQDLRAHNILGAFPHLA  778



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS V+LA+K  KI ++ +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  555  EWEARERFSSVELADKNCKIDDLELTPEELEMYIDLHPFTNTTPYTVVETMSVAKAVVLF  614

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  615  RSVALRHMLIMPKYQGPEISPLVGILTRQDLRAHNILGAFPHLA  658



>gb|ABA98017.1| Chloride channel protein CLC-a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95101.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE FS  +LA+K G +  + +  +EMGM+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  516  EWEAREMFSSAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLF  575

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD    NILG FPHLA
Sbjct  576  RSVALRHMLIMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLA  619



>gb|EEC69202.1| hypothetical protein OsI_38195 [Oryza sativa Indica Group]
Length=621

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE FS  +LA+K G +  + +  +EMGM+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  512  EWEAREMFSSAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLF  571

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD    NILG FPHLA
Sbjct  572  RSVALRHMLIMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLA  615



>ref|NP_001066692.1| Os12g0438600 [Oryza sativa Japonica Group]
 dbj|BAF29711.1| Os12g0438600, partial [Oryza sativa Japonica Group]
Length=707

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE FS  +LA+K G +  + +  +EMGM+V LHPLT TTP++  E++SVAKA+ LF
Sbjct  598  EWEAREMFSSAELADKCGGVDELEISPEEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLF  657

Query  294  RQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            R V L  ML+ PK Q     P+ GIL RQD    NILG FPHLA
Sbjct  658  RSVALRHMLIMPKFQGPEISPIVGILTRQDLIAHNILGAFPHLA  701



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAV--PNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EWE RE+FS  +LAEK G I  VAV    +E+ M++ LHP T TTP++  E++SVAKA+ 
Sbjct  690  EWEARERFSSTELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVV  749

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFR   L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  750  LFRTCALRHMLIIPKFQGPEIAPIVGILTRQDLRAHNILGAFPHLA  795



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAV--PNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EWE RE+FS  +LAEK G I  VAV    +E+ M++ LHP T TTP++  E++SVAKA+ 
Sbjct  690  EWEARERFSSTELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVV  749

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFR   L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  750  LFRTCALRHMLIIPKFQGPEIAPIVGILTRQDLRAHNILGAFPHLA  795



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVA-VPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            +WE RE+FS V+LA+K  K+ ++  +  +EM MFV LHP T TTP++  E++SVAKA+ L
Sbjct  680  DWEARERFSSVELADKSAKLEDLQEITPEEMEMFVDLHPFTNTTPYTVVETMSVAKAVVL  739

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            FR V L  ML+ PK Q     P+ GIL RQD R  NILG FPHLA
Sbjct  740  FRAVALRHMLIMPKFQGPEISPIVGILTRQDLRAHNILGAFPHLA  784



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WV+LAE+  KI  VAV  DEM M+V LHPLT TTPF+  ES+SVAKA+ LF
Sbjct  677  EWEVREKFNWVELAEREIKIEQVAVTRDEMEMYVDLHPLTNTTPFTVVESLSVAKALVLF  736

Query  294  RQVGLCPMLLGPKNQAAG  241
            RQVGL  +L+ PK Q AG
Sbjct  737  RQVGLRHLLIVPKYQGAG  754



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+WVDLAE+  KI  VAV  DEM M+  LHPLT TTP++  ES+SVAKAM LF
Sbjct  673  EWEVREKFNWVDLAERELKIEQVAVTRDEMEMYADLHPLTNTTPYTVVESMSVAKAMVLF  732

Query  294  RQVGLCPMLLGPKNQAAG  241
            RQVGL  +L+ PK Q AG
Sbjct  733  RQVGLRHLLIVPKYQGAG  750



>ref|XP_006848425.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
 gb|ERN10006.1| hypothetical protein AMTR_s00013p00233550 [Amborella trichopoda]
Length=634

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = -3

Query  465  VREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            V E+FS  DLA++  KI +V V  +E  M++ LHP T  TP++  ES+SVAKA+ LFRQV
Sbjct  524  VTERFSSWDLAKRGRKIEDVVVSEEEEEMYIDLHPFTNMTPYTVMESMSVAKAVVLFRQV  583

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  ML+ PK+Q AGG PV GIL RQD    NI   +PHL
Sbjct  584  GLRHMLVMPKSQVAGGSPVVGILTRQDLIANNIKSAYPHL  623



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWEVREKF+ V+LAE   KI  VAV  DEM M+V LHPLT  TP++  E +SVAKAM LF
Sbjct  678  EWEVREKFTSVELAEXEAKIEEVAVTRDEMEMYVDLHPLTNRTPYTVMEGMSVAKAMVLF  737

Query  294  RQVGLCPMLLGPKNQAAG  241
            RQVGL  +L+ PK +A+G
Sbjct  738  RQVGLRHLLIVPKYEASG  755



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            +WEVR+KF+WV+LAE+ G I  VAV ++EM MFV LHPLT TTPF+  ES+SVAKAM LF
Sbjct  679  DWEVRQKFTWVELAEREGSIEGVAVTSEEMEMFVDLHPLTNTTPFTVLESMSVAKAMILF  738

Query  294  R  292
            R
Sbjct  739  R  739



>ref|XP_003609433.1| hypothetical protein MTR_4g115640 [Medicago truncatula]
 gb|AES91630.1| ClC chloride channel family protein [Medicago truncatula]
Length=776

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 6/106 (6%)
 Frame = -3

Query  471  WEVREKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            ++V  KFS  D A+K+     KI ++ +  +EMGMFV LHP T  +P++  E++S+AKA+
Sbjct  651  YDVVRKFSSDDFAKKYSVERVKIEDIQLTEEEMGMFVDLHPFTNASPYTVVETMSLAKAL  710

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR+VGL  +L+ PK    G  PV GIL R D    +ILG+ P L
Sbjct  711  ILFREVGLRHLLVIPK--IPGRSPVVGILTRHDFTPEHILGMHPFL  754



>emb|CBI27719.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  K++ +D A+    K  K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA  
Sbjct  636  EILRKYAALDFAKAGSGKGVKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAI  695

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFRQVGL  M + PK+Q  G  P+ GIL R D    +ILG++PHL+
Sbjct  696  LFRQVGLRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHLS  739



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLF  295
            EWE RE+FS  +LAEK G I +V +  +E+ M++ LHP T TTP++  E++SVAKA+ LF
Sbjct  685  EWEARERFSSTELAEKAGSIDDVQLSPEELDMYIDLHPFTNTTPYTVVETMSVAKAVVLF  744

Query  294  RQVGLCPMLLGPKNQ  250
            R   L  ML+ PK Q
Sbjct  745  RTCALRHMLIIPKFQ  759



>ref|NP_001268085.1| uncharacterized protein LOC100259734 [Vitis vinifera]
 ref|XP_010653021.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653022.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653023.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653024.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653025.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653026.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 ref|XP_010653027.1| PREDICTED: uncharacterized protein LOC100259734 isoform X1 [Vitis 
vinifera]
 gb|ADK66981.1| chloride channel ClC3 [Vitis vinifera]
Length=780

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  K++ +D A+    K  K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA  
Sbjct  674  EILRKYAALDFAKAGSGKGVKLEDLNIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAI  733

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFRQVGL  M + PK+Q  G  P+ GIL R D    +ILG++PHL+
Sbjct  734  LFRQVGLRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHLS  777



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++ +KFS  D A+    K  K+ +V +  +EM M++ LHP+T  +P++  E++S+AKA  
Sbjct  677  DILKKFSPFDFAKPGTGKGLKLEDVTITEEEMEMYIDLHPITNASPYTVLETMSLAKAKV  736

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + PK+Q  G  P+ G+L R D    +ILG++PH+
Sbjct  737  LFRQIGLRHMCVVPKSQ--GRSPIVGLLTRHDFMPEHILGLYPHM  779



>ref|XP_004508447.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cicer arietinum]
Length=777

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 6/106 (6%)
 Frame = -3

Query  471  WEVREKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            ++V  +FS  D A+K      KI ++ + ++EMGMF+ LHP T  +P++  E++S+AKA+
Sbjct  652  YDVLREFSADDFAKKGSGERIKIEDIQLTDEEMGMFIDLHPFTNASPYTVVETMSLAKAL  711

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR+VGL  +L+ PK    G +PV GIL R D    +ILG+ P L
Sbjct  712  ILFREVGLRHLLVIPK--IPGRWPVVGILTRHDFMPEHILGMHPFL  755



>gb|KJB40519.1| hypothetical protein B456_007G067500 [Gossypium raimondii]
Length=767

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EV  + S  D A+    K  K+ ++ + ++EM M+V LHP+T T+P++  E++S+AKA  
Sbjct  661  EVVHRISKFDFAKAGSGKGVKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAV  720

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + PK+Q  G  P+ GIL R D    +ILG++PH+
Sbjct  721  LFRQLGLRHMCVVPKSQ--GRPPIVGILTRHDFLPEHILGLYPHI  763



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = -3

Query  474  EWEVREKFSWVDLAEKWGKI*NVAV--PNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EWE RE+FS  +LAEK G I  VAV    +E+ M++ LHP T TTP++  E++SVAKA+ 
Sbjct  690  EWEARERFSSTELAEKSGSIDEVAVQLTPEELDMYIDLHPFTNTTPYTVVETMSVAKAVV  749

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPR  199
            LFR   L  ML+ PK Q     P     + QDPR
Sbjct  750  LFRTCALRHMLIIPKFQG----PEVRATSCQDPR  779



>gb|KHG07842.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=700

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EV  + S  D A+    K  K+ ++ + ++EM M+V LHP+T T+P++  E++S+AKA  
Sbjct  594  EVVRRISKFDFAKAGSGKGVKLEDLDIKDEEMDMYVDLHPITNTSPYTVVETMSLAKAAV  653

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + PK+Q  G  P+ GIL R D    +ILG++PH+
Sbjct  654  LFRQLGLRHMCVVPKSQ--GRPPIVGILTRHDFLPEHILGLYPHI  696



>gb|AFB33948.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33949.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33950.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33951.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33952.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33953.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
 gb|AFB33954.1| hypothetical protein CL1659Contig1_02, partial [Abies alba]
Length=91

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQVGL  + + PK  ++   P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQVGLRHLCVVPK--SSDRSPIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D     +LG+ PHL
Sbjct  59   RHDFMPEYVLGLHPHL  74



>ref|XP_007048601.1| Chloride channel C [Theobroma cacao]
 gb|EOX92758.1| Chloride channel C [Theobroma cacao]
Length=771

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  +F+  D A+    K  K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA  
Sbjct  665  EILHRFAAFDFAKAGSGKGIKVEDLDIEQEEMDMYVDLHPITNASPYTVVETMSLAKAAV  724

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + PK+Q  G  P+ GIL R D    ++LG++PH+
Sbjct  725  LFRQLGLRHMCVVPKSQ--GRPPIVGILTRHDFMPEHVLGLYPHI  767



>ref|XP_010057598.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Eucalyptus grandis]
 gb|KCW74787.1| hypothetical protein EUGRSUZ_E03522 [Eucalyptus grandis]
Length=771

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V E+FS VD A+K      KI +V V N+E  MF+ LHP T T+P++  E++S+AKA+ 
Sbjct  650  DVSEQFSVVDFAKKGSGNADKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALI  709

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            L RQVGL  +L+ PK    G  PV GIL R D    +IL   P L
Sbjct  710  LLRQVGLRHLLVIPK--IYGRSPVVGILTRHDFMPEDILSSHPAL  752



>ref|XP_010057599.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Eucalyptus grandis]
Length=700

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V E+FS VD A+K      KI +V V N+E  MF+ LHP T T+P++  E++S+AKA+ 
Sbjct  579  DVSEQFSVVDFAKKGSGNADKIEDVDVTNEEENMFLDLHPFTNTSPYTVVETMSLAKALI  638

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            L RQVGL  +L+ PK    G  PV GIL R D    +IL   P L
Sbjct  639  LLRQVGLRHLLVIPK--IYGRSPVVGILTRHDFMPEDILSSHPAL  681



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+ +K++  D A+    K  K+ ++ + ++EM +++ LHP+T  +P++  E++S+AKA  
Sbjct  675  EILQKYAAFDFAKPGSGKGIKLEDLDIDDEEMDLYIDLHPVTNASPYTVVETMSLAKAAI  734

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + PK+Q  G  P+ GIL R D    +ILG++PH+
Sbjct  735  LFRQLGLRHMCVVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHI  777



>ref|XP_010099521.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB79401.1| Chloride channel protein CLC-c [Morus notabilis]
Length=176

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = -3

Query  396  NDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGIL  217
             +EM M+V LHP+T T+P++  E++S+AKA  LFR +GL  M + PK+Q  G  P+ GIL
Sbjct  98   EEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRLLGLRHMCVVPKSQ--GRHPIVGIL  155

Query  216  ARQDPRGPNILGVFPHL  166
             R D    ++LG++PHL
Sbjct  156  TRHDFMPEHVLGLYPHL  172



>ref|XP_011084086.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Sesamum indicum]
Length=651

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -3

Query  456  KFSWVDLAEKWG-----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            +FS  D A KWG      I ++ +  +EM M+V LHP T T+P++  E++S+AKA+ LFR
Sbjct  522  RFSDDDFA-KWGFGHDDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFR  580

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GIL R D    +IL + P LA
Sbjct  581  EVGLRHLLVIPK--FSGRIPVVGILTRHDFMPEDILNLHPRLA  621



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 65/103 (63%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEK----WGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            E+FS  D A+K      ++ ++ + ++EM MF+ LHP   T+PF+  E++S+AKA+ LFR
Sbjct  670  EQFSADDFAKKGLEHVDRVEDIQLKDEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFR  729

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  730  EVGLRHLLVIPK--VSGRIPVVGIITRHDFMPEHVLSLHPSLA  770



>ref|XP_006852872.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
 gb|ERN14339.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
Length=785

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = -3

Query  459  EKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            + FS+ D A+    K  +I ++ + ++EM MFV LHP   T+P++  E++S+AKA+ LFR
Sbjct  662  KHFSFDDFAKRGSGKGDQIEDIELSDEEMEMFVDLHPFANTSPYTVVETMSLAKALILFR  721

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            QVGL  +L+ PK    G  PV GIL R D    ++LG+ P+L
Sbjct  722  QVGLRHLLVVPKTH--GRAPVVGILTRHDFMPEHVLGLHPYL  761



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  +F   D A+    K  K  ++ +  DEM MFV LHP+T T+P++  E++S+AKA  
Sbjct  674  EILRRFGAFDFAKAGSGKGLKFEDLNILEDEMDMFVDLHPITNTSPYTVVETMSLAKAAV  733

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK    G  P+ GIL R D    +ILG+FPH+
Sbjct  734  LFRELGLRHLCVVPK--TPGRPPIVGILTRHDFTSEHILGLFPHI  776



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -3

Query  456  KFSWVDLAEKWG-----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            +FS  D A KWG      I ++ +  +EM M+V LHP T T+P++  E++S+AKA+ LFR
Sbjct  658  RFSDDDFA-KWGFGHDDNIEDIELSEEEMDMYVDLHPFTNTSPYTVVETMSLAKALKLFR  716

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GIL R D    +IL + P LA
Sbjct  717  EVGLRHLLVIPK--FSGRIPVVGILTRHDFMPEDILNLHPRLA  757



>ref|XP_010241600.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nelumbo nucifera]
Length=765

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V ++FS  D A+    K+  I N+ V  +EM MF+ LHP T  +P++  E++S+AKA+ 
Sbjct  655  DVTKQFSANDFAKRGSTKYETIDNIEVTEEEMDMFIDLHPFTNASPYTVLETMSLAKALI  714

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR+VGL  +L+ PK       PV GIL R D    ++LG+ P L
Sbjct  715  LFRKVGLRHLLVVPKTSTRS--PVVGILTRHDFMPEHVLGLHPFL  757



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E   +F   D A+    K  +I +V + + EM M+V LHP+T ++P++  E++S+AKA  
Sbjct  666  EFGRRFGASDFAKAGLGKGLRIEDVELSDKEMEMYVDLHPITNSSPYTVVETMSLAKAAM  725

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  + + PK    GG P+ GIL R D    +I+G++PHL
Sbjct  726  LFRQLGLRHLCVMPKT--PGGAPIVGILTRHDFMPEHIIGLYPHL  768



>ref|XP_008368156.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=778

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  474  EWEVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKA  307
            E E+  +F+  + A+    K  K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA
Sbjct  669  EEEILGRFAAFNFAKAGSGKGIKVEDLDIEEEEMDMYVDLHPITNASPYTVVETMSLAKA  728

Query  306  MGLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
              LFRQ+GL  + L PK+Q  G  P+ GIL R D    +ILG++PH+
Sbjct  729  AILFRQLGLRHLCLVPKSQ--GRPPIVGILTRHDFMPEHILGLYPHI  773



>ref|XP_003580671.2| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Brachypodium distachyon]
Length=826

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +  + FS  D A+    K  +I ++ +  DEM MFV LHP T T+P++  E++S+AKA+ 
Sbjct  705  DASKHFSPDDFAKRGSGKHDRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALI  764

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR+VGL  +L+ PK+      PV GIL R D    ++LG+ P+L
Sbjct  765  LFREVGLRHLLVLPKSSKRA--PVVGILTRHDFMPEHVLGLHPYL  807



>ref|XP_004486231.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=766

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            ++ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  LFR+VGL  +L+ PK    G
Sbjct  681  RVDDLDISKEEMEMFVDLHPITNTSPYTVVETMSLAKAALLFREVGLRHLLVVPK--TPG  738

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D     ILG+FPHL
Sbjct  739  RPPIVGILTRHDFMPEYILGLFPHL  763



>gb|AEW08796.1| hypothetical protein CL1659Contig1_02, partial [Pinus lambertiana]
 gb|AFB33955.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
Length=91

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQ+GL  + + PK+      P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPKSSERS--PIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D    ++LG+ P+L
Sbjct  59   RHDFMPEHVLGLHPYL  74



>ref|XP_010240516.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Brachypodium distachyon]
Length=662

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +  + FS  D A+    K  +I ++ +  DEM MFV LHP T T+P++  E++S+AKA+ 
Sbjct  541  DASKHFSPDDFAKRGSGKHDRIEDIELTADEMEMFVDLHPFTNTSPYTVVETMSLAKALI  600

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR+VGL  +L+ PK+      PV GIL R D    ++LG+ P+L
Sbjct  601  LFREVGLRHLLVLPKSSKRA--PVVGILTRHDFMPEHVLGLHPYL  643



>ref|XP_008361634.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c-like 
[Malus domestica]
Length=778

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA  LFRQ+GL  + L PK+Q  G
Sbjct  691  KVEDLDIEEEEMDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--G  748

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +ILG++PH+
Sbjct  749  RPPIVGILTRHDFMPEHILGLYPHI  773



>emb|CDP10469.1| unnamed protein product [Coffea canephora]
Length=784

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            ++F   D A+K      +I ++ + ++EM MFV LHP   T+P+S  E++S+AKA+ LFR
Sbjct  666  KRFMADDFAKKGLGNGDRIEDIDLSDEEMNMFVDLHPFVNTSPYSVVETMSLAKALILFR  725

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFP  172
            +VGL  ML+ PK    GG PV GIL R D    ++L V P
Sbjct  726  EVGLRHMLVVPK--IPGGVPVVGILTRHDFMPEHVLNVHP  763



>gb|AFB33961.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
 gb|AFB33962.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
 gb|AFB33963.1| hypothetical protein CL1659Contig1_02, partial [Pinus mugo]
Length=91

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQ+GL  + + PK  ++   P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D    ++LG+ P+L
Sbjct  59   RHDFMPEHVLGLHPYL  74



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  ES+S+AKA  LFRQ+GL  + + PK   AG
Sbjct  689  KIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TAG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  ES+S+AKA  LFRQ+GL  + + PK   AG
Sbjct  689  KIEDLDISEEEMEMYVDLHPITNTSPYTVLESLSLAKAAILFRQLGLRHLCVIPK--TAG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (63%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            +R+ F   D A+    K  K+ ++ +  +EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  663  IRKSFRAHDFAKAGSGKGVKLEDLDITEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVL  722

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR++GL  + + PK    G  PV GIL R D    +ILG++PH+
Sbjct  723  FRELGLRHLCVVPKT--PGRPPVAGILTRHDFMPEHILGLYPHI  764



>ref|XP_009392132.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=806

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  +I ++ V  +EM M++ LHP T T+P++  E++S+AKA+ LFRQVGL  +L+ PK+ 
Sbjct  693  KHDRIEDIEVTAEEMEMYIDLHPFTNTSPYTVVETMSLAKALTLFRQVGLRHLLIVPKSS  752

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
                 PV GIL R D    +ILG+ P L
Sbjct  753  CRA--PVVGILTRHDFMPEHILGLHPFL  778



>gb|AFB33956.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33957.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33958.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33959.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
 gb|AFB33960.1| hypothetical protein CL1659Contig1_02, partial [Pinus cembra]
Length=91

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQ+GL  + + PK+      P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPKSLERS--PIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D    ++LG+ P+L
Sbjct  59   RHDFMPEHVLGLHPYL  74



>ref|XP_004288642.1| PREDICTED: chloride channel protein CLC-c [Fragaria vesca subsp. 
vesca]
Length=782

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  +F   D A+    K  K+ ++ +  +EM M+V LHP+T  +P++  E++S+AKA  
Sbjct  675  EILRRFGPFDFAKAGSGKGLKVEDLDIEEEEMEMYVDLHPITNASPYTVVETMSLAKAAI  734

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  + L PK+Q  G  P+ GIL R D    +ILG++P++
Sbjct  735  LFRQLGLRHLCLVPKSQ--GRSPIVGILTRHDFMPEHILGLYPNI  777



>ref|XP_006359489.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Solanum tuberosum]
Length=767

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -3

Query  456  KFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQ  289
            +FS  D A+K      ++ ++ + ++EM MF+ LHP   T+PF+  E++S+AKA+ LFR+
Sbjct  650  QFSADDFAKKGLDHGDRVEDIQLADEEMDMFIDLHPFCNTSPFTVVETMSLAKALMLFRE  709

Query  288  VGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  710  VGLRHLLVIPK--VSGRIPVVGIITRHDFMPEHVLSLHPSLA  749



>ref|XP_009418228.1| PREDICTED: putative chloride channel-like protein CLC-g [Musa 
acuminata subsp. malaccensis]
Length=801

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  ++ +V V  +EM MFV LHP T ++P++  E++S+AKA+ LFR++GL  +L+ PK+ 
Sbjct  688  KHDRVEDVEVSAEEMEMFVDLHPFTNSSPYTVVETMSLAKALILFREMGLRHLLIVPKSS  747

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
            +    PV GIL R D    +ILG+ P L
Sbjct  748  SRA--PVVGILTRHDFMAEHILGLHPFL  773



>ref|XP_010682061.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=781

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++++ F  +D A+    K  KI ++ + ++EM M+V LHP+T T+P++  E++S+AK   
Sbjct  675  DIKKSFKAIDFAKPGSGKGIKIEDLIIKDEEMNMYVDLHPITNTSPYTVVETMSLAKVAV  734

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR +GL  + + PK    G  P+ G+L R D    ++LG++PHL
Sbjct  735  LFRDLGLRHLCVVPK--TPGRPPIVGVLTRHDFTPEHVLGLYPHL  777



>ref|XP_008786445.1| PREDICTED: chloride channel protein CLC-c-like [Phoenix dactylifera]
Length=778

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+ ++F   D A+    K  K  ++ +  +EM M+V LHP+T T+P++  E++S+AKA  
Sbjct  672  ELLQRFGAFDFAKPGSGKGLKFEDLDIQEEEMDMYVDLHPITNTSPYTVVETMSLAKAAV  731

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  + + PK    G  P+ GIL R D    +ILG+FPH 
Sbjct  732  LFRQLGLRHLCVVPK--TPGRPPIVGILTRHDFVPEHILGLFPHF  774



>ref|XP_009586705.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana tomentosiformis]
Length=732

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
              FS  D A+K      ++ N+ + ++EM MF+ LHP   T+P++  E++S+AKA+ LFR
Sbjct  614  NHFSADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFR  673

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  674  EVGLRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLA  714



>ref|XP_009777969.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Nicotiana sylvestris]
Length=776

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
              FS  D A+K      ++ N+ + ++EM MF+ LHP   T+P++  E++S+AKA+ LFR
Sbjct  658  NHFSADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFR  717

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  718  EVGLRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLA  758



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
              FS  D A+K      ++ N+ + ++EM MF+ LHP   T+P++  E++S+AKA+ LFR
Sbjct  670  NHFSADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFR  729

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  730  EVGLRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLA  770



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
              FS  D A+K      ++ N+ + ++EM MF+ LHP   T+P++  E++S+AKA+ LFR
Sbjct  670  NHFSADDFAKKGLDHGDRVENIQLTDEEMDMFIDLHPFCNTSPYTVVETMSLAKALVLFR  729

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   +G  PV GI+ R D    ++L + P LA
Sbjct  730  EVGLRHLLVIPK--VSGRVPVVGIITRHDFMPEHVLSLHPSLA  770



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KIDDLVISDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EV   F   D A+    K  K+ ++ V  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  676  EVLRTFHAYDFAKAGSGKGLKVEDLDVKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAL  735

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK   +G  P+ GIL R D    ++LG++P L
Sbjct  736  LFRELGLRHLCVVPK--TSGRSPIVGILTRHDFMPEHVLGLYPQL  778



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KIDDLVISDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V  K S +D A+    K  K+ ++ +  +E  M+V LHP+  T+P++  E++S+AKA  
Sbjct  655  KVLRKISELDFAKAGSGKGLKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAV  714

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  M + PK+Q  G  P+ GIL R D +  +ILG++PH+
Sbjct  715  LFRELGLRHMCVVPKSQ--GRPPIVGILTRHDFQPEHILGLYPHI  757



>ref|XP_009411882.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V  +F   D A+    K  K+  + + + EM M+V LHP+   +P++  E++S+AKA  
Sbjct  673  DVLRRFDPFDFAKAGSGKGVKLEELDIDDAEMEMYVDLHPIVNRSPYTVKETMSLAKAAV  732

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK  + GG PV GIL R D    +ILG FPHL
Sbjct  733  LFRELGLRHLCVVPK--SPGGSPVAGILTRHDFMPEHILGRFPHL  775



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V  +F   D A+    K  KI ++    +EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  694  VLRRFGAFDFAKPGSGKGMKIEDLDFTEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVL  753

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  +L+ PK    G FP+ GIL R D    +I G+FP+L
Sbjct  754  FRALGLRHLLVVPKTP--GRFPIVGILTRHDLMPEHIHGLFPNL  795



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V  +F   D A+    K  KI ++    +EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  663  VLRRFGAFDFAKPGSGKGMKIEDLDFTEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVL  722

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  +L+ PK    G FP+ GIL R D    +I G+FP+L
Sbjct  723  FRALGLRHLLVVPKTP--GRFPIVGILTRHDLMPEHIHGLFPNL  764



>gb|KHG08138.1| Chloride channel CLC-c -like protein [Gossypium arboreum]
Length=708

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V  K S +D A+    K  K+ ++ +  +E  M+V LHP+  T+P++  E++S+AKA  
Sbjct  602  KVLRKISELDFAKAGSGKGLKLEDLDIQEEEWDMYVDLHPIANTSPYTVVETMSLAKAAV  661

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  M + PK+Q  G  P+ GIL R D +  +ILG++PH+
Sbjct  662  LFRELGLRHMCVVPKSQ--GRPPIVGILTRHDFQPEHILGLYPHV  704



>ref|XP_010928311.1| PREDICTED: putative chloride channel-like protein CLC-g [Elaeis 
guineensis]
Length=790

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  +I ++ +  +EM MF+ LHP T T+P++  E++S+AKA+ LFR+VGL  +L+ PK+ 
Sbjct  677  KHDRIEDIELTAEEMEMFLDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPKSS  736

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
                 PV GIL R D    +ILG+ P+L
Sbjct  737  PRA--PVVGILTRHDFMPEHILGLHPYL  762



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+ ++F   D A+    K  K  ++ +  +EM M++ LHP+T T+P++  E++S+AKA  
Sbjct  672  ELLQRFGAFDFAKPGSGKGMKFEDLDIQEEEMDMYLDLHPITNTSPYTVVETMSLAKAAV  731

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  + + PK    G  P+ GIL R D    +ILG+FPH 
Sbjct  732  LFRQLGLRHLCVVPK--TPGRPPIVGILTRHDFVPEHILGLFPHF  774



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
             +FS VD A++      KI ++ +  +EM M+V LHP    +P++  E++S+AKA+ LFR
Sbjct  676  SQFSAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFR  735

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK   + G PV GIL R D    +IL + P LA
Sbjct  736  EVGLRHLLVIPK--ISNGSPVMGILTRHDFMPEHILALNPLLA  776



>gb|EMT23162.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=1241

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  459  EKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            + FS  D A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR
Sbjct  697  KHFSPEDFAKRGSGKHDRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFR  756

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            +VGL  +L+ PK       PV GIL R D    ++LG+ P+L
Sbjct  757  EVGLRHLLVLPKTSKRA--PVVGILTRHDFMPEHVLGLHPYL  796



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWG-----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            +V  +FS  D A+K       KI ++ +  +EM MF+ LHP T  +P++  E++S+ KA+
Sbjct  652  DVINEFSADDFAKKGSSKGRLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKAL  711

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR++GL  +L+ PK   +G  PV GIL R D    +ILG+ P L
Sbjct  712  TLFRELGLRHLLVVPK--FSGRSPVVGILTRHDFMSEHILGLHPFL  755



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWG-----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            +V  +FS  D A+K       KI ++ +  +EM MF+ LHP T  +P++  E++S+ KA+
Sbjct  652  DVINEFSADDFAKKGSSKGRLKIEDIQLSEEEMDMFIDLHPFTNASPYTVVETMSLGKAL  711

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR++GL  +L+ PK   +G  PV GIL R D    +ILG+ P L
Sbjct  712  TLFRELGLRHLLVVPK--FSGRSPVVGILTRHDFMSEHILGLHPFL  755



>gb|EEC78120.1| hypothetical protein OsI_17660 [Oryza sativa Indica Group]
Length=295

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  +I  +    +E+ MFV LHP T T+P++  E++S+AKA  LFR+VGL  +L+ PK+ 
Sbjct  187  KHDRIEEIQFSAEELEMFVDLHPFTNTSPYTVVETMSLAKAHVLFREVGLRHLLVLPKSS  246

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
                 PV GIL R D    +ILG+ P L
Sbjct  247  KRA--PVVGILTRHDFMPEHILGLHPFL  272



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KIEDLVISGEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +  ++FS  D A+    K   I ++ +  +EM M++ LHP T T+P++  E++S+AKA+ 
Sbjct  653  DASKQFSADDFAKRGSGKRDSIDDIELTTEEMEMYIDLHPFTNTSPYTVVETMSLAKALI  712

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR+VGL  +L+ PK+ +    PV GIL R D    +ILG+ P L
Sbjct  713  LFREVGLRHLLVVPKSSSRA--PVVGILTRHDFMPEHILGLHPCL  755



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KIEDLVISGEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  690  KIEDLDLSDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  747

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  748  RPPIVGILTRHDFMPEHVLGLYPHI  772



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  693  KIEDLDLSDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  750

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  751  RPPIVGILTRHDFMPEHVLGLYPHI  775



>ref|XP_008788814.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=790

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  ++ ++ +  +EM MF+ LHP T T+P++  E++S+AKA+ LFR+VGL  +L+ PK+ 
Sbjct  677  KHDRVEDIELTAEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREVGLRHLLVVPKSS  736

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
                 PV GIL R D    +ILG+ P+L
Sbjct  737  PRA--PVVGILTRHDFMPEHILGLHPYL  762



>ref|XP_009401373.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=786

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V ++FS  D A+    K   I  + +  +EM M+V LHP T T+P++  E++S+AKA+ 
Sbjct  661  DVSKQFSAEDFAKRGSGKHENIEGIDLTAEEMDMYVDLHPYTNTSPYTVVETMSLAKALI  720

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR+VGL  +L+ PK+ +    PV GIL R D    +ILG  P L
Sbjct  721  LFREVGLRHLLVIPKSSSRA--PVVGILTRHDFMPEHILGTHPFL  763



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  692  KIEDLDLSDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  749

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  750  RPPIVGILTRHDFMPEHVLGLYPHI  774



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  691  KIEDLDLSDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  748

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  749  RPPIVGILTRHDFMPEHVLGLYPHI  773



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ +++  ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK +  G
Sbjct  695  KLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTTG  753

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +I G++PHL
Sbjct  754  RDPIVGILTRHDFMPEHIKGLYPHL  778



>gb|AFG64985.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64986.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64987.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64988.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64989.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64990.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64991.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64992.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64993.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64994.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
 gb|AFG64995.1| hypothetical protein CL1659Contig1_02, partial [Pinus taeda]
Length=91

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQ+GL  + + PK  ++   P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D    ++LG+  +L
Sbjct  59   RHDFMPEHVLGLHSYL  74



>gb|AEW08797.1| hypothetical protein CL1659Contig1_02, partial [Pinus radiata]
Length=91

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +EM M+V LHP T T+P++  E++S+AKA+ LFRQ+GL  + + PK  ++   P+ GIL 
Sbjct  1    EEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFRQLGLRHLCVVPK--SSDRSPIVGILT  58

Query  213  RQDPRGPNILGVFPHL  166
            R D    ++LG+  +L
Sbjct  59   RHDFMPEHVLGLHSYL  74



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +  ++FS  D A++       I N+ V  +EM MF+ LHP T  +P++  E++S+AK++ 
Sbjct  655  DFMKQFSANDFAKRGSGNNEDIYNIEVTEEEMDMFIDLHPFTNASPYTVVETMSLAKSLI  714

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR VGL  +L+ PK       PV GIL R D    +ILG++P L
Sbjct  715  LFRGVGLRHLLVVPKTSNWS--PVVGILTRHDFMPEHILGLYPXL  757



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  D AE+      KI  +    +EM MF+ LHP T  +P+S  E++S+AKA+ LFR+V
Sbjct  659  FSAGDFAERRSGNGDKIEELRFTEEEMEMFLDLHPFTNASPYSVVETMSLAKALILFREV  718

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK   +G  PV GIL R D    +ILG+ P L
Sbjct  719  GLRHLLVTPK--ISGRSPVVGILTRHDFMPEHILGLHPLL  756



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ +++  ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK +  G
Sbjct  693  KLEDLSFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPK-KTTG  751

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +I G++PHL
Sbjct  752  RDPIVGILTRHDFMPEHIKGLYPHL  776



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ + ++EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  692  KIEDLDLSDEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  749

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  750  RPPIVGILTRHDFMPEHVLGLYPHI  774



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS VD A+    K  KI ++ +  +EM MF+ LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  662  FSSVDFAKRGSGKGDKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREV  721

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK   +   PV GIL R D    +IL + P L
Sbjct  722  GLRHLLVIPK--LSNRTPVVGILTRHDFMPEHILSLHPML  759



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            EV ++F   D A+    K  K+ ++ +  DEM ++V LHP+T  +P++  E++S+AKA  
Sbjct  667  EVLQRFDAFDFAKAGSGKGVKLEDLHIEEDEMELYVDLHPITNASPYTVVETMSLAKAAL  726

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK    G  P+ GIL R D    +ILG++P+L
Sbjct  727  LFRELGLRHLCVVPK--TPGRPPIVGILTRHDFTPEHILGIYPNL  769



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            ++FS  D A++      KI +V +  +EM MF+ LHP T  +P++  E++S+AKA  LFR
Sbjct  657  KQFSPGDFAKRGSGNGDKIEDVEITEEEMEMFLDLHPFTNASPYTVVETMSLAKACVLFR  716

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            +VGL  +L+ PK  +    PV GIL R D    +ILG+ P LA
Sbjct  717  EVGLRHLLVIPKISSRS--PVVGILTRHDFMPEHILGLHPFLA  757



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = -3

Query  471  WEVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            ++  + FS  D A+    K   I ++ +  +EM M++ LHP T T+P++  E++S+AKA+
Sbjct  653  FDASKPFSADDFAKRGSGKHDSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKAL  712

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR+VGL  +L+ PK+ +    PV GIL R D    +ILG+ P L
Sbjct  713  ILFREVGLRHLLVVPKSSSRA--PVVGILTRHDFMPEHILGLHPFL  756



>ref|XP_009403721.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403722.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403723.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+ ++F   D A+    K  K+ ++ +  +EM MF+ LHP+T  +P++  E++S+AKA  
Sbjct  672  EMLQRFGAFDFAKAGSGKGLKLEDLNILEEEMDMFIDLHPVTNKSPYTVVETMSLAKAAI  731

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPH  169
            LFR++GL  + + PK    G  P+ GIL R D    +ILG+FPH
Sbjct  732  LFRELGLRHLCVVPKT--PGTPPIVGILTRHDFMPEHILGLFPH  773



>ref|XP_007155066.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
 gb|ESW27060.1| hypothetical protein PHAVU_003G170300g [Phaseolus vulgaris]
Length=800

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = -3

Query  465  VREKFSWVDLAEKWG-----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            V  KFS  D A+K       KI ++ +  +EM MF+ LHP T  +P++  E++S+ KA+ 
Sbjct  688  VLNKFSADDFAKKGSSKVRLKIEDIQLLEEEMDMFIDLHPFTNASPYTVVETMSLGKALT  747

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFR++GL  +L+ PK  +    PV GIL R D    +ILG+ P LA
Sbjct  748  LFRELGLRHLLVIPKISSRS--PVVGILTRHDFMPEHILGLHPLLA  791



>ref|XP_004287269.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Fragaria vesca subsp. vesca]
Length=780

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            E+FS  D A++      KI ++ +  +EM M++ LHP T  +P++  E++S+AKA+ LFR
Sbjct  662  EQFSSEDFAKRGLGNGDKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFR  721

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            QVGL  +L+ PK  +    P+ GIL R D    +I G+ P L
Sbjct  722  QVGLRHLLVIPKMSSMS--PIVGILTRHDFMPEHIFGIHPML  761



>ref|XP_004287270.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Fragaria vesca subsp. vesca]
Length=752

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = -3

Query  459  EKFSWVDLAEKW----GKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            E+FS  D A++      KI ++ +  +EM M++ LHP T  +P++  E++S+AKA+ LFR
Sbjct  634  EQFSSEDFAKRGLGNGDKIEDIELTEEEMEMYIDLHPFTNASPYTVVETMSLAKALILFR  693

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            QVGL  +L+ PK  +    P+ GIL R D    +I G+ P L
Sbjct  694  QVGLRHLLVIPKMSSMS--PIVGILTRHDFMPEHIFGIHPML  733



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  693  KIEDLDLSEEEMEMYVDLHPITNTSPYTVLETLSLAKAAILFRQLGLRHLCVVPK--TPG  750

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  751  RPPIVGILTRHDFMPEHVLGLYPHI  775



>ref|XP_010905340.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Elaeis guineensis]
Length=645

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = -3

Query  471  WEVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAM  304
            ++  + FS  D A+    K   I ++ +  +EM M++ LHP T T+P++  E++S+AKA+
Sbjct  519  FDASKPFSADDFAKRGSGKHDSIDDIELTVEEMEMYIDLHPFTNTSPYTVVETMSLAKAL  578

Query  303  GLFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
             LFR+VGL  +L+ PK+ +    PV GIL R D    +ILG+ P L
Sbjct  579  ILFREVGLRHLLVVPKSSSRA--PVVGILTRHDFMPEHILGLHPFL  622



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS VD A+    K  KI ++ +  +EM MF+ LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  662  FSSVDFAKRGSGKGDKIEDIELTEEEMEMFIDLHPFTNTSPYTVVETMSLAKALILFREV  721

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK   +   PV GIL R D    +IL + P L
Sbjct  722  GLRHLLVIPK--LSXRTPVVGILTRHDFMPEHILSLHPML  759



>gb|ACF78606.1| unknown [Zea mays]
Length=496

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  + A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  380  FSHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREV  439

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK+      PV GIL R D    +ILG+ P L
Sbjct  440  GLRHLLVLPKSSKRA--PVVGILTRHDFMPEHILGLHPFL  477



>ref|NP_001170245.1| uncharacterized protein LOC100384199 [Zea mays]
 gb|ACN36355.1| unknown [Zea mays]
Length=455

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V E+F   D A+    K  KI ++   ++EM ++V LHP+T T+P++  E++S+AKA  L
Sbjct  350  VLERFGAFDFAKPGSGKGLKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVL  409

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  ML+ PK    G  P+ GIL R D    +I G+FP++
Sbjct  410  FRALGLRHMLVVPKTP--GRPPIVGILTRHDFIPEHIHGLFPNI  451



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = -3

Query  411  NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFP  232
            +V +  +EM M+V LHP T T+P++  E++S+AKA+ LFR+VGL  +L+ PK  A    P
Sbjct  697  DVEISAEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--ACDRSP  754

Query  231  VGGILARQDPRGPNILGVFPHL  166
            V GIL R D    +ILG+ P L
Sbjct  755  VVGILTRHDFMPEHILGLHPVL  776



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  682  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  741

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  742  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  784



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  682  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  741

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  742  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  784



>ref|NP_001169702.1| uncharacterized protein LOC100383583 [Zea mays]
 gb|ACN34587.1| unknown [Zea mays]
Length=341

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V E+F   D  +    K   I +V +  +EM M+V LHP T T+P++  E++S+AKA+ L
Sbjct  210  VAERFQAEDFDKRGSGKQDTIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVL  269

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR+VGL  +L+ PK  A    PV GIL R D    +IL + P L
Sbjct  270  FREVGLRHLLVVPK--ACDRSPVVGILTRHDFMPEHILELHPVL  311



>ref|XP_010999722.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_010999723.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=784

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+  +F+  D ++    K  K+ ++A+  +EM M+V LHP++  +P +  E++S+AKA  
Sbjct  678  EILHRFAVFDFSKAGSGKGVKLEDLAIEEEEMDMYVDLHPISNASPHTVVETMSLAKAAI  737

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+GL  M + P +Q  G  P+ GIL R D    +ILG++P +
Sbjct  738  LFRQIGLRHMCVVPTSQ--GRPPIVGILTRHDFMPEHILGLYPRI  780



>ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
isoform X2 [Citrus sinensis]
 gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
 gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina]
Length=794

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  456  KFSWVDLAEKWG----KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQ  289
            +FS VD A++      KI ++ +  +EM M+V LHP    +P++  E++S+AKA+ LFR+
Sbjct  677  QFSAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFRE  736

Query  288  VGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            VGL  +L+ PK   + G PV GIL R D    +IL + P LA
Sbjct  737  VGLRHLLVIPK--ISNGSPVVGILTRHDFMPEHILALNPLLA  776



>ref|XP_006385193.1| Chloride channel protein CLC-c [Populus trichocarpa]
 gb|ERP62990.1| Chloride channel protein CLC-c [Populus trichocarpa]
Length=769

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            + + F   D A+    K  K+ ++ +  +EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  664  IMKSFKAHDFAKAGSGKGVKLEDLEITEEEMEMYVDLHPITNTSPYTVVETMSLAKAAVL  723

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR++GL  + + PK    G  P+ GIL R D    +ILG++PH+
Sbjct  724  FRELGLRHLCVVPKT--PGRPPIVGILTRHDFTPDHILGLYPHI  765



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM M+V LHP+T T+P++  E++S+AK   LFRQ+GL  + + PK    G
Sbjct  689  KIEDLVISGEEMEMYVDLHPITNTSPYTVLETLSLAKVAILFRQLGLRHLCVVPK--TPG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG++PH+
Sbjct  747  RPPIVGILTRHDFMPEHVLGLYPHI  771



>ref|XP_002527858.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF34561.1| chloride channel clc, putative [Ricinus communis]
Length=754

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ ++ +  +EM M+V LHP+T T+P++  ES+S+AKA  LFR++GL  + + PK    G
Sbjct  668  KLEDLDITAEEMDMYVDLHPITNTSPYTVVESMSLAKAAVLFRELGLRHLCVVPK--TPG  725

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +ILG++PH+
Sbjct  726  RPPIVGILTRHDFVPEHILGLYPHI  750



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  682  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  741

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  742  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHV  784



>gb|KDO42565.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=642

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  535  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  594

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  595  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  637



>ref|XP_006431488.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 ref|XP_006431489.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44728.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44729.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=642

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  535  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  594

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  595  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHI  637



>ref|XP_004975698.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Setaria 
italica]
Length=875

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V +KF   D A+    K  KI ++   ++EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  770  VLKKFGAFDFAKAGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVL  829

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  +L+ PK    G  P+ GIL R D    +I G+FP+L
Sbjct  830  FRALGLRHLLVVPKT--PGRPPIVGILTRHDFMPEHIHGLFPNL  871



>ref|XP_007214607.1| hypothetical protein PRUPE_ppa001700mg [Prunus persica]
 gb|EMJ15806.1| hypothetical protein PRUPE_ppa001700mg [Prunus persica]
Length=777

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -3

Query  387  MGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILARQ  208
            M M+V LHP+T  +P++  E++S+AKA  LFRQ+GL  + L PK+Q  G  P+ GIL R 
Sbjct  703  MDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGILTRH  760

Query  207  DPRGPNILGVFPHL  166
            D    +ILG++PH+
Sbjct  761  DFMPEHILGLYPHI  774



>gb|EMS56130.1| Putative chloride channel-like protein CLC-g [Triticum urartu]
Length=866

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = -3

Query  459  EKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFR  292
            + FS  D A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR
Sbjct  754  KHFSPEDFAKRGSGKHDRIEDIELTAEELEMFVDLHPFTNTSPYTVVETMSLAKALILFR  813

Query  291  QVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            +VGL  +L+ PK       PV GIL R D    ++LG+ P+L
Sbjct  814  EVGLRHLLVLPKTSKRA--PVVGILTRHDFMPEHVLGLHPYL  853



>ref|NP_001130407.2| chloride channel G [Zea mays]
 gb|ADF18550.1| chloride channel G [Zea mays]
Length=943

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  + A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  692  FSHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREV  751

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK+      PV GIL R D    +ILG+ P L
Sbjct  752  GLRHLLVLPKSSKRA--PVVGILTRHDFMPEHILGLHPFL  789



>ref|XP_008452224.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c 
[Cucumis melo]
Length=789

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -3

Query  393  DEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILA  214
            +E+ MFV LHP+T T+P++  ES+S+AKA  LF  +GL  +L+ PK    G  P+ GIL 
Sbjct  712  EELEMFVDLHPITNTSPYTVVESMSLAKAAILFHALGLRHLLVVPK--TPGRPPIAGILT  769

Query  213  RQDPRGPNILGVFPHL  166
            R D    +ILG++PHL
Sbjct  770  RHDFMPEHILGLYPHL  785



>ref|XP_009393492.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393493.1| PREDICTED: chloride channel protein CLC-c [Musa acuminata subsp. 
malaccensis]
Length=780

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V ++F   D A+    K  K+  + +  +EM M+V LHP+T  +P++ +E++S+AKA  
Sbjct  674  DVLQRFGAYDFAKAGSGKGVKLEEIDINEEEMEMYVDLHPITNRSPYTVAETMSLAKAAI  733

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK    G  P+ GIL R D    +ILG+FP +
Sbjct  734  LFRELGLRHLCVVPKT--PGRPPIVGILTRHDFMSEHILGLFPRI  776



>ref|XP_008227672.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
 ref|XP_008227673.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
 ref|XP_008227674.1| PREDICTED: chloride channel protein CLC-c-like [Prunus mume]
Length=777

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -3

Query  387  MGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAGGFPVGGILARQ  208
            M M+V LHP+T  +P++  E++S+AKA  LFRQ+GL  + L PK+Q  G  P+ GIL R 
Sbjct  703  MDMYVDLHPITNASPYTVVETMSLAKAAILFRQLGLRHLCLVPKSQ--GRPPIVGILTRH  760

Query  207  DPRGPNILGVFPHL  166
            D    +ILG++PH+
Sbjct  761  DFMPEHILGLYPHI  774



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V  +F   D A+    K  KI ++   ++E+ M+V LHP+T T+P++  E++S+AKA  L
Sbjct  698  VLRRFGAFDFAKPGSGKGLKIEDLDFTDEELEMYVDLHPITNTSPYTVVETMSLAKAAVL  757

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            FR +GL  +L+ PK    G  P+ GIL R D    +ILG+FP+L+
Sbjct  758  FRALGLRHLLVVPKTP--GRPPIVGILTRHDFMPEHILGLFPNLS  800



>ref|XP_004975700.1| PREDICTED: chloride channel protein CLC-c-like isoform X3 [Setaria 
italica]
Length=844

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V +KF   D A+    K  KI ++   ++EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  739  VLKKFGAFDFAKAGSGKGLKIEDLDFTDEEMDMYVDLHPITNTSPYTVVETMSLAKAAVL  798

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  +L+ PK    G  P+ GIL R D    +I G+FP+L
Sbjct  799  FRALGLRHLLVVPKT--PGRPPIVGILTRHDFMPEHIHGLFPNL  840



>ref|XP_006470993.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Citrus 
sinensis]
Length=642

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            ++  +F   D A+    K  K+ ++ +  +EM MFV LHP+T T+P++  E++S+AKA  
Sbjct  535  DIMRRFKAHDFAKAGSGKGVKLEDLDIKEEEMEMFVDLHPITNTSPYTVVETMSLAKAAV  594

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFRQ+ L  + + PK    G  P+ GIL R D    ++LG++PH+
Sbjct  595  LFRQLALRHLCVVPK--TPGRPPIVGILTRHDFMPEHVLGLYPHV  637



>ref|XP_009768532.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
Length=775

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K  ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPKK--TG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +I  ++PHL
Sbjct  747  RAPIAGILTRHDFMHEHISNLYPHL  771



>ref|XP_009599120.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=775

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K  ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFRQ+GL  + + PK    G
Sbjct  689  KFEDLVITQEEMEMYVDLHPITNTSPYTVVETMSLAKAAILFRQLGLRHLCVVPKK--TG  746

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    +I  ++PHL
Sbjct  747  RAPIAGILTRHDFMHEHISNLYPHL  771



>ref|XP_004977021.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=820

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+VGL  +L+ PK+ 
Sbjct  713  KQDRIEDIELSAEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREVGLRHLLVLPKSS  772

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
                 PV GIL R D    ++LG+ P L
Sbjct  773  TRA--PVVGILTRHDFMPEHVLGLHPFL  798



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            ++ ++ +  +EM M+V LHP+T T+P++  E++S+AKA  LFR++GL  +L+ PK    G
Sbjct  675  RVEDLDISQEEMEMYVDLHPITNTSPYTVVETMSLAKAALLFRELGLRHLLVVPKK--PG  732

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D     ILG+FP+L
Sbjct  733  RPPIVGILTRHDFMHDYILGLFPNL  757



>ref|XP_010030223.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57159.1| hypothetical protein EUGRSUZ_I02790 [Eucalyptus grandis]
Length=778

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ ++ + +DEM MFV LHP+T  +P++  E+ S+AKA  LFR++GL  + + PK    G
Sbjct  692  KVEDLDIKDDEMEMFVDLHPITNMSPYTVLETTSLAKAAVLFRELGLRHLCVVPK--TPG  749

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG+ PHL
Sbjct  750  RPPIVGILTRHDFMPEHVLGLHPHL  774



>ref|XP_002453459.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
 gb|EES06435.1| hypothetical protein SORBIDRAFT_04g006250 [Sorghum bicolor]
Length=793

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQ  250
            K   I +V +  +EM M+V LHP T T+P++  E++S+AKA+ LFR+VGL  +L+ PK  
Sbjct  678  KQDAIADVVLSPEEMEMYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPK--  735

Query  249  AAGGFPVGGILARQDPRGPNILGVFPHL  166
            A    PV GIL R D    +ILG+ P L
Sbjct  736  ACDRSPVVGILTRHDFMPEHILGLHPVL  763



>gb|EMT05380.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=127

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V E+F   D A+    K  KI ++   ++EM M+V LH +  T+P++  E++S+AKA  L
Sbjct  14   VMERFGAFDFAKAGSGKGLKIEDLHFTDEEMQMYVDLHAIANTSPYTVVETMSLAKAALL  73

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR++GL  +L+ PK       P+ GIL R D    +I  +FP L
Sbjct  74   FRELGLRHLLVVPKTPYRP--PIVGILTRHDFVAEHIHDLFPSL  115



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+ + F   D A+    K  K+ ++ +  +EM M+V LHP+T T+P++  E++S+AKA  
Sbjct  665  EILKTFEANDFAKAGSGKGVKLEDLDITAEEMEMYVDLHPITNTSPYTVVETMSLAKAAV  724

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LFR++GL  + + PK  A    P+ GIL R D    +I G++PH 
Sbjct  725  LFRELGLRHLCVVPKTHARP--PIVGILTRHDFMPGHIRGLYPHF  767



>ref|XP_010687880.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=676

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAEK----WGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            +V E+FS VD A+        I ++ + ++E+ MFV LHP T  +P++  E++S+AKA  
Sbjct  555  DVFEQFSSVDFAKSGSATVDDIEDIELTDEELKMFVDLHPFTNASPYTIVETMSLAKARV  614

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHLA  163
            LFR+VGL  ML+ P        PV G+L R D    ++L + P L 
Sbjct  615  LFREVGLRHMLVTPTTIDRS--PVVGMLTRHDFMPEHVLSLHPSLV  658



>gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
 gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays]
Length=795

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V E+F   D A+    K  KI ++   ++EM ++V LHP+T T+P++  E++S+AKA  L
Sbjct  690  VLERFGAFDFAKPGSGKGLKIEDLDFTDEEMDLYVDLHPITNTSPYTVVETMSLAKAAVL  749

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  ML+ PK    G  P+ GIL R D    +I G+FP++
Sbjct  750  FRALGLRHMLVVPKT--PGRPPIVGILTRHDFIPEHIHGLFPNI  791



>ref|XP_010030224.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Eucalyptus 
grandis]
Length=712

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            K+ ++ + +DEM MFV LHP+T  +P++  E+ S+AKA  LFR++GL  + + PK    G
Sbjct  626  KVEDLDIKDDEMEMFVDLHPITNMSPYTVLETTSLAKAAVLFRELGLRHLCVVPK--TPG  683

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
              P+ GIL R D    ++LG+ PHL
Sbjct  684  RPPIVGILTRHDFMPEHVLGLHPHL  708



>gb|KJB53990.1| hypothetical protein B456_009G015100 [Gossypium raimondii]
Length=774

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  KI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQVGLCPMLLGPKNQAAG  241
            KI ++ +  +EM MF+ LHP T  +P++  E++S+AKA  LFR+VGL  +L+ PK     
Sbjct  673  KIEDIKLTEEEMEMFLDLHPFTNASPYTVVETMSLAKASTLFREVGLRHLLVIPKRTT--  730

Query  240  GFPVGGILARQDPRGPNILGVFPHL  166
            G PV GIL R D    ++LG+ P L
Sbjct  731  GSPVVGILTRHDFMPEHVLGLHPLL  755



>tpg|DAA35720.1| TPA: chloride channel G, partial [Zea mays]
Length=823

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  + A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  692  FSHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREV  751

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK+      PV GIL R D    +ILG+ P L
Sbjct  752  GLRHLLVLPKSSKRA--PVVGILTRHDFMPEHILGLHPFL  789



>tpg|DAA35719.1| TPA: hypothetical protein ZEAMMB73_781870, partial [Zea mays]
Length=827

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  + A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  696  FSHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREV  755

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK+      PV GIL R D    +ILG+ P L
Sbjct  756  GLRHLLVLPKSSKRA--PVVGILTRHDFMPEHILGLHPFL  793



>ref|XP_002447212.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
 gb|EES11540.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
Length=814

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = -3

Query  453  FSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGLFRQV  286
            FS  + A+    K  +I ++ +  +E+ MFV LHP T T+P++  E++S+AKA+ LFR+V
Sbjct  698  FSHAEFAKRGSGKHDRIEDIELCPEELEMFVDLHPFTNTSPYTVLETMSLAKALILFREV  757

Query  285  GLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            GL  +L+ PK+      PV GIL R D    +ILG+ P L
Sbjct  758  GLRHLLVLPKSSKRA--PVVGILTRHDFMPEHILGLHPFL  795



>ref|XP_004133731.1| PREDICTED: chloride channel protein CLC-c-like isoform 2 [Cucumis 
sativus]
 gb|AFJ15539.1| chloride channel c [Cucumis sativus]
Length=718

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+   F   D A+    K  K+ ++    +E+ MFV LHP+T T+P++  ES+S+AKA  
Sbjct  612  EIWRGFKAHDFAKPGSGKGVKLEDLDFNEEELEMFVDLHPITNTSPYTVVESMSLAKAAI  671

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LF  +GL  +L+ PK    G  P+ GIL R D    +ILG++PHL
Sbjct  672  LFHALGLRHLLVVPK--TPGRPPIAGILTRHDFMPEHILGLYPHL  714



>ref|XP_004155280.1| PREDICTED: chloride channel protein CLC-c-like [Cucumis sativus]
Length=598

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = -3

Query  468  EVREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMG  301
            E+   F   D A+    K  K+ ++    +E+ MFV LHP+T T+P++  ES+S+AKA  
Sbjct  492  EIWRGFKAHDFAKPGSGKGVKLEDLDFNEEELEMFVDLHPITNTSPYTVVESMSLAKAAI  551

Query  300  LFRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            LF  +GL  +L+ PK    G  P+ GIL R D    +ILG++PHL
Sbjct  552  LFHALGLRHLLVVPKT--PGRPPIAGILTRHDFMPEHILGLYPHL  594



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -3

Query  465  VREKFSWVDLAE----KWGKI*NVAVPNDEMGMFVGLHPLTKTTPFSGSESISVAKAMGL  298
            V ++F   D A+    K  KI ++   ++EM M+V LHP+T T+P++  E++S+AKA  L
Sbjct  690  VLQRFGAFDFAKAGSGKGIKIEDLDFTDEEMEMYVDLHPVTNTSPYTVVETMSLAKAAVL  749

Query  297  FRQVGLCPMLLGPKNQAAGGFPVGGILARQDPRGPNILGVFPHL  166
            FR +GL  +L+ PK    G  P+ GIL R D    +I G+FP+L
Sbjct  750  FRALGLRHLLVVPKT--PGRPPIVGILTRHDLMPEHIHGLFPNL  791



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552245584395