BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041C23

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776174.1|  PREDICTED: uncharacterized protein LOC104225989    145   4e-38   Nicotiana sylvestris
ref|XP_009619129.1|  PREDICTED: uncharacterized protein LOC104111192    145   6e-38   Nicotiana tomentosiformis
ref|XP_006366515.1|  PREDICTED: uncharacterized protein LOC102585370    144   6e-38   Solanum tuberosum [potatoes]
ref|XP_004244888.1|  PREDICTED: uncharacterized protein LOC101262938    143   2e-37   Solanum lycopersicum
ref|XP_010665861.1|  PREDICTED: uncharacterized protein LOC104883105    122   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002285361.1|  PREDICTED: uncharacterized protein LOC100262872    112   8e-26   Vitis vinifera
emb|CAN69699.1|  hypothetical protein VITISV_001515                     110   3e-25   Vitis vinifera
ref|XP_007011756.1|  Uncharacterized protein TCM_036932                 104   5e-23   
gb|KDP33539.1|  hypothetical protein JCGZ_07110                         100   7e-22   Jatropha curcas
gb|KJB55057.1|  hypothetical protein B456_009G060700                    100   7e-22   Gossypium raimondii
gb|KJB07669.1|  hypothetical protein B456_001G036600                  99.4    2e-21   Gossypium raimondii
ref|XP_010033684.1|  PREDICTED: uncharacterized protein LOC104422917  97.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_010048907.1|  PREDICTED: uncharacterized protein LOC104437620  97.1    1e-20   Eucalyptus grandis [rose gum]
ref|XP_003603315.1|  hypothetical protein MTR_3g106250                96.3    2e-20   Medicago truncatula
ref|XP_006450316.1|  hypothetical protein CICLE_v10008624mg           96.3    3e-20   Citrus clementina [clementine]
ref|XP_004501367.1|  PREDICTED: uncharacterized protein LOC101507611  95.9    3e-20   Cicer arietinum [garbanzo]
ref|XP_008220875.1|  PREDICTED: uncharacterized protein LOC103320911  93.6    2e-19   
ref|XP_008378697.1|  PREDICTED: uncharacterized protein LOC103441769  92.8    4e-19   Malus domestica [apple tree]
ref|XP_009363946.1|  PREDICTED: uncharacterized protein LOC103953867  91.3    1e-18   Pyrus x bretschneideri [bai li]
gb|KJB65893.1|  hypothetical protein B456_010G117700                  91.3    1e-18   Gossypium raimondii
ref|XP_010245551.1|  PREDICTED: uncharacterized protein LOC104589062  91.3    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_007224916.1|  hypothetical protein PRUPE_ppa021934mg           91.7    2e-18   
ref|XP_004291941.1|  PREDICTED: uncharacterized protein LOC101293553  90.5    3e-18   Fragaria vesca subsp. vesca
ref|XP_008377675.1|  PREDICTED: uncharacterized protein LOC103440754  90.1    3e-18   
ref|XP_006382097.1|  hypothetical protein POPTR_0006s27720g           86.3    4e-17   
emb|CBI21089.3|  unnamed protein product                              85.9    8e-17   Vitis vinifera
ref|XP_007136970.1|  hypothetical protein PHAVU_009G089200g           85.5    1e-16   Phaseolus vulgaris [French bean]
ref|XP_004138846.1|  PREDICTED: uncharacterized protein LOC101205493  85.5    1e-16   
ref|XP_004160786.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.5    1e-16   
ref|XP_011039597.1|  PREDICTED: uncharacterized protein LOC105136101  86.3    1e-16   Populus euphratica
ref|XP_002515453.1|  conserved hypothetical protein                   85.5    1e-16   
gb|KGN62983.1|  hypothetical protein Csa_2G382560                     85.5    1e-16   Cucumis sativus [cucumbers]
ref|XP_011036648.1|  PREDICTED: uncharacterized protein LOC105134078  86.3    1e-16   Populus euphratica
ref|XP_008445586.1|  PREDICTED: uncharacterized protein LOC103488566  84.7    2e-16   Cucumis melo [Oriental melon]
emb|CDP18790.1|  unnamed protein product                              85.5    2e-16   Coffea canephora [robusta coffee]
ref|XP_007161151.1|  hypothetical protein PHAVU_001G046800g           84.3    3e-16   Phaseolus vulgaris [French bean]
ref|XP_002324318.2|  hypothetical protein POPTR_0018s02290g           84.7    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003549308.1|  PREDICTED: putative uncharacterized protein ...  84.0    5e-16   Glycine max [soybeans]
ref|XP_003545439.1|  PREDICTED: putative uncharacterized protein ...  83.2    1e-15   Glycine max [soybeans]
gb|KEH39864.1|  DUF868 family protein                                 81.6    2e-15   Medicago truncatula
gb|KCW80312.1|  hypothetical protein EUGRSUZ_C01671                   78.6    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010050717.1|  PREDICTED: uncharacterized protein LOC104439337  79.7    2e-14   
ref|XP_010050838.1|  PREDICTED: uncharacterized protein LOC104439472  78.6    4e-14   
emb|CDY51100.1|  BnaCnng20030D                                        77.8    8e-14   Brassica napus [oilseed rape]
ref|XP_010265675.1|  PREDICTED: uncharacterized protein LOC104603360  76.3    4e-13   Nelumbo nucifera [Indian lotus]
emb|CDX97072.1|  BnaC09g45530D                                        75.9    7e-13   
ref|XP_003527779.1|  PREDICTED: uncharacterized protein LOC100783731  74.7    8e-13   Glycine max [soybeans]
emb|CDX85733.1|  BnaA02g00800D                                        74.3    1e-12   
ref|XP_009125261.1|  PREDICTED: uncharacterized protein LOC103850289  74.3    2e-12   Brassica rapa
ref|XP_010519647.1|  PREDICTED: uncharacterized protein LOC104799041  74.3    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_010089947.1|  hypothetical protein L484_014458                 73.9    2e-12   
ref|XP_004145513.1|  PREDICTED: uncharacterized protein LOC101215936  72.8    2e-12   
ref|XP_006399599.1|  hypothetical protein EUTSA_v10015286mg           73.9    3e-12   Eutrema salsugineum [saltwater cress]
emb|CDX69793.1|  BnaA10g21420D                                        73.9    3e-12   
ref|XP_009122005.1|  PREDICTED: uncharacterized protein LOC103846761  73.9    4e-12   Brassica rapa
ref|XP_008452874.1|  PREDICTED: uncharacterized protein LOC103493769  72.4    7e-12   Cucumis melo [Oriental melon]
gb|KGN55450.1|  hypothetical protein Csa_4G652140                     72.4    7e-12   Cucumis sativus [cucumbers]
ref|XP_010541582.1|  PREDICTED: uncharacterized protein LOC104815002  71.6    2e-11   Tarenaya hassleriana [spider flower]
gb|AFB32548.1|  hypothetical protein 0_14883_01                       67.8    4e-11   Larix decidua
ref|XP_006289029.1|  hypothetical protein CARUB_v10002414mg           69.7    7e-11   Capsella rubella
gb|AFB32542.1|  hypothetical protein 0_14883_01                       66.2    1e-10   Abies alba [abete-blanco]
gb|AEW07939.1|  hypothetical protein 0_14883_01                       65.1    3e-10   Pinus radiata
gb|AFB32551.1|  hypothetical protein 0_14883_01                       65.1    3e-10   Pinus mugo [mountain pine]
ref|XP_006405118.1|  hypothetical protein EUTSA_v10000227mg           67.4    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010929117.1|  PREDICTED: uncharacterized protein LOC105050701  67.0    7e-10   Elaeis guineensis
gb|AFB32550.1|  hypothetical protein 0_14883_01                       63.9    8e-10   Pinus mugo [mountain pine]
ref|XP_006494497.1|  PREDICTED: uncharacterized protein LOC102630737  62.8    1e-09   
ref|XP_010090415.1|  hypothetical protein L484_025081                 65.5    1e-09   Morus notabilis
ref|XP_004958096.1|  PREDICTED: uncharacterized protein LOC101782767  65.1    1e-09   Setaria italica
ref|XP_002460890.1|  hypothetical protein SORBIDRAFT_02g037000        65.1    1e-09   Sorghum bicolor [broomcorn]
emb|CDO99050.1|  unnamed protein product                              65.1    2e-09   Coffea canephora [robusta coffee]
dbj|BAJ95878.1|  predicted protein                                    65.1    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52757.1|  hypothetical protein TRIUR3_04572                     63.9    2e-09   Triticum urartu
ref|XP_010942142.1|  PREDICTED: uncharacterized protein LOC105060228  65.5    2e-09   Elaeis guineensis
ref|XP_004493685.1|  PREDICTED: uncharacterized protein LOC101510231  64.7    2e-09   Cicer arietinum [garbanzo]
emb|CDY56275.1|  BnaA09g55790D                                        62.8    2e-09   Brassica napus [oilseed rape]
ref|XP_002873490.1|  hypothetical protein ARALYDRAFT_909057           65.5    2e-09   Arabidopsis lyrata subsp. lyrata
gb|ABR17303.1|  unknown                                               64.3    2e-09   Picea sitchensis
ref|XP_009402136.1|  PREDICTED: uncharacterized protein LOC103986002  64.7    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25403.1|  hypothetical protein F775_31443                       64.7    2e-09   
ref|XP_009407751.1|  PREDICTED: uncharacterized protein LOC103990370  64.3    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_196661.1|  uncharacterized protein                             65.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417285.1|  PREDICTED: uncharacterized protein LOC104703050  65.1    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011079867.1|  PREDICTED: uncharacterized protein LOC105163276  64.3    3e-09   
ref|XP_010453134.1|  PREDICTED: uncharacterized protein LOC104735112  65.1    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010419653.1|  PREDICTED: uncharacterized protein LOC104705366  64.7    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008808239.1|  PREDICTED: uncharacterized protein LOC103720353  64.7    4e-09   Phoenix dactylifera
emb|CBI26241.3|  unnamed protein product                              63.5    4e-09   Vitis vinifera
ref|XP_010552768.1|  PREDICTED: uncharacterized protein LOC104823045  63.9    4e-09   Tarenaya hassleriana [spider flower]
gb|ACU20214.1|  unknown                                               63.9    5e-09   Glycine max [soybeans]
ref|XP_010491790.1|  PREDICTED: uncharacterized protein LOC104769314  64.3    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009387555.1|  PREDICTED: uncharacterized protein LOC103974443  63.9    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846874.1|  hypothetical protein AMTR_s00150p00067790        64.3    5e-09   Amborella trichopoda
gb|EAZ04414.1|  hypothetical protein OsI_26558                        63.5    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004247361.1|  PREDICTED: uncharacterized protein LOC101254730  63.5    5e-09   Solanum lycopersicum
ref|XP_010649892.1|  PREDICTED: uncharacterized protein LOC100246068  63.5    6e-09   Vitis vinifera
ref|XP_003536564.1|  PREDICTED: uncharacterized protein LOC100796685  63.5    6e-09   
emb|CAN68226.1|  hypothetical protein VITISV_040533                   63.5    6e-09   Vitis vinifera
gb|AFK42653.1|  unknown                                               63.2    6e-09   Medicago truncatula
ref|XP_009601952.1|  PREDICTED: uncharacterized protein LOC104097132  63.5    6e-09   Nicotiana tomentosiformis
ref|XP_006360806.1|  PREDICTED: uncharacterized protein LOC102583145  63.5    6e-09   Solanum tuberosum [potatoes]
ref|XP_006433029.1|  hypothetical protein CICLE_v10001999mg           63.5    6e-09   Citrus clementina [clementine]
gb|KEH23778.1|  plant/T24G3-80 protein                                63.5    6e-09   Medicago truncatula
ref|XP_004981359.1|  PREDICTED: uncharacterized protein LOC101774579  63.2    7e-09   Setaria italica
ref|XP_011071576.1|  PREDICTED: uncharacterized protein LOC105156990  63.2    8e-09   Sesamum indicum [beniseed]
ref|XP_004146978.1|  PREDICTED: uncharacterized protein LOC101203661  63.5    8e-09   
ref|XP_004158912.1|  PREDICTED: uncharacterized protein LOC101227560  63.5    8e-09   
ref|XP_008451346.1|  PREDICTED: uncharacterized protein LOC103492661  63.2    8e-09   Cucumis melo [Oriental melon]
gb|KJB22972.1|  hypothetical protein B456_004G079100                  61.2    8e-09   Gossypium raimondii
gb|EAY92263.1|  hypothetical protein OsI_13984                        60.8    9e-09   Oryza sativa Indica Group [Indian rice]
gb|KFK25379.1|  hypothetical protein AALP_AA8G105700                  63.5    9e-09   Arabis alpina [alpine rockcress]
ref|XP_008455804.1|  PREDICTED: uncharacterized protein LOC103495897  63.2    9e-09   Cucumis melo [Oriental melon]
ref|XP_004139223.1|  PREDICTED: uncharacterized protein LOC101220430  63.2    9e-09   Cucumis sativus [cucumbers]
gb|KGN60826.1|  hypothetical protein Csa_2G011590                     63.2    1e-08   Cucumis sativus [cucumbers]
ref|XP_007144641.1|  hypothetical protein PHAVU_007G172700g           62.8    1e-08   Phaseolus vulgaris [French bean]
emb|CDP03641.1|  unnamed protein product                              62.8    1e-08   Coffea canephora [robusta coffee]
ref|NP_001143196.1|  uncharacterized protein LOC100275698             62.8    1e-08   
gb|KHN03804.1|  hypothetical protein glysoja_011033                   62.8    1e-08   Glycine soja [wild soybean]
ref|XP_008651185.1|  PREDICTED: uncharacterized protein LOC100275...  62.8    1e-08   
gb|AFG57306.1|  hypothetical protein 0_630_01                         60.5    1e-08   Pinus taeda
gb|AFG57303.1|  hypothetical protein 0_630_01                         60.5    1e-08   Pinus taeda
gb|EMT06649.1|  hypothetical protein F775_13550                       62.4    1e-08   
gb|AFG57305.1|  hypothetical protein 0_630_01                         60.5    1e-08   Pinus taeda
ref|XP_003518919.1|  PREDICTED: uncharacterized protein LOC100793503  62.8    1e-08   Glycine max [soybeans]
ref|XP_008804337.1|  PREDICTED: uncharacterized protein LOC103717650  62.4    1e-08   Phoenix dactylifera
ref|XP_007162443.1|  hypothetical protein PHAVU_001G152600g           62.4    1e-08   Phaseolus vulgaris [French bean]
gb|EYU46571.1|  hypothetical protein MIMGU_mgv1a026066mg              61.6    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_010674843.1|  PREDICTED: uncharacterized protein LOC104890923  62.4    1e-08   
ref|XP_008783101.1|  PREDICTED: uncharacterized protein LOC103702440  62.0    2e-08   Phoenix dactylifera
ref|XP_006657868.1|  PREDICTED: uncharacterized protein LOC102710887  62.0    2e-08   Oryza brachyantha
gb|KJB42120.1|  hypothetical protein B456_007G137800                  61.6    2e-08   Gossypium raimondii
gb|ACN25495.1|  unknown                                               61.2    2e-08   Zea mays [maize]
ref|XP_003564146.1|  PREDICTED: uncharacterized protein LOC100837549  62.0    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_009408456.1|  PREDICTED: uncharacterized protein LOC103990890  62.0    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444048.1|  hypothetical protein CICLE_v10021341mg           62.0    2e-08   
ref|XP_007050578.1|  Uncharacterized protein isoform 2                61.2    2e-08   
ref|XP_010689671.1|  PREDICTED: uncharacterized protein LOC104903342  62.0    2e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45005.1|  hypothetical protein B456_007G284600                  62.0    2e-08   Gossypium raimondii
ref|XP_010929447.1|  PREDICTED: uncharacterized protein LOC105050916  62.0    2e-08   Elaeis guineensis
ref|XP_010910592.1|  PREDICTED: uncharacterized protein LOC105036529  62.0    2e-08   Elaeis guineensis
ref|XP_010923391.1|  PREDICTED: uncharacterized protein LOC105046501  61.6    2e-08   Elaeis guineensis
ref|XP_010455167.1|  PREDICTED: uncharacterized protein LOC104736806  61.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006851632.1|  hypothetical protein AMTR_s00040p00202330        61.6    2e-08   
ref|XP_006294490.1|  hypothetical protein CARUB_v10023518mg           62.4    2e-08   Capsella rubella
ref|XP_002880661.1|  hypothetical protein ARALYDRAFT_481378           62.4    2e-08   Arabidopsis lyrata subsp. lyrata
emb|CDX76763.1|  BnaC08g33490D                                        62.0    2e-08   
ref|XP_007050577.1|  Uncharacterized protein isoform 1                62.0    2e-08   
gb|KJB42124.1|  hypothetical protein B456_007G137800                  62.0    2e-08   Gossypium raimondii
ref|XP_006838233.1|  hypothetical protein AMTR_s00103p00021650        62.0    2e-08   Amborella trichopoda
gb|KJB22971.1|  hypothetical protein B456_004G079100                  62.0    2e-08   Gossypium raimondii
ref|XP_009117076.1|  PREDICTED: uncharacterized protein LOC103842203  62.0    3e-08   Brassica rapa
ref|XP_009792059.1|  PREDICTED: uncharacterized protein LOC104239187  61.6    3e-08   Nicotiana sylvestris
gb|KDP22998.1|  hypothetical protein JCGZ_01720                       62.8    3e-08   Jatropha curcas
ref|XP_011032694.1|  PREDICTED: uncharacterized protein LOC105131425  61.6    3e-08   Populus euphratica
ref|XP_008802684.1|  PREDICTED: uncharacterized protein LOC103716457  61.6    3e-08   Phoenix dactylifera
ref|XP_002307590.1|  hypothetical protein POPTR_0005s23240g           61.6    3e-08   
ref|XP_001770719.1|  predicted protein                                61.6    3e-08   
ref|XP_010253022.1|  PREDICTED: uncharacterized protein LOC104594441  61.6    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009151242.1|  PREDICTED: uncharacterized protein LOC103874571  61.6    3e-08   Brassica rapa
ref|XP_006395009.1|  hypothetical protein EUTSA_v10004720mg           61.2    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009392096.1|  PREDICTED: uncharacterized protein LOC103978120  61.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI28703.3|  unnamed protein product                              61.2    3e-08   Vitis vinifera
ref|NP_001167908.1|  hypothetical protein                             61.2    3e-08   Zea mays [maize]
ref|XP_010277409.1|  PREDICTED: uncharacterized protein LOC104611862  61.2    4e-08   Nelumbo nucifera [Indian lotus]
gb|KHN10674.1|  hypothetical protein glysoja_019105                   61.2    4e-08   Glycine soja [wild soybean]
ref|XP_003632331.1|  PREDICTED: uncharacterized protein LOC100853449  61.2    4e-08   Vitis vinifera
ref|XP_006288375.1|  hypothetical protein CARUB_v10001626mg           61.2    4e-08   Capsella rubella
ref|XP_010256015.1|  PREDICTED: uncharacterized protein LOC104596517  61.2    4e-08   Nelumbo nucifera [Indian lotus]
gb|KDP21447.1|  hypothetical protein JCGZ_21918                       61.2    4e-08   Jatropha curcas
ref|XP_003617887.1|  Kinesin-4                                        62.4    4e-08   
ref|XP_010228241.1|  PREDICTED: uncharacterized protein LOC100838117  61.2    4e-08   
gb|AET00846.2|  kinesin heavy chain, putative                         62.4    4e-08   Medicago truncatula
ref|XP_010041438.1|  PREDICTED: uncharacterized protein LOC104430401  61.2    5e-08   Eucalyptus grandis [rose gum]
ref|XP_011090719.1|  PREDICTED: uncharacterized protein LOC105171...  60.8    5e-08   
ref|XP_010421680.1|  PREDICTED: uncharacterized protein LOC104707100  60.8    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003521248.2|  PREDICTED: uncharacterized protein LOC100799355  61.2    5e-08   Glycine max [soybeans]
ref|NP_198167.1|  uncharacterized protein                             60.8    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19762.1|  unknown                                               60.5    5e-08   Glycine max [soybeans]
ref|XP_008457940.1|  PREDICTED: uncharacterized protein LOC103497505  58.2    5e-08   
emb|CDY52485.1|  BnaC07g49460D                                        60.8    5e-08   Brassica napus [oilseed rape]
gb|EMS45281.1|  hypothetical protein TRIUR3_16464                     60.5    6e-08   Triticum urartu
ref|XP_002466252.1|  hypothetical protein SORBIDRAFT_01g004400        60.8    6e-08   Sorghum bicolor [broomcorn]
ref|XP_010546610.1|  PREDICTED: uncharacterized protein LOC104818644  60.5    6e-08   Tarenaya hassleriana [spider flower]
emb|CAN61445.1|  hypothetical protein VITISV_024138                   61.2    6e-08   Vitis vinifera
ref|XP_002872306.1|  hypothetical protein ARALYDRAFT_489643           60.5    6e-08   
gb|AFW67285.1|  hypothetical protein ZEAMMB73_929047                  60.5    6e-08   
ref|XP_011090718.1|  PREDICTED: uncharacterized protein LOC105171...  60.8    7e-08   
ref|XP_002520723.1|  conserved hypothetical protein                   60.5    7e-08   Ricinus communis
ref|NP_001060057.1|  Os07g0572300                                     60.5    7e-08   
ref|XP_009592922.1|  PREDICTED: uncharacterized protein LOC104089679  60.5    7e-08   Nicotiana tomentosiformis
ref|XP_010429511.1|  PREDICTED: uncharacterized protein LOC104713...  60.8    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011032437.1|  PREDICTED: uncharacterized protein LOC105131255  60.5    8e-08   Populus euphratica
ref|XP_006366122.1|  PREDICTED: uncharacterized protein LOC102584925  60.5    8e-08   Solanum tuberosum [potatoes]
ref|XP_002524594.1|  conserved hypothetical protein                   60.5    9e-08   Ricinus communis
ref|XP_004252365.1|  PREDICTED: uncharacterized protein LOC101249896  60.5    9e-08   Solanum lycopersicum
ref|XP_006650760.1|  PREDICTED: uncharacterized protein LOC102720690  60.1    9e-08   Oryza brachyantha
ref|XP_009778863.1|  PREDICTED: uncharacterized protein LOC104228156  60.1    9e-08   Nicotiana sylvestris
ref|XP_010429513.1|  PREDICTED: uncharacterized protein LOC104713...  60.5    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003536115.1|  PREDICTED: uncharacterized protein LOC100778089  60.1    1e-07   Glycine max [soybeans]
ref|XP_008380035.1|  PREDICTED: uncharacterized protein LOC103443030  60.1    1e-07   
ref|XP_011026156.1|  PREDICTED: uncharacterized protein LOC105126841  60.1    1e-07   Populus euphratica
ref|XP_008218232.1|  PREDICTED: uncharacterized protein LOC103318613  60.1    1e-07   
ref|XP_007207341.1|  hypothetical protein PRUPE_ppa009272mg           60.1    1e-07   Prunus persica
gb|EPS66867.1|  hypothetical protein M569_07907                       60.1    1e-07   Genlisea aurea
ref|XP_010494083.1|  PREDICTED: uncharacterized protein LOC104771271  59.7    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_004302026.1|  PREDICTED: uncharacterized protein LOC101296394  60.1    1e-07   Fragaria vesca subsp. vesca
ref|XP_001772274.1|  predicted protein                                59.7    1e-07   
ref|XP_008345708.1|  PREDICTED: uncharacterized protein LOC103408652  59.7    1e-07   
ref|XP_008388659.1|  PREDICTED: uncharacterized protein LOC103451015  59.7    1e-07   
gb|EEE60141.1|  hypothetical protein OsJ_13031                        59.7    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009364535.1|  PREDICTED: uncharacterized protein LOC103954432  59.7    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_004305864.1|  PREDICTED: uncharacterized protein LOC101301230  59.7    1e-07   Fragaria vesca subsp. vesca
ref|XP_004495197.1|  PREDICTED: uncharacterized protein LOC101503605  59.7    1e-07   Cicer arietinum [garbanzo]
ref|XP_003562863.1|  PREDICTED: uncharacterized protein LOC100826732  59.3    1e-07   Brachypodium distachyon [annual false brome]
ref|NP_001051637.1|  Os03g0806700                                     59.7    1e-07   
ref|XP_003539811.1|  PREDICTED: uncharacterized protein LOC100794621  59.7    1e-07   Glycine max [soybeans]
ref|XP_002512236.1|  conserved hypothetical protein                   59.7    2e-07   
emb|CBI34200.3|  unnamed protein product                              58.9    2e-07   Vitis vinifera
gb|KHN21116.1|  hypothetical protein glysoja_006595                   59.7    2e-07   Glycine soja [wild soybean]
ref|XP_008342273.1|  PREDICTED: uncharacterized protein LOC103405081  59.3    2e-07   
ref|XP_008353616.1|  PREDICTED: uncharacterized protein LOC103417205  59.3    2e-07   
ref|XP_004490568.1|  PREDICTED: uncharacterized protein LOC101492045  59.3    2e-07   Cicer arietinum [garbanzo]
ref|XP_003544282.1|  PREDICTED: uncharacterized protein LOC100810973  59.3    2e-07   Glycine max [soybeans]
gb|KDP23639.1|  hypothetical protein JCGZ_23472                       59.3    2e-07   Jatropha curcas
ref|XP_003606250.1|  hypothetical protein MTR_4g055230                59.3    2e-07   Medicago truncatula
ref|XP_002977922.1|  hypothetical protein SELMODRAFT_107811           59.3    2e-07   
ref|XP_002986948.1|  hypothetical protein SELMODRAFT_158336           59.3    2e-07   
gb|AFG57312.1|  hypothetical protein 0_630_01                         56.6    2e-07   Pinus taeda
ref|XP_006382769.1|  hypothetical protein POPTR_0005s05250g           58.9    2e-07   Populus trichocarpa [western balsam poplar]
emb|CAN64151.1|  hypothetical protein VITISV_041021                   59.3    2e-07   Vitis vinifera
ref|XP_010644630.1|  PREDICTED: uncharacterized protein LOC100852612  58.9    2e-07   
ref|XP_002277386.1|  PREDICTED: uncharacterized protein LOC100267457  58.9    2e-07   
gb|ACU18815.1|  unknown                                               59.3    2e-07   Glycine max [soybeans]
gb|KHN38664.1|  hypothetical protein glysoja_008213                   59.3    2e-07   Glycine soja [wild soybean]
ref|XP_003538138.1|  PREDICTED: uncharacterized protein LOC100797969  59.3    2e-07   
ref|XP_007217278.1|  hypothetical protein PRUPE_ppa017616mg           58.9    2e-07   Prunus persica
gb|KHN33661.1|  hypothetical protein glysoja_013667                   58.5    2e-07   Glycine soja [wild soybean]
gb|EYU33727.1|  hypothetical protein MIMGU_mgv1a0262881mg             58.9    2e-07   Erythranthe guttata [common monkey flower]
gb|EEC80133.1|  hypothetical protein OsI_21920                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_008229762.1|  PREDICTED: uncharacterized protein LOC103329112  58.9    3e-07   Prunus mume [ume]
ref|XP_010103965.1|  hypothetical protein L484_020218                 60.1    3e-07   
ref|XP_006604441.1|  PREDICTED: uncharacterized protein LOC100786850  58.9    3e-07   Glycine max [soybeans]
ref|XP_010676107.1|  PREDICTED: uncharacterized protein LOC104892001  58.9    3e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN62312.1|  hypothetical protein VITISV_018204                   59.7    3e-07   Vitis vinifera
gb|EEE65210.1|  hypothetical protein OsJ_20353                        58.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006299727.1|  hypothetical protein CARUB_v10015920mg           58.9    3e-07   Capsella rubella
dbj|BAD72575.1|  hypothetical protein                                 58.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010278217.1|  PREDICTED: uncharacterized protein LOC104612487  58.5    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006418603.1|  hypothetical protein EUTSA_v10002618mg           58.5    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_002883629.1|  hypothetical protein ARALYDRAFT_480071           58.5    4e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010275153.1|  PREDICTED: uncharacterized protein LOC104610298  58.5    4e-07   Nelumbo nucifera [Indian lotus]
gb|KJB22685.1|  hypothetical protein B456_004G060700                  58.5    4e-07   Gossypium raimondii
ref|NP_850061.1|  uncharacterized protein                             58.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038753.1|  PREDICTED: uncharacterized protein LOC104427347  58.5    4e-07   Eucalyptus grandis [rose gum]
emb|CDY00013.1|  BnaC09g02880D                                        58.2    4e-07   
ref|XP_002863234.1|  hypothetical protein ARALYDRAFT_497148           58.2    4e-07   Arabidopsis lyrata subsp. lyrata
emb|CBI28480.3|  unnamed protein product                              58.2    4e-07   Vitis vinifera
ref|XP_009111920.1|  PREDICTED: uncharacterized protein LOC103837313  58.2    4e-07   Brassica rapa
ref|XP_007049429.1|  Uncharacterized protein TCM_002465               58.2    5e-07   
gb|EYU41493.1|  hypothetical protein MIMGU_mgv1a027106mg              58.2    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_004495789.1|  PREDICTED: uncharacterized protein LOC101494890  58.2    5e-07   Cicer arietinum [garbanzo]
gb|KHN46178.1|  hypothetical protein glysoja_022820                   57.4    5e-07   Glycine soja [wild soybean]
gb|KJB10213.1|  hypothetical protein B456_001G189700                  58.2    5e-07   Gossypium raimondii
ref|NP_193005.1|  uncharacterized protein                             57.8    5e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00849.1|  BnaCnng00490D                                        57.8    5e-07   
gb|KFK31798.1|  hypothetical protein AALP_AA6G160300                  58.2    5e-07   Arabis alpina [alpine rockcress]
emb|CDY27882.1|  BnaA07g04720D                                        57.8    5e-07   Brassica napus [oilseed rape]
gb|EYU45648.1|  hypothetical protein MIMGU_mgv1a010996mg              57.8    6e-07   Erythranthe guttata [common monkey flower]
ref|XP_003615564.1|  hypothetical protein MTR_5g069570                58.2    6e-07   Medicago truncatula
ref|XP_006469407.1|  PREDICTED: uncharacterized protein LOC102629245  57.8    6e-07   Citrus sinensis [apfelsine]
ref|XP_009102402.1|  PREDICTED: uncharacterized protein LOC103828543  57.8    6e-07   Brassica rapa
ref|XP_006447854.1|  hypothetical protein CICLE_v10017488mg           57.8    6e-07   Citrus clementina [clementine]
ref|XP_003521743.1|  PREDICTED: uncharacterized protein LOC100791607  57.8    6e-07   
ref|XP_004294466.1|  PREDICTED: uncharacterized protein LOC101309136  57.8    6e-07   Fragaria vesca subsp. vesca
ref|XP_008777988.1|  PREDICTED: uncharacterized protein LOC103697828  57.8    6e-07   Phoenix dactylifera
ref|XP_003518296.1|  PREDICTED: uncharacterized protein LOC100796483  57.8    6e-07   Glycine max [soybeans]
gb|ACU18448.1|  unknown                                               57.8    6e-07   Glycine max [soybeans]
gb|KHN18735.1|  hypothetical protein glysoja_021486                   57.8    6e-07   Glycine soja [wild soybean]
gb|AFK45691.1|  unknown                                               57.8    6e-07   Medicago truncatula
ref|XP_007142239.1|  hypothetical protein PHAVU_008G264000g           57.8    6e-07   
ref|XP_007147151.1|  hypothetical protein PHAVU_006G100000g           57.8    7e-07   
ref|XP_009415663.1|  PREDICTED: uncharacterized protein LOC103996465  57.8    7e-07   
emb|CDY59819.1|  BnaA09g51660D                                        58.2    7e-07   
ref|XP_011005698.1|  PREDICTED: uncharacterized protein LOC105111908  57.8    7e-07   
ref|NP_001239656.1|  uncharacterized protein LOC100815367             57.8    7e-07   
gb|KJB46029.1|  hypothetical protein B456_007G344900                  57.8    7e-07   
ref|XP_002319062.1|  hypothetical protein POPTR_0013s03440g           57.8    7e-07   
ref|XP_006656706.1|  PREDICTED: uncharacterized protein LOC102719212  58.5    7e-07   
ref|XP_011080356.1|  PREDICTED: uncharacterized protein LOC105163627  57.8    7e-07   
emb|CDO97954.1|  unnamed protein product                              57.8    7e-07   
gb|EYU30508.1|  hypothetical protein MIMGU_mgv1a010362mg              57.8    8e-07   
ref|XP_002300838.1|  hypothetical protein POPTR_0002s05250g           57.4    8e-07   
ref|XP_008444827.1|  PREDICTED: uncharacterized protein LOC103488057  57.4    8e-07   
ref|XP_010532946.1|  PREDICTED: uncharacterized protein LOC104808831  57.4    8e-07   
ref|XP_008806297.1|  PREDICTED: uncharacterized protein LOC103719024  57.8    8e-07   
gb|ABK28164.1|  unknown                                               57.4    8e-07   
ref|NP_178505.1|  uncharacterized protein                             57.4    8e-07   
ref|XP_010912238.1|  PREDICTED: uncharacterized protein LOC105038210  57.4    8e-07   
gb|KJB10781.1|  hypothetical protein B456_001G224000                  57.4    8e-07   
ref|XP_006482363.1|  PREDICTED: uncharacterized protein LOC102616904  57.4    9e-07   
ref|XP_010466979.1|  PREDICTED: uncharacterized protein LOC104747105  57.4    9e-07   
ref|XP_007030623.1|  Uncharacterized protein TCM_026394               57.4    9e-07   
gb|KDO61039.1|  hypothetical protein CISIN_1g021584mg                 57.4    9e-07   
emb|CDP13671.1|  unnamed protein product                              57.4    9e-07   
emb|CDP13674.1|  unnamed protein product                              57.4    9e-07   
ref|XP_007146005.1|  hypothetical protein PHAVU_006G004800g           57.4    9e-07   
ref|XP_010488665.1|  PREDICTED: uncharacterized protein LOC104766470  57.4    9e-07   
ref|XP_004251021.1|  PREDICTED: uncharacterized protein LOC101249043  57.4    1e-06   
ref|XP_004135720.1|  PREDICTED: uncharacterized protein LOC101212848  57.4    1e-06   
ref|XP_006430292.1|  hypothetical protein CICLE_v10012276mg           57.4    1e-06   
ref|XP_011097721.1|  PREDICTED: uncharacterized protein LOC105176569  57.0    1e-06   
ref|XP_004502142.1|  PREDICTED: uncharacterized protein LOC101513281  57.4    1e-06   
ref|XP_010243783.1|  PREDICTED: uncharacterized protein LOC104587757  57.0    1e-06   
gb|KDO59224.1|  hypothetical protein CISIN_1g036500mg                 57.0    1e-06   
ref|XP_006452672.1|  hypothetical protein CICLE_v10010821mg           57.0    1e-06   
gb|KHN02254.1|  hypothetical protein glysoja_002278                   57.0    1e-06   
ref|XP_003554419.1|  PREDICTED: uncharacterized protein LOC100785438  57.0    1e-06   
ref|XP_006284280.1|  hypothetical protein CARUB_v10005449mg           57.0    1e-06   
ref|XP_002266988.1|  PREDICTED: uncharacterized protein LOC100249414  57.0    1e-06   
ref|XP_006347793.1|  PREDICTED: uncharacterized protein LOC102597851  57.0    1e-06   
ref|XP_004230118.1|  PREDICTED: uncharacterized protein LOC101268432  57.0    1e-06   
ref|NP_001142811.1|  uncharacterized protein LOC100275190             57.4    1e-06   
ref|XP_009367630.1|  PREDICTED: uncharacterized protein LOC103957228  57.0    1e-06   
gb|ACG26895.1|  hypothetical protein                                  57.0    1e-06   
ref|XP_008368838.1|  PREDICTED: uncharacterized protein LOC103432425  57.0    1e-06   
ref|XP_010654045.1|  PREDICTED: uncharacterized protein LOC100240...  57.0    1e-06   
emb|CDP21506.1|  unnamed protein product                              56.6    1e-06   
ref|XP_011072457.1|  PREDICTED: uncharacterized protein LOC105157708  57.0    1e-06   
ref|XP_010090262.1|  hypothetical protein L484_006168                 56.6    1e-06   
ref|NP_001136825.1|  uncharacterized protein LOC100216973             57.0    1e-06   
ref|XP_011092005.1|  PREDICTED: uncharacterized protein LOC105172319  56.6    1e-06   
ref|XP_010654044.1|  PREDICTED: uncharacterized protein LOC100240...  56.6    2e-06   
ref|XP_002307050.1|  hypothetical protein POPTR_0005s06920g           56.6    2e-06   
ref|XP_004506139.1|  PREDICTED: uncharacterized protein LOC101505580  56.6    2e-06   
ref|XP_010514327.1|  PREDICTED: uncharacterized protein LOC104790300  56.6    2e-06   
ref|XP_009390571.1|  PREDICTED: uncharacterized protein LOC103976931  56.6    2e-06   
ref|XP_009593148.1|  PREDICTED: uncharacterized protein LOC104089853  56.6    2e-06   
ref|XP_006857698.1|  hypothetical protein AMTR_s00061p00168530        56.2    2e-06   
ref|XP_008235300.1|  PREDICTED: uncharacterized protein LOC103334...  55.8    2e-06   
ref|XP_009370813.1|  PREDICTED: uncharacterized protein LOC103960122  56.2    2e-06   
ref|XP_003556459.1|  PREDICTED: uncharacterized protein LOC100802...  56.2    2e-06   
ref|XP_007199427.1|  hypothetical protein PRUPE_ppa026525mg           56.2    2e-06   
ref|XP_008235299.1|  PREDICTED: uncharacterized protein LOC103334...  56.2    2e-06   
ref|XP_011022881.1|  PREDICTED: uncharacterized protein LOC105124530  56.2    2e-06   
ref|XP_007144817.1|  hypothetical protein PHAVU_007G186400g           56.2    2e-06   
emb|CAN68722.1|  hypothetical protein VITISV_033681                   57.0    2e-06   
ref|XP_010496357.1|  PREDICTED: uncharacterized protein LOC104773443  56.2    2e-06   
ref|XP_010450329.1|  PREDICTED: uncharacterized protein LOC104732477  56.2    2e-06   
ref|XP_010435360.1|  PREDICTED: uncharacterized protein LOC104719196  56.2    2e-06   
ref|XP_011031123.1|  PREDICTED: uncharacterized protein LOC105130358  56.2    2e-06   
ref|XP_002310533.1|  hypothetical protein POPTR_0007s04630g           56.2    2e-06   
gb|KHN43207.1|  hypothetical protein glysoja_001790                   55.5    2e-06   
ref|XP_003554710.1|  PREDICTED: uncharacterized protein LOC100806479  55.8    3e-06   
ref|XP_008386487.1|  PREDICTED: uncharacterized protein LOC103448992  56.2    3e-06   
ref|XP_009333930.1|  PREDICTED: uncharacterized protein LOC103926780  56.2    3e-06   
gb|KJB51117.1|  hypothetical protein B456_008G201900                  55.8    3e-06   
gb|ADG39148.1|  AT5G28150-like protein                                53.9    3e-06   
ref|XP_009362927.1|  PREDICTED: uncharacterized protein LOC103952942  55.8    3e-06   
gb|AEN83173.1|  AT5G28150-like protein                                53.9    3e-06   
ref|XP_007037767.1|  Uncharacterized protein TCM_014486               55.8    3e-06   
ref|XP_004301015.1|  PREDICTED: uncharacterized protein LOC101312836  55.8    3e-06   
gb|KHN23821.1|  hypothetical protein glysoja_028114                   55.8    3e-06   
gb|KCW48363.1|  hypothetical protein EUGRSUZ_K02075                   55.8    3e-06   
ref|XP_010036729.1|  PREDICTED: uncharacterized protein LOC104425670  55.8    3e-06   
ref|XP_008360800.1|  PREDICTED: uncharacterized protein LOC103424495  55.8    3e-06   
ref|XP_009789133.1|  PREDICTED: uncharacterized protein LOC104236813  55.8    3e-06   
ref|XP_008239343.1|  PREDICTED: uncharacterized protein LOC103337946  55.8    3e-06   
ref|XP_007208899.1|  hypothetical protein PRUPE_ppa026898mg           55.8    3e-06   
ref|XP_002528592.1|  conserved hypothetical protein                   55.8    3e-06   
ref|XP_007150100.1|  hypothetical protein PHAVU_005G126700g           55.8    3e-06   
emb|CBI14939.3|  unnamed protein product                              55.8    3e-06   
ref|XP_003556772.1|  PREDICTED: uncharacterized protein LOC100806502  55.8    4e-06   
gb|KHN09942.1|  hypothetical protein glysoja_043621                   55.1    4e-06   
ref|XP_003591011.1|  hypothetical protein MTR_1g081260                55.8    4e-06   
gb|AFK40643.1|  unknown                                               55.5    4e-06   
gb|EPS70677.1|  hypothetical protein M569_04081                       55.5    4e-06   
gb|KDO45483.1|  hypothetical protein CISIN_1g021977mg                 55.5    4e-06   
ref|XP_006424321.1|  hypothetical protein CICLE_v10029846mg           55.5    4e-06   
ref|XP_010663087.1|  PREDICTED: uncharacterized protein LOC100243254  55.5    4e-06   
ref|XP_007020399.1|  Uncharacterized protein TCM_030574               55.5    4e-06   
ref|XP_011021264.1|  PREDICTED: uncharacterized protein LOC105123388  55.5    4e-06   
gb|AES61262.2|  plant/T24G3-80 protein                                55.5    4e-06   
ref|XP_004955779.1|  PREDICTED: uncharacterized protein LOC101785301  55.5    4e-06   
ref|XP_010678886.1|  PREDICTED: uncharacterized protein LOC104894363  55.5    4e-06   
ref|XP_006383434.1|  hypothetical protein POPTR_0005s15470g           55.5    4e-06   
ref|XP_008386989.1|  PREDICTED: uncharacterized protein LOC103449449  55.5    4e-06   
ref|XP_009365336.1|  PREDICTED: uncharacterized protein LOC103955180  55.5    4e-06   
ref|XP_009353177.1|  PREDICTED: uncharacterized protein LOC103944435  55.5    4e-06   
ref|XP_010256498.1|  PREDICTED: uncharacterized protein LOC104596873  55.1    5e-06   
ref|XP_007202844.1|  hypothetical protein PRUPE_ppa014641mg           55.5    5e-06   
gb|ADG39150.1|  AT5G28150-like protein                                53.5    5e-06   
gb|ADG39149.1|  AT5G28150-like protein                                53.5    5e-06   
ref|XP_009588422.1|  PREDICTED: uncharacterized protein LOC104085995  55.1    5e-06   
gb|EYU21422.1|  hypothetical protein MIMGU_mgv1a022950mg              55.5    5e-06   
gb|ADG39151.1|  AT5G28150-like protein                                53.5    5e-06   
ref|XP_008241288.1|  PREDICTED: uncharacterized protein LOC103339729  55.1    5e-06   
gb|EMT16711.1|  hypothetical protein F775_12417                       55.1    5e-06   
gb|EAY84891.1|  hypothetical protein OsI_06256                        55.1    5e-06   
ref|NP_001046211.1|  Os02g0198800                                     55.1    5e-06   
ref|XP_007027625.1|  Uncharacterized protein TCM_022452               55.1    5e-06   
gb|EMS50536.1|  hypothetical protein TRIUR3_22811                     55.1    5e-06   
ref|XP_003571347.2|  PREDICTED: uncharacterized protein LOC100832869  55.1    6e-06   
ref|XP_011458574.1|  PREDICTED: uncharacterized protein LOC101299...  55.1    6e-06   
ref|XP_002268230.1|  PREDICTED: uncharacterized protein LOC100255180  55.1    6e-06   
ref|XP_003551067.1|  PREDICTED: uncharacterized protein LOC100775403  55.1    6e-06   
ref|XP_009805050.1|  PREDICTED: uncharacterized protein LOC104250176  55.1    6e-06   
ref|XP_007138005.1|  hypothetical protein PHAVU_009G173000g           55.1    6e-06   
ref|XP_009777340.1|  PREDICTED: uncharacterized protein LOC104226933  55.1    6e-06   
ref|XP_009622577.1|  PREDICTED: uncharacterized protein LOC104113961  55.1    6e-06   
gb|KJB08092.1|  hypothetical protein B456_001G064200                  54.7    6e-06   
gb|KJB63087.1|  hypothetical protein B456_009G452200                  54.7    7e-06   
dbj|BAK07193.1|  predicted protein                                    54.7    7e-06   
ref|XP_004494145.1|  PREDICTED: uncharacterized protein LOC101498919  54.7    7e-06   
ref|XP_004290606.1|  PREDICTED: uncharacterized protein LOC101299...  54.7    7e-06   
ref|XP_008355221.1|  PREDICTED: uncharacterized protein LOC103418890  54.7    7e-06   
gb|KJB08091.1|  hypothetical protein B456_001G064200                  54.7    7e-06   
emb|CDP15369.1|  unnamed protein product                              54.7    7e-06   
ref|XP_010102967.1|  hypothetical protein L484_018986                 54.7    7e-06   
gb|ADG39153.1|  AT5G28150-like protein                                52.8    8e-06   
ref|XP_011015288.1|  PREDICTED: uncharacterized protein LOC105118926  54.3    8e-06   
ref|XP_008660687.1|  PREDICTED: uncharacterized protein LOC103639741  54.7    8e-06   
ref|XP_004515862.1|  PREDICTED: uncharacterized protein LOC101502004  54.7    8e-06   
ref|XP_002436603.1|  hypothetical protein SORBIDRAFT_10g005530        54.7    8e-06   
ref|XP_009385461.1|  PREDICTED: uncharacterized protein LOC103972819  54.7    8e-06   
ref|XP_004494682.1|  PREDICTED: uncharacterized protein LOC101496846  54.7    8e-06   
ref|XP_007142451.1|  hypothetical protein PHAVU_008G281700g           54.3    9e-06   
gb|EYU45840.1|  hypothetical protein MIMGU_mgv1a019714mg              54.7    9e-06   
ref|XP_004139571.1|  PREDICTED: uncharacterized protein LOC101206510  54.3    9e-06   
ref|XP_004166778.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    9e-06   
ref|XP_011462197.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    9e-06   
ref|XP_003549823.1|  PREDICTED: uncharacterized protein LOC100802...  54.3    9e-06   
gb|KHN10445.1|  hypothetical protein glysoja_030881                   54.3    9e-06   
ref|XP_007155488.1|  hypothetical protein PHAVU_003G205700g           54.3    9e-06   
gb|KEH31766.1|  protein phosphatase 2c, putative                      54.3    9e-06   
ref|XP_010107360.1|  hypothetical protein L484_006875                 54.3    1e-05   
ref|XP_003525519.1|  PREDICTED: uncharacterized protein LOC100779755  54.3    1e-05   
ref|XP_008391809.1|  PREDICTED: uncharacterized protein LOC103453997  54.3    1e-05   
ref|XP_006439940.1|  hypothetical protein CICLE_v10023489mg           54.3    1e-05   
ref|XP_006471404.1|  PREDICTED: uncharacterized protein LOC102616852  53.9    1e-05   
ref|XP_006349132.1|  PREDICTED: uncharacterized protein LOC102579967  54.3    1e-05   
ref|XP_008380651.1|  PREDICTED: uncharacterized protein LOC103443554  54.3    1e-05   
gb|AFW70716.1|  hypothetical protein ZEAMMB73_330752                  54.3    1e-05   
ref|XP_006579047.1|  PREDICTED: uncharacterized protein LOC100775282  53.9    1e-05   
ref|XP_004951552.1|  PREDICTED: uncharacterized protein LOC101772581  53.9    1e-05   
ref|XP_003574544.1|  PREDICTED: uncharacterized protein LOC100835247  53.9    1e-05   
ref|XP_002318087.2|  hypothetical protein POPTR_0012s09090g           53.9    1e-05   
ref|XP_004973544.1|  PREDICTED: uncharacterized protein LOC101780988  53.9    1e-05   
ref|XP_011040513.1|  PREDICTED: uncharacterized protein LOC105136753  53.9    2e-05   
gb|KHN43917.1|  hypothetical protein glysoja_025956                   53.5    2e-05   
ref|XP_009381564.1|  PREDICTED: uncharacterized protein LOC103969672  53.9    2e-05   
ref|XP_011046236.1|  PREDICTED: uncharacterized protein LOC105140891  53.9    2e-05   
ref|XP_003601156.1|  hypothetical protein MTR_3g076610                53.9    2e-05   
ref|XP_010039142.1|  PREDICTED: uncharacterized protein LOC104427810  53.5    2e-05   
ref|XP_006384659.1|  hypothetical protein POPTR_0004s19910g           53.5    2e-05   
ref|XP_010932250.1|  PREDICTED: uncharacterized protein LOC105052962  53.5    2e-05   
ref|XP_007030630.1|  Sulfate/thiosulfate import ATP-binding prote...  53.5    2e-05   
ref|XP_006645201.1|  PREDICTED: uncharacterized protein LOC102718506  53.5    2e-05   
ref|XP_009364857.1|  PREDICTED: uncharacterized protein LOC103954761  53.5    2e-05   
ref|XP_003601505.1|  hypothetical protein MTR_3g082430                53.5    2e-05   
ref|XP_002322201.2|  hypothetical protein POPTR_0015s09600g           53.9    2e-05   
ref|XP_006343140.1|  PREDICTED: uncharacterized protein LOC102583919  53.5    2e-05   
ref|XP_009390748.1|  PREDICTED: uncharacterized protein LOC103977065  53.5    2e-05   
ref|XP_008385435.1|  PREDICTED: uncharacterized protein LOC103447...  53.5    2e-05   
ref|XP_004235628.1|  PREDICTED: uncharacterized protein LOC101250288  53.5    2e-05   
ref|XP_008807465.1|  PREDICTED: uncharacterized protein LOC103719825  53.5    2e-05   
ref|XP_007162857.1|  hypothetical protein PHAVU_001G186900g           53.5    2e-05   
ref|XP_008385436.1|  PREDICTED: uncharacterized protein LOC103447...  53.1    2e-05   
ref|XP_004305363.1|  PREDICTED: uncharacterized protein LOC101294969  53.5    2e-05   
ref|XP_009763291.1|  PREDICTED: uncharacterized protein LOC104215233  53.1    2e-05   
gb|AFK39419.1|  unknown                                               53.5    2e-05   
emb|CDY30020.1|  BnaC01g39880D                                        53.1    2e-05   
ref|XP_006408140.1|  hypothetical protein EUTSA_v10021255mg           53.1    2e-05   
ref|XP_002300574.2|  hypothetical protein POPTR_0001s47170g           53.1    2e-05   
ref|XP_002451729.1|  hypothetical protein SORBIDRAFT_04g006760        53.1    3e-05   
ref|XP_004501866.1|  PREDICTED: uncharacterized protein LOC101507...  53.1    3e-05   
ref|XP_010682310.1|  PREDICTED: uncharacterized protein LOC104897184  53.5    3e-05   
ref|XP_009124203.1|  PREDICTED: uncharacterized protein LOC103849150  53.1    3e-05   
ref|XP_009379778.1|  PREDICTED: uncharacterized protein LOC103968343  53.1    3e-05   
ref|XP_002458958.1|  hypothetical protein SORBIDRAFT_03g043380        53.1    3e-05   
gb|EMS46054.1|  hypothetical protein TRIUR3_18113                     52.8    3e-05   
gb|KDP42681.1|  hypothetical protein JCGZ_23621                       53.1    3e-05   
ref|XP_002444411.1|  hypothetical protein SORBIDRAFT_07g021540        53.1    3e-05   
gb|ADG39147.1|  AT5G28150-like protein                                51.2    3e-05   
ref|XP_003564890.1|  PREDICTED: uncharacterized protein LOC100831420  53.1    3e-05   
ref|XP_009124977.1|  PREDICTED: uncharacterized protein LOC103850026  52.8    3e-05   
emb|CDY21108.1|  BnaA01g33390D                                        52.8    3e-05   
ref|XP_004236272.1|  PREDICTED: uncharacterized protein LOC101245536  53.1    3e-05   
ref|XP_006344483.1|  PREDICTED: uncharacterized protein LOC102586788  53.1    3e-05   
emb|CDY50761.1|  BnaAnng10680D                                        52.8    3e-05   
ref|XP_011071966.1|  PREDICTED: uncharacterized protein LOC105157288  52.8    3e-05   
ref|XP_010929912.1|  PREDICTED: uncharacterized protein LOC105051269  52.8    3e-05   
ref|XP_010093199.1|  hypothetical protein L484_008981                 52.8    3e-05   
gb|KEH38957.1|  DUF868 family protein                                 52.8    3e-05   
emb|CDP06975.1|  unnamed protein product                              52.8    3e-05   
gb|EMS52810.1|  hypothetical protein TRIUR3_01241                     49.7    4e-05   
ref|XP_003560999.1|  PREDICTED: uncharacterized protein LOC100825676  52.8    4e-05   
ref|XP_009627559.1|  PREDICTED: uncharacterized protein LOC104118085  52.8    4e-05   
ref|XP_002987520.1|  hypothetical protein SELMODRAFT_126257           52.8    4e-05   
ref|XP_011044542.1|  PREDICTED: uncharacterized protein LOC105139691  52.8    4e-05   
ref|XP_002312897.2|  hypothetical protein POPTR_0009s15050g           52.8    4e-05   



>ref|XP_009776174.1| PREDICTED: uncharacterized protein LOC104225989 [Nicotiana sylvestris]
Length=386

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 102/142 (72%), Gaps = 7/142 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            +K+VLQIKHLKWKFRGNERIEV+G P+ VSWDV++WLFDDDEDGYALF FKFEK S    
Sbjct  247  NKRVLQIKHLKWKFRGNERIEVDGVPVLVSWDVYNWLFDDDEDGYALFMFKFEKSSYEYV  306

Query  381  gggggfrgk-----mvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWE  217
                              CG GFET +MKKG+     S SSSS S +SASS+C+SVMEW 
Sbjct  307  ATDDSNFNNGVQLWSQQSCGFGFETKMMKKGV--LRSSRSSSSSSLSSASSTCSSVMEWA  364

Query  216  SAEENELKDPPGFSLLVYAWKS  151
            S EENELK P GFSLLVYAWKS
Sbjct  365  STEENELKGPSGFSLLVYAWKS  386



>ref|XP_009619129.1| PREDICTED: uncharacterized protein LOC104111192 [Nicotiana tomentosiformis]
Length=383

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 102/142 (72%), Gaps = 7/142 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            +K+VLQIKHLKWKFRGNERIEV+G P+ VSWDV++WLFDDDEDGYALF FKFEK S    
Sbjct  244  NKRVLQIKHLKWKFRGNERIEVDGVPVLVSWDVYNWLFDDDEDGYALFMFKFEKSSYEYV  303

Query  381  gggggfrgk-----mvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWE  217
                              CG GFET +MKKG+     S SSSS S +SASS+C+SVMEW 
Sbjct  304  AADDYSLNNGVQLWSQQSCGFGFETKMMKKGV--LRSSRSSSSSSLSSASSTCSSVMEWA  361

Query  216  SAEENELKDPPGFSLLVYAWKS  151
            S EENELK P GFSLLVYAWKS
Sbjct  362  STEENELKGPSGFSLLVYAWKS  383



>ref|XP_006366515.1| PREDICTED: uncharacterized protein LOC102585370 [Solanum tuberosum]
Length=349

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            +K+VLQIKHLKWKFRGNERIEV+G  + VSWDV++WLFDDDEDGYALF FKFEK S+  D
Sbjct  218  NKRVLQIKHLKWKFRGNERIEVDGVGVVVSWDVYNWLFDDDEDGYALFMFKFEKSSL--D  275

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                G        CG GFET +MKKG+    RSSSSSS  S+++SS  +SVMEW S EEN
Sbjct  276  ELNNGVEMWSQQSCGFGFETKMMKKGV---LRSSSSSSSLSSASSSCSSSVMEWASTEEN  332

Query  201  ELKDPPGFSLLVYAWKS  151
            ELKDP GFSLLVYAWK+
Sbjct  333  ELKDPSGFSLLVYAWKT  349



>ref|XP_004244888.1| PREDICTED: uncharacterized protein LOC101262938 [Solanum lycopersicum]
Length=339

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            +K+VLQIKHL+WKFRGNERIEV+G  + VSWDV++WLFDDDEDGYAL+ FKFEK S+  D
Sbjct  207  NKRVLQIKHLRWKFRGNERIEVDGVGVAVSWDVYNWLFDDDEDGYALYMFKFEKSSL--D  264

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                         CG GFET +MKKG+     SSSSSS  S+++SS  +SVMEW S EEN
Sbjct  265  EEQFNNSMWSQQSCGFGFETKMMKKGV--LRSSSSSSSSLSSASSSCSSSVMEWASTEEN  322

Query  201  ELKDPPGFSLLVYAWKS  151
            E+KDP GFSLLVYAWK+
Sbjct  323  EMKDPTGFSLLVYAWKT  339



>ref|XP_010665861.1| PREDICTED: uncharacterized protein LOC104883105 [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 14/149 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD----EDGYALFTFKFEKQ-  397
             K+VLQ+KHLKWKFRG+ERIEV+G+PIQ+SWDV++WLFD D    +DGYALFTF+FEKQ 
Sbjct  238  SKRVLQVKHLKWKFRGSERIEVDGYPIQLSWDVYNWLFDQDCGSHDDGYALFTFRFEKQG  297

Query  396  -------SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssc  238
                   ++  +           + CGL +E   MKK      ++SSSS+ S +S SS  
Sbjct  298  NEVFSDDNINNNVVSKREVIWSQDSCGLNYERKKMKK--KLLVKTSSSSNSSISSVSSGS  355

Query  237  tSVMEWESAEENELKDPPGFSLLVYAWKS  151
            +SV+EWES EENELK P GFSLLVYAWK+
Sbjct  356  SSVLEWESVEENELKGPTGFSLLVYAWKN  384



>ref|XP_002285361.1| PREDICTED: uncharacterized protein LOC100262872 [Vitis vinifera]
Length=371

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 97/145 (67%), Gaps = 10/145 (7%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK------Q  397
            K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+       
Sbjct  228  KRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFERVGFEEED  287

Query  396  SVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrsssssslsstsasssctSVM  226
               +           +  CG G    E   MKK LL+++RSSSSSSLSS S+  S + VM
Sbjct  288  EELQQQQQHLNEKNGMALCGFGMNGIERKKMKKSLLKTTRSSSSSSLSSASSGCSSS-VM  346

Query  225  EWESAEENELKDPPGFSLLVYAWKS  151
            EW S EE ELK P GFSLLVYAWKS
Sbjct  347  EWASTEEMELKSPSGFSLLVYAWKS  371



>emb|CAN69699.1| hypothetical protein VITISV_001515 [Vitis vinifera]
Length=372

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 94/146 (64%), Gaps = 11/146 (8%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK-------  400
            K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+       
Sbjct  228  KRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFERVGFEEED  287

Query  399  QSVgedgggggfrgkmvnGCGL---GFETMLMKKGLlrssrsssssslsstsasssctSV  229
            + + +           +  CG    G E   MKK L   +  SSSSS  S+++S   +SV
Sbjct  288  EELQQQQQQHLNEKNGMALCGFGMNGIERKKMKKSL-LKTTRSSSSSSLSSASSGCSSSV  346

Query  228  MEWESAEENELKDPPGFSLLVYAWKS  151
            MEW S EE +LK P GFSLLVYAWKS
Sbjct  347  MEWASTEEMDLKSPSGFSLLVYAWKS  372



>ref|XP_007011756.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
 gb|EOY29375.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
Length=384

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 91/156 (58%), Gaps = 20/156 (13%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEKQS---  394
            +K+VLQIK LKWKFRGNERIEV+G  IQVSWDV++WLFD D  +G+A+F FKFE +    
Sbjct  228  NKRVLQIKRLKWKFRGNERIEVDGVSIQVSWDVYNWLFDQDLNNGHAVFVFKFENEGSEI  287

Query  393  ------------VgedgggggfrgkmvnGCGL---GFETMLMKKG-Llrssrssssssls  262
                        V              N C L   G E   M+K  L  +  SSSSS   
Sbjct  288  LEEEHQQADAEVVSPFNEKNEVVLWQQNSCSLPLNGIEWKKMRKSLLRTARSSSSSSISM  347

Query  261  stsasssctSVMEWESAEENELKDPPGFSLLVYAWK  154
            S+++S   +SVMEW S EE EL  P GFSLLVYAWK
Sbjct  348  SSASSGGSSSVMEWASVEETELSAPTGFSLLVYAWK  383



>gb|KDP33539.1| hypothetical protein JCGZ_07110 [Jatropha curcas]
Length=384

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 19/155 (12%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            ++KVLQIK LKWKFRGNE+IEV+G P QVSWDV++WLF+D  +G+A+F F+FE Q + + 
Sbjct  229  NQKVLQIKRLKWKFRGNEKIEVDGVPTQVSWDVYNWLFEDVNNGHAVFMFRFETQDIEDA  288

Query  381  gggggfrgkmvnGCG------------------LGFETMLMKKGLlrss-rsssssslss  259
            G            C                    G E   M+  +  +   SSSS S+SS
Sbjct  289  GEEEEEGRGGTEVCNGQDEKNGVVPWQHSNLGMSGIEWRKMRSLMRTTRSSSSSSISMSS  348

Query  258  tsasssctSVMEWESAEENELKDPPGFSLLVYAWK  154
             S++   +S+MEW S EENEL  P GFSLLVYAW+
Sbjct  349  ASSAGGSSSIMEWASTEENELSSPNGFSLLVYAWR  383



>gb|KJB55057.1| hypothetical protein B456_009G060700 [Gossypium raimondii]
Length=386

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 93/157 (59%), Gaps = 21/157 (13%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEKQS---  394
            + +VLQIK LKWKFRGNERIEV+G  IQVSWDV++WLFD D ++G+A+F FKFE +    
Sbjct  229  NNRVLQIKRLKWKFRGNERIEVDGVSIQVSWDVYNWLFDQDLDNGHAVFMFKFENEGSEI  288

Query  393  -------------VgedgggggfrgkmvnGCGLGFETM----LMKKGLlrssrssssssl  265
                         VG      G      + C  G   +    + K  L  +  SSSSS  
Sbjct  289  LEGDYQQDGVEEVVGPFNEKNGVVLWQQSSCNFGVNGIEWKKMRKSFLRTARSSSSSSIS  348

Query  264  sstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  154
             S+++S+  +SVMEW S EE+EL  P GFSLLVYAWK
Sbjct  349  MSSASSAGSSSVMEWASVEESELSAPTGFSLLVYAWK  385



>gb|KJB07669.1| hypothetical protein B456_001G036600 [Gossypium raimondii]
Length=362

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 6/139 (4%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEK-QSVg  388
            +++VLQIK LKWKFRGNERIEV+G  +QVSWDV++WLFD +  +G+A+F FKFE  ++V 
Sbjct  226  NQRVLQIKRLKWKFRGNERIEVDGVSVQVSWDVYNWLFDQELNNGHAVFMFKFENDEAVS  285

Query  387  edgggggfrgkmvnGCGLGFETMLMKKGL-lrssrsssssslsstsasssctSVMEWESA  211
                  G      +   +G +   M+K + + +  SSSSS  +S+++S   +SV+EW S 
Sbjct  286  PLKEKEGIFLCQQSSPSIGEK---MRKSMWMTARSSSSSSISTSSASSGGSSSVLEWASV  342

Query  210  EENELKDPPGFSLLVYAWK  154
            EE+EL  P GFSLLVYAWK
Sbjct  343  EESELSAPTGFSLLVYAWK  361



>ref|XP_010033684.1| PREDICTED: uncharacterized protein LOC104422917 [Eucalyptus grandis]
 gb|KCW53394.1| hypothetical protein EUGRSUZ_J02625 [Eucalyptus grandis]
Length=382

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 16/151 (11%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK-------  400
            ++VLQ+K LKWKFRGNER+EV+G   QVSWDV++WLF+D +D +A+F F+FEK       
Sbjct  231  RRVLQVKRLKWKFRGNERVEVDGVNFQVSWDVYNWLFEDAKDSHAVFMFRFEKLINNDEE  290

Query  399  -----QSVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrsssssslsstsass  244
                                    C  G    E   M+K  LRS+RSSSSSS+SS+++S 
Sbjct  291  RKKGGGGDDGVQAVSNLLLWSQPSCSFGMNEIELRKMRKSKLRSARSSSSSSISSSASSG  350

Query  243  sctSVMEWESAEENELKDP-PGFSLLVYAWK  154
              +S+MEW SAEENEL  P  GFSLLVYAWK
Sbjct  351  GSSSIMEWASAEENELSGPFVGFSLLVYAWK  381



>ref|XP_010048907.1| PREDICTED: uncharacterized protein LOC104437620 [Eucalyptus grandis]
 gb|KCW81330.1| hypothetical protein EUGRSUZ_C02717 [Eucalyptus grandis]
Length=382

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 93/151 (62%), Gaps = 16/151 (11%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK-------  400
            ++VLQ+K LKWKFRGNER+EV+G   QVSWDV++WLF+D  D +A+F F+FEK       
Sbjct  231  RRVLQVKRLKWKFRGNERVEVDGVNFQVSWDVYNWLFEDASDSHAVFMFRFEKLINNDEE  290

Query  399  -----QSVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrsssssslsstsass  244
                                    C  G    E   M+K  LRS+RSSSSSS+SS+++S 
Sbjct  291  RKKGGGGDDGVQAVSNLLLWSQPSCSFGMNEIELRKMRKSKLRSARSSSSSSISSSASSG  350

Query  243  sctSVMEWESAEENELKDP-PGFSLLVYAWK  154
              +S+MEW SAEENEL  P  GFSLLVYAWK
Sbjct  351  GSSSIMEWASAEENELSGPFVGFSLLVYAWK  381



>ref|XP_003603315.1| hypothetical protein MTR_3g106250 [Medicago truncatula]
 gb|AES73566.1| DUF868 family protein [Medicago truncatula]
Length=346

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFEKQSVged  382
            +KVLQIK LKWKFRGNER+E++G P+Q+SWDV++WLF  D+ DG+A+F FKFE++   E 
Sbjct  210  QKVLQIKRLKWKFRGNERVEIDGVPVQISWDVYNWLFVKDNSDGHAIFMFKFEEEDEDEQ  269

Query  381  gg-gggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                      ++    L      + K + +S  SSS S  SS  +  + +SV+EW S EE
Sbjct  270  QRGKEKSLTNLLAQQNLNLGVYELGK-MGKSWSSSSVSMASSGGSFGASSSVLEWSSVEE  328

Query  204  NELKDPPGFSLLVYAWK  154
            NEL  P GFSLLVYAWK
Sbjct  329  NELVVPVGFSLLVYAWK  345



>ref|XP_006450316.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 ref|XP_006483448.1| PREDICTED: uncharacterized protein LOC102620001 [Citrus sinensis]
 gb|ESR63556.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 gb|KDO67512.1| hypothetical protein CISIN_1g016824mg [Citrus sinensis]
Length=382

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 95/146 (65%), Gaps = 13/146 (9%)
 Frame = -3

Query  555  KVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD------DEDGYALFTFKFEKQS  394
            +VLQIK LKWKFRGNERI+V+G P+Q+SWDV++WLFDD      D +G+A+F F+FE  +
Sbjct  237  RVLQIKRLKWKFRGNERIDVDGVPVQISWDVYNWLFDDFKSNKNDGNGHAVFMFRFE-DT  295

Query  393  VgedgggggfrgkmvnGCG----LGFETMLMKKGLlrssr-sssssslsstsasssctSV  229
            V  +           + C      G E   M+K L+R++R SSSSS   S+S+S   +SV
Sbjct  296  VDNEEEQEPMWQLQQSSCSNFGMSGIEWRKMRKSLMRTARSSSSSSISMSSSSSGCSSSV  355

Query  228  MEWESAEENELKD-PPGFSLLVYAWK  154
            MEW S EE+EL   P GFSLLVY WK
Sbjct  356  MEWASMEESELSPGPNGFSLLVYIWK  381



>ref|XP_004501367.1| PREDICTED: uncharacterized protein LOC101507611 [Cicer arietinum]
Length=347

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 2/137 (1%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFEK-QSVge  385
            KKVL IK LKWKFRGNER+E++G P+Q+SWDV++WLF  D+ DG+A+F FKFE+ ++  E
Sbjct  210  KKVLVIKRLKWKFRGNERVEIDGVPVQISWDVYNWLFVKDNNDGHAIFMFKFEEDENNEE  269

Query  384  dgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                      +     L    +     + +S  SSS S  SS  +  + +SV+EW S EE
Sbjct  270  QIVRERSLMNLWTQQNLNNLGVYELGKIGKSWSSSSVSMASSGGSFGASSSVLEWSSVEE  329

Query  204  NELKDPPGFSLLVYAWK  154
            NEL  P GFSLLVYAWK
Sbjct  330  NELVVPIGFSLLVYAWK  346



>ref|XP_008220875.1| PREDICTED: uncharacterized protein LOC103320911 [Prunus mume]
Length=342

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFEK-QSVge  385
            ++VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE+ + + +
Sbjct  208  QRVLQIKRLKWKFRGNERIEVDGAPLQISWDVYNWLFESDSDDGHAVFMFRFEEDEEINK  267

Query  384  dgggggfrgkmvnGCGL-GFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
            +              G+ G E   M K     S SSSS S+SS  +S   +SVMEW S E
Sbjct  268  ESNNCQMGHLNSWNFGMNGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSVMEWASME  322

Query  207  ENELK-DPPGFSLLVYAWK  154
            E+EL   P GFSLLVYAWK
Sbjct  323  ESELSGGPTGFSLLVYAWK  341



>ref|XP_008378697.1| PREDICTED: uncharacterized protein LOC103441769 [Malus domestica]
Length=344

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 88/137 (64%), Gaps = 9/137 (7%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFKFEKQSVged  382
            VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D   +DG+A+F F+FE+    ++
Sbjct  212  VLQIKRLKWKFRGNERIEVDGTPLQISWDVYNWLFESDGCRDDGHAVFMFRFEEDEEIKE  271

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                       N    G E   M K     S SSSS S+SS  +S   +SVMEW S EE+
Sbjct  272  NNYQLGHLNSWNFGMSGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSVMEWASTEES  326

Query  201  ELK-DPPGFSLLVYAWK  154
            EL   P GFSLLVYAWK
Sbjct  327  ELSGGPAGFSLLVYAWK  343



>ref|XP_009363946.1| PREDICTED: uncharacterized protein LOC103953867 [Pyrus x bretschneideri]
Length=343

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 87/137 (64%), Gaps = 9/137 (7%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFKFEKQSVged  382
            VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D   +DG+A+F F+FE+    ++
Sbjct  211  VLQIKRLKWKFRGNERIEVDGTPLQISWDVYNWLFESDGGGDDGHAVFMFRFEEDGEIKE  270

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                       N    G E   M K     S SSSS S+SS  +S   +SVMEW S EE+
Sbjct  271  NNYQLGHLNSWNFGMSGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSVMEWASTEES  325

Query  201  ELK-DPPGFSLLVYAWK  154
            EL   P GFSL VYAWK
Sbjct  326  ELSGGPAGFSLFVYAWK  342



>gb|KJB65893.1| hypothetical protein B456_010G117700 [Gossypium raimondii]
Length=357

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 87/142 (61%), Gaps = 5/142 (4%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDG--YALFTFKFEKQSVg  388
            +K+VLQIK LKWKFRGNERIEV+G  I VSWDV+SWL D D +    A+F FKFE Q   
Sbjct  216  NKRVLQIKRLKWKFRGNERIEVDGVWIGVSWDVYSWLSDKDGNNGRPAVFIFKFENQGTE  275

Query  387  edggg--ggfrgkmvnGCGLGFE-TMLMKKGLlrssrsssssslsstsasssctSVMEWE  217
                    G      + C  G E     +  L  +  SSSSS   S+++S   +SVMEWE
Sbjct  276  TMEDPFKEGVVLGQQSPCSDGIEWKKKRRSLLRSARSSSSSSISMSSASSGCSSSVMEWE  335

Query  216  SAEENELKDPPGFSLLVYAWKS  151
            S EE+EL  P GFSLLVYAW++
Sbjct  336  SVEESELCAPMGFSLLVYAWRN  357



>ref|XP_010245551.1| PREDICTED: uncharacterized protein LOC104589062 [Nelumbo nucifera]
Length=369

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 95/155 (61%), Gaps = 20/155 (13%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEKQSVged  382
            K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLF+   EDG+A+F FKFEK   GE+
Sbjct  216  KRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFEGGVEDGHAVFMFKFEKTEFGEE  275

Query  381  ggggg--------------frgkmvnGCGLGFETM---LMKKGLlrssrsssssslssts  253
                                  +     G+G  T     + +G    +  SSSSS  S++
Sbjct  276  EEENVQEELNEKTGRMVVWKPQQSPTSGGIGMNTFEWKRINRGF-LKTTRSSSSSSMSSA  334

Query  252  asssctSVMEWESA-EENELKDPPGFSLLVYAWKS  151
            +S   +SVMEW S+ +E+EL+ P GF LLVYAW++
Sbjct  335  SSGCSSSVMEWASSMDESELQSPSGFCLLVYAWRN  369



>ref|XP_007224916.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
 gb|EMJ26115.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
Length=431

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 17/143 (12%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFEKQSVged  382
            ++VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE++     
Sbjct  297  QRVLQIKRLKWKFRGNERIEVDGAPLQISWDVYNWLFESDSDDGHAVFMFRFEEEEE---  353

Query  381  gggggfrgkmvnGCGLG------FETMLMKKGLlrssrsssssslsstsasssctSVMEW  220
                    K  N C LG      F    ++   +  S SSSS S+SS  +S   +SVMEW
Sbjct  354  ------INKESNNCQLGHLNSWNFGMNGIEWRKMGKSLSSSSVSMSSAGSSGGSSSVMEW  407

Query  219  ESAEENELK-DPPGFSLLVYAWK  154
             S EE+EL   P GFSLLVYAWK
Sbjct  408  ASMEESELSGGPTGFSLLVYAWK  430



>ref|XP_004291941.1| PREDICTED: uncharacterized protein LOC101293553 [Fragaria vesca 
subsp. vesca]
Length=352

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEKQSVge  385
            +K+VLQIK LKWKFRGNERIEV+G P+ +SWDV++WLF++D  DG+A+F F+FE+     
Sbjct  217  NKRVLQIKRLKWKFRGNERIEVDGVPMHISWDVYNWLFENDGNDGHAVFMFRFEEDEQDI  276

Query  384  dgggggfr-gkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
            +         +       G   +  +K      +S SSSS+S +SA S  +SVMEW + E
Sbjct  277  NTQLSVGHWAQQQQFWNFGMNGIEWRK----MGKSFSSSSVSMSSAGSCSSSVMEWATME  332

Query  207  ENELK-DPPGFSLLVYAWK  154
            E+E+   P GFSLLVYAW+
Sbjct  333  ESEVSAGPTGFSLLVYAWR  351



>ref|XP_008377675.1| PREDICTED: uncharacterized protein LOC103440754 [Malus domestica]
Length=346

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 87/135 (64%), Gaps = 7/135 (5%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFEKQSVgedgg  376
            VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE+    ++  
Sbjct  216  VLQIKRLKWKFRGNERIEVDGTPVQISWDVYNWLFESDGDDGHAVFMFRFEEXEEIKENN  275

Query  375  gggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEENEL  196
                     N    G E   M K     S SSSS S+SS  +S   +SVMEW S EE+EL
Sbjct  276  YQXGHLNSWNFGMSGIEWRKMGK-----SFSSSSVSMSSAGSSGGSSSVMEWASTEESEL  330

Query  195  K-DPPGFSLLVYAWK  154
               P GFSL +YAWK
Sbjct  331  NGGPAGFSLQIYAWK  345



>ref|XP_006382097.1| hypothetical protein POPTR_0006s27720g [Populus trichocarpa]
 gb|ERP59894.1| hypothetical protein POPTR_0006s27720g [Populus trichocarpa]
Length=246

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQ  397
            +K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD    +A+F F+FE  
Sbjct  71   NKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDINTDHAVFMFRFESN  125



>emb|CBI21089.3| unnamed protein product [Vitis vinifera]
Length=291

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  400
            K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+
Sbjct  188  KRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFER  240



>ref|XP_007136970.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
 gb|ESW08964.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
Length=319

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 79/136 (58%), Gaps = 14/136 (10%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFEKQSVged  382
            +KVLQIK LKWKFRGNER+ V+G  +Q+SWD+++W FD ++ D +A+F FKFE++     
Sbjct  196  EKVLQIKRLKWKFRGNERVVVDGVHVQISWDLYNWFFDKNNADAHAIFMFKFEEEEEEAV  255

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                      +  C  G                SSSS  SS  +    +SV+EW S EEN
Sbjct  256  ADRNLAGLWNLGVCEWG-------------KTWSSSSVSSSGGSFGGSSSVLEWSSVEEN  302

Query  201  ELKDPPGFSLLVYAWK  154
            EL  P GFSLLVYAWK
Sbjct  303  ELVVPVGFSLLVYAWK  318



>ref|XP_004138846.1| PREDICTED: uncharacterized protein LOC101205493 [Cucumis sativus]
Length=300

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEKQSVge  385
            D KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F++     
Sbjct  167  DVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFDEDD---  223

Query  384  dgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                           G+   ++      +R S SSSS S+SS  +S+  +SV++W + EE
Sbjct  224  --EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLDWTTVEE  281

Query  204  NEL-KDPPGFSLLVYAWK  154
            +EL   P  FSLLVYAWK
Sbjct  282  SELGGGPSTFSLLVYAWK  299



>ref|XP_004160786.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230499 
[Cucumis sativus]
Length=300

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEKQSVge  385
            D KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F++     
Sbjct  167  DVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFDEDD---  223

Query  384  dgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                           G+   ++      +R S SSSS S+SS  +S+  +SV++W + EE
Sbjct  224  --EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLDWTTVEE  281

Query  204  NEL-KDPPGFSLLVYAWK  154
            +EL   P  FSLLVYAWK
Sbjct  282  SELGGGPSTFSLLVYAWK  299



>ref|XP_011039597.1| PREDICTED: uncharacterized protein LOC105136101 [Populus euphratica]
Length=402

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQ  397
            +K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD    +A+F F+FE  
Sbjct  228  NKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDIHTDHAVFMFRFESN  282



>ref|XP_002515453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46902.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSV  391
            +K+VL IK LKWKFRGNE+IEV+G PIQVSWDV++WLF+D  +G+A+F F+FE   +
Sbjct  181  NKRVLHIKQLKWKFRGNEKIEVDGVPIQVSWDVYNWLFEDINNGHAVFMFRFESTDI  237



>gb|KGN62983.1| hypothetical protein Csa_2G382560 [Cucumis sativus]
Length=328

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEKQSVge  385
            D KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F++     
Sbjct  195  DVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFDEDD---  251

Query  384  dgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                           G+   ++      +R S SSSS S+SS  +S+  +SV++W + EE
Sbjct  252  --EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLDWTTVEE  309

Query  204  NEL-KDPPGFSLLVYAWK  154
            +EL   P  FSLLVYAWK
Sbjct  310  SELGGGPSTFSLLVYAWK  327



>ref|XP_011036648.1| PREDICTED: uncharacterized protein LOC105134078 [Populus euphratica]
Length=407

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQ  397
            +++VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD  + +A+F F+FE  
Sbjct  233  NERVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDINNDHAVFMFRFESN  287



>ref|XP_008445586.1| PREDICTED: uncharacterized protein LOC103488566 [Cucumis melo]
Length=328

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEKQSVge  385
            D KVL+IKHLKWKFRGNE+++VEG P+Q+SWD+++W+F D++D G+A+F F+F++     
Sbjct  195  DVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDIYNWVFGDEKDHGHAIFMFRFDEDD---  251

Query  384  dgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEE  205
                           G+   ++      +R S SSSS S+SS  +S+  +SV++W + EE
Sbjct  252  --EELRTETPSFPRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLDWATVEE  309

Query  204  NEL-KDPPGFSLLVYAWK  154
            +EL   P  FSLLVYAWK
Sbjct  310  SELGGGPSTFSLLVYAWK  327



>emb|CDP18790.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 91/159 (57%), Gaps = 39/159 (25%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGF--PIQVSWDVHSWLFDDDED-----GYALFTFKFEK  400
            ++VLQ+KHLKWKFRGNER+E +    P+QVSWDV++WLF  D+D      +ALF FKFEK
Sbjct  234  QRVLQVKHLKWKFRGNERVEGDDGIPPVQVSWDVYNWLFVQDDDHELTNAHALFMFKFEK  293

Query  399  QSVgedgggggfrgkmvnGCG----LGFETMLMKKG------------Llrssrssssss  268
            +                  CG    +GFET   KK             +      SSSS 
Sbjct  294  KP---------------GDCGGLNLIGFETKKKKKKTTTTMMMKKGFKMRSGRSWSSSSL  338

Query  267  lsstsasssctSVMEWESAEENELKDPP-GFSLLVYAWK  154
             S +S+S+S +SVMEW S EENELK  P GFSL+VYAW 
Sbjct  339  SSVSSSSNSTSSVMEWASVEENELKGGPCGFSLVVYAWN  377



>ref|XP_007161151.1| hypothetical protein PHAVU_001G046800g [Phaseolus vulgaris]
 gb|ESW33145.1| hypothetical protein PHAVU_001G046800g [Phaseolus vulgaris]
Length=334

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 88/162 (54%), Gaps = 43/162 (27%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-----------------  433
            ++KVL++  LKWKFRG+ER+EV+G  +Q+SWDVH WLF+ D+D                 
Sbjct  189  EEKVLEVTRLKWKFRGSERVEVDGAHVQISWDVHDWLFEKDKDHGFSNISNDVNGNSDGG  248

Query  432  ---GYALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLM------KKGLlrssrss  280
               G+A+F FKFE   V               GCG G E  ++      K G  +S  SS
Sbjct  249  KNEGHAVFMFKFENDEV---------------GCGSGKEVDVVWSSGEWKNG--KSWSSS  291

Query  279  sssslsstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  154
            S S  SS  +    +SVMEW S EENEL  P GFSL+VYAW+
Sbjct  292  SLSVSSSVGSFGGSSSVMEWSSLEENELVVPFGFSLVVYAWR  333



>ref|XP_002324318.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
 gb|EEF02883.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
Length=401

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQ  397
            +K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFD   + +A+F F+FE  
Sbjct  227  NKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDGINNDHAVFMFRFESN  281



>ref|XP_003549308.1| PREDICTED: putative uncharacterized protein DDB_G0282499-like 
[Glycine max]
 gb|KHN22514.1| hypothetical protein glysoja_036218 [Glycine soja]
Length=340

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 86/153 (56%), Gaps = 24/153 (16%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED------------------  433
            +KVL++  LKWKFRG+ER+E++G  +Q+SWDVH WLF+ D+D                  
Sbjct  193  EKVLEVARLKWKFRGSERVEIDGVHVQISWDVHDWLFEKDKDIVNHRSSNNNNSNNNGIE  252

Query  432  GYALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts  253
            G+A+F FKFE+  V   GGG     +   G G  +      +     S SS S S +S  
Sbjct  253  GHAVFMFKFEEDEVRGSGGGKEEEQQWSMGSGGEW------RNGKSWSSSSLSVSSTSGG  306

Query  252  asssctSVMEWESAEENELKDPPGFSLLVYAWK  154
            +    +SVMEW S EENEL  P GFSL+VYAW+
Sbjct  307  SFGGSSSVMEWSSVEENELVVPLGFSLVVYAWR  339



>ref|XP_003545439.1| PREDICTED: putative uncharacterized protein DDB_G0282499-like 
[Glycine max]
Length=342

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 87/151 (58%), Gaps = 24/151 (16%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED----------------GY  427
            +KVL++  LKWKFRG+ER+E++G  +Q+SWDVH WLF+ D+D                G+
Sbjct  199  EKVLEVTRLKWKFRGSERVEIDGVHVQISWDVHDWLFEKDKDNNHCSTNNNNNNNGNEGH  258

Query  426  ALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsas  247
            A+F FKFE+  V    GGGG   +     G G E    K        SSS S  SS  + 
Sbjct  259  AVFVFKFEEDEV---RGGGGKEEEQQWSLGSGGEWRNGKS-----WSSSSLSVSSSVGSF  310

Query  246  ssctSVMEWESAEENELKDPPGFSLLVYAWK  154
               +SVMEW SAEENEL  P GFSL+VYAW+
Sbjct  311  GGSSSVMEWSSAEENELVVPLGFSLVVYAWR  341



>gb|KEH39864.1| DUF868 family protein [Medicago truncatula]
Length=328

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 23/138 (17%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD---DEDGYALFTFKFEKQSVg  388
            ++VL+++ LKWKFRGNER+E++G  + + WDVH WLF++   D DG+A+F FKFE+  V 
Sbjct  208  ERVLEVRKLKWKFRGNERVEIDGVSVLICWDVHDWLFENGGSDGDGHAVFMFKFEENEV-  266

Query  387  edgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
                           CG        +         SSSS   S+++     SV EW S E
Sbjct  267  ------------GGCCG-------ERSEFGSCKSWSSSSLSMSSNSVGGSCSVTEWSSFE  307

Query  207  ENELKDPPGFSLLVYAWK  154
            E+E   P GFSL VYAW+
Sbjct  308  ESEFLVPLGFSLFVYAWR  325



>gb|KCW80312.1| hypothetical protein EUGRSUZ_C01671, partial [Eucalyptus grandis]
Length=200

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  400
            K+VLQ+K LKWKFRG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+K
Sbjct  47   KRVLQVKRLKWKFRGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFDK  99



>ref|XP_010050717.1| PREDICTED: uncharacterized protein LOC104439337 [Eucalyptus grandis]
Length=357

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  400
            K+VLQ+K LKWKFRG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+K
Sbjct  204  KRVLQVKRLKWKFRGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFDK  256



>ref|XP_010050838.1| PREDICTED: uncharacterized protein LOC104439472 [Eucalyptus grandis]
Length=331

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  400
            K+VLQ+K LKWKFRG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+K
Sbjct  178  KRVLQVKRLKWKFRGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFDK  230



>emb|CDY51100.1| BnaCnng20030D [Brassica napus]
Length=340

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 16/151 (11%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
             K VL++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+A+F F+FE       
Sbjct  188  SKTVLEVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKGLGHAVFMFRFESDPEERV  247

Query  381  gggggfrgkmvnGCGLGFETM-----LMKKGLlrssrsssssslsstsasssctSVMEW-  220
            G G          CG GF+ M     + ++ +     SSSSS   S+++S+  +SV+EW 
Sbjct  248  GNGNDVVLWKRRKCGSGFKGMVEWRKMRRRFVKSKRSSSSSSMSMSSASSACSSSVLEWA  307

Query  219  ESAEENEL----------KDPPGFSLLVYAW  157
             SA+E+E            +  GFSLLVYAW
Sbjct  308  SSADESEYGGGGSSGLGSGNGLGFSLLVYAW  338



>ref|XP_010265675.1| PREDICTED: uncharacterized protein LOC104603360 [Nelumbo nucifera]
Length=376

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALF  418
            K+VL IK LKWKFRGNERIEV+G PIQVSWDV++WLFD   EDG+A+F
Sbjct  219  KRVLLIKRLKWKFRGNERIEVDGIPIQVSWDVYNWLFDGGVEDGHAVF  266



>emb|CDX97072.1| BnaC09g45530D [Brassica napus]
Length=387

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 3/56 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF---DDDEDGYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F+FE
Sbjct  217  SKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKSSGEGGHAVFMFRFE  272



>ref|XP_003527779.1| PREDICTED: uncharacterized protein LOC100783731 [Glycine max]
Length=333

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE----DGYALFTFKFEKQSV  391
            +KVLQIK LKWKFRGNER++V+G  +Q+SWD+++WLFD +     D +A+F FKFE+  V
Sbjct  206  EKVLQIKRLKWKFRGNERVQVDGVHVQISWDLYNWLFDKNNNSAADAHAIFMFKFEEDEV  265



>emb|CDX85733.1| BnaA02g00800D [Brassica napus]
Length=343

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
             +KVL++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+ +F F+FE      +
Sbjct  189  SEKVLEVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKGLGHGVFMFRFESDPEERE  248

Query  381  gggggfrgkmvnGCGLGFETML  316
            G G          CG GF+ M+
Sbjct  249  GSGNDVVLWKPRKCGSGFKGMV  270



>ref|XP_009125261.1| PREDICTED: uncharacterized protein LOC103850289 [Brassica rapa]
Length=343

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
             K VL++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+ +F F+FE      +
Sbjct  189  SKMVLEVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKSLGHGVFMFRFESDPEERE  248

Query  381  gggggfrgkmvnGCGLGFETML  316
            G G          CG GF+ M+
Sbjct  249  GSGNDVVLWKPRKCGSGFKGMV  270



>ref|XP_010519647.1| PREDICTED: uncharacterized protein LOC104799041 [Tarenaya hassleriana]
Length=389

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 10/67 (15%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD----------DEDGYALFTF  412
             K+VLQIK L+WKFRGNE IEV+G P+QVSWDV++WLF++          +  G A+F F
Sbjct  220  SKRVLQIKRLRWKFRGNENIEVDGVPVQVSWDVYNWLFENKTTATVDGNGNGGGQAVFIF  279

Query  411  KFEKQSV  391
            +FE   V
Sbjct  280  RFETDPV  286



>ref|XP_010089947.1| hypothetical protein L484_014458 [Morus notabilis]
 gb|EXB38643.1| hypothetical protein L484_014458 [Morus notabilis]
Length=360

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKF  406
            KK+LQIK LKWKFRGNER EV+G  +Q+SWDV++WLFD  + D +A+F F+F
Sbjct  212  KKILQIKRLKWKFRGNERAEVDGVNVQISWDVYNWLFDAQNGDAHAVFMFRF  263



>ref|XP_004145513.1| PREDICTED: uncharacterized protein LOC101215936, partial [Cucumis 
sativus]
Length=270

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALFTFKFEKQSVge  385
            K+VL+IK LKWKFRGNERIEV G P+ V WDV++W+F+ +++  G A+F F+FE+++   
Sbjct  136  KRVLEIKRLKWKFRGNERIEVAGVPMDVYWDVYNWVFELEKESRGNAVFMFRFEEENE--  193

Query  384  dgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
                     +     GL   E   M+  L  SS S S+S+ S  S++ + +SVMEW ++E
Sbjct  194  ---EQSSNQQQNWNLGLNELEWRRMRNSLSSSSISFSTSTSSVGSSAGASSSVMEWANSE  250

Query  207  E-NELKDPPGFSLLVYAWK  154
            + +++  P GFSLL+YAW+
Sbjct  251  DSDQIGAPLGFSLLIYAWR  269



>ref|XP_006399599.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
 gb|ESQ41052.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
Length=387

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 3/56 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF---DDDEDGYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      + G+A+F F+FE
Sbjct  219  SKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKSSGDGGHAVFMFRFE  274



>emb|CDX69793.1| BnaA10g21420D [Brassica napus]
Length=376

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFKF  406
             K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F+F
Sbjct  218  SKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKASGEGGHAVFMFRF  272



>ref|XP_009122005.1| PREDICTED: uncharacterized protein LOC103846761 [Brassica rapa]
Length=441

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFKF  406
             K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F+F
Sbjct  271  SKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKASGEGGHAVFMFRF  325



>ref|XP_008452874.1| PREDICTED: uncharacterized protein LOC103493769 [Cucumis melo]
Length=347

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 88/139 (63%), Gaps = 10/139 (7%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALFTFKFEKQSVge  385
            K+VL+IK LKWKFRGNERIEV G  + V WDV++W+F+ +++  G A+F F+FE++    
Sbjct  214  KRVLEIKRLKWKFRGNERIEVAGVQMDVYWDVYNWVFELEKENRGNAVFMFRFEEE----  269

Query  384  dgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
                     +     GL   E   M+  L  SS S S+S+ S  S++ + +SVMEW ++E
Sbjct  270  --IEEQSNQQQNWNLGLNELEWRRMRSSLSSSSISFSTSTSSVGSSAGASSSVMEWANSE  327

Query  207  E-NELKDPPGFSLLVYAWK  154
            + +++  P GFSLL+YAW+
Sbjct  328  DSDQIGAPLGFSLLIYAWR  346



>gb|KGN55450.1| hypothetical protein Csa_4G652140 [Cucumis sativus]
Length=351

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALFTFKFEKQSVge  385
            K+VL+IK LKWKFRGNERIEV G P+ V WDV++W+F+ +++  G A+F F+FE+++  +
Sbjct  217  KRVLEIKRLKWKFRGNERIEVAGVPMDVYWDVYNWVFELEKESRGNAVFMFRFEEENEEQ  276

Query  384  dgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  208
                           GL   E   M+  L  SS S S+S+ S  S++ + +SVMEW ++E
Sbjct  277  SSNQQQNWNL-----GLNELEWRRMRNSLSSSSISFSTSTSSVGSSAGASSSVMEWANSE  331

Query  207  E-NELKDPPGFSLLVYAWK  154
            + +++  P GFSLL+YAW+
Sbjct  332  DSDQIGAPLGFSLLIYAWR  350



>ref|XP_010541582.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
 ref|XP_010541584.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
Length=376

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 13/70 (19%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-------------AL  421
             K+VLQIK L+WKFRGNERIEV+G P+Q+SWDV++WLF++                  A+
Sbjct  203  SKRVLQIKRLRWKFRGNERIEVDGVPVQISWDVYNWLFENKPAVNDVNGNGNCNGGGDAV  262

Query  420  FTFKFEKQSV  391
            F F+FE   V
Sbjct  263  FMFRFETDPV  272



>gb|AFB32548.1| hypothetical protein 0_14883_01, partial [Larix decidua]
 gb|AFB32549.1| hypothetical protein 0_14883_01, partial [Larix decidua]
Length=146

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = -3

Query  561  DKKV-LQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            DKKV LQ+KHL WKFRGN+ IEV+G  IQV WDVH+WLF +  +G+A+F F+
Sbjct  39   DKKVVLQVKHLMWKFRGNQTIEVDGTSIQVFWDVHNWLF-NPSNGHAVFMFQ  89



>ref|XP_006289029.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
 gb|EOA21927.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
Length=390

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-----DDEDGYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF      D   G+A+F F+FE
Sbjct  216  SKQVLQIKRLRWKFRGNEKVEIDGVHVQISWDVYNWLFQSKNSGDGGGGHAVFMFRFE  273



>gb|AFB32542.1| hypothetical protein 0_14883_01, partial [Abies alba]
 gb|AFB32543.1| hypothetical protein 0_14883_01, partial [Abies alba]
 gb|AFB32544.1| hypothetical protein 0_14883_01, partial [Abies alba]
 gb|AFB32545.1| hypothetical protein 0_14883_01, partial [Abies alba]
 gb|AFB32546.1| hypothetical protein 0_14883_01, partial [Abies alba]
 gb|AFB32547.1| hypothetical protein 0_14883_01, partial [Abies alba]
Length=146

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            VLQ+KHL WKFRGN+ IEV+G  IQ+ WDVH+WLF +  +G+A+F F+
Sbjct  43   VLQVKHLMWKFRGNQTIEVDGTSIQIFWDVHNWLF-NPSNGHAVFMFQ  89



>gb|AEW07939.1| hypothetical protein 0_14883_01, partial [Pinus radiata]
 gb|AFG43320.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43321.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43322.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43323.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43324.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43325.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43326.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43327.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43328.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43329.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43330.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43331.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43332.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43333.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43334.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
 gb|AFG43335.1| hypothetical protein 0_14883_01, partial [Pinus taeda]
Length=146

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            VLQ+KHL WKFRGN+ IEV+G  IQ+ WDVH+WLF+    G+A+F F+
Sbjct  43   VLQVKHLMWKFRGNQTIEVDGASIQIFWDVHNWLFNPTH-GHAVFMFQ  89



>gb|AFB32551.1| hypothetical protein 0_14883_01, partial [Pinus mugo]
Length=146

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            VLQ+KHL WKFRGN+ IEV+G  IQ+ WDVH+WLF+    G+A+F F+
Sbjct  43   VLQVKHLMWKFRGNQTIEVDGASIQIFWDVHNWLFNPTH-GHAVFMFQ  89



>ref|XP_006405118.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
 gb|ESQ46571.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
Length=343

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 78/143 (55%), Gaps = 25/143 (17%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            +K VL+IK L+WKFRGN ++ ++G  IQ+SWD+++WLF D +   A+F  +FE Q V   
Sbjct  218  NKSVLKIKQLQWKFRGNAKVVIDGVNIQISWDLYNWLFGDKDKVPAVFLLRFENQEVE--  275

Query  381  gggggfrgkmvnGCGLGFETMLMKK----GLlrssrsssssslsstsasssctSVMEWES  214
                            G + ++M K     ++    +S ++S  S+S     +SVMEW +
Sbjct  276  ----------------GNDLLMMNKRERDDVVLRKENSRTASFWSSSYRHWSSSVMEWST  319

Query  213  AEENELKD---PPGFSLLVYAWK  154
             +E E +       +SL+VYAW+
Sbjct  320  CKEEEERSFGHKSWYSLIVYAWR  342



>ref|XP_010929117.1| PREDICTED: uncharacterized protein LOC105050701 [Elaeis guineensis]
Length=404

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 91/181 (50%), Gaps = 45/181 (25%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVE-GFPIQVSWDVHSWLFDDD-------------------  439
            + VLQ++ LKWKFRG+ER+EVE G  IQVSWD+++W F                      
Sbjct  224  RNVLQVRRLKWKFRGSERVEVESGARIQVSWDLYNWFFQPKDKPHATASTAAAAAAAAAA  283

Query  438  --EDGYALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLMKK--------------  307
              E G+A+F F+FE ++  E     GF G+    C  G    L K               
Sbjct  284  AAELGHAVFVFRFEWEAGEERHFVKGFGGRARGVCYKGIGGFLGKNRNRSQSSGGDCGGG  343

Query  306  ---------GLlrssrsssssslsstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  154
                     G  +S   +SSSS SS+++S+S ++VMEW S EE EL+   GF LLV+AWK
Sbjct  344  GGGEVRRKMGRSQSLLKTSSSSPSSSASSASSSTVMEWASPEETELQSADGFLLLVHAWK  403

Query  153  S  151
            S
Sbjct  404  S  404



>gb|AFB32550.1| hypothetical protein 0_14883_01, partial [Pinus mugo]
Length=146

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            VLQ+KHL WKFRGN+ I+V+G  IQ+ WDVH+WLF+    G+A+F F+
Sbjct  43   VLQVKHLMWKFRGNQTIQVDGASIQIFWDVHNWLFNPTH-GHAVFMFQ  89



>ref|XP_006494497.1| PREDICTED: uncharacterized protein LOC102630737 [Citrus sinensis]
Length=109

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++KHL+WKFRGN  I V+G P++V WDVH+WLF     G A+F FK
Sbjct  13   KSVMKVKHLRWKFRGNHTILVDGLPVEVFWDVHNWLFGASV-GNAVFMFK  61



>ref|XP_010090415.1| hypothetical protein L484_025081 [Morus notabilis]
 gb|EXB39385.1| hypothetical protein L484_025081 [Morus notabilis]
Length=305

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFK--------F  406
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF ++ + G A+F F+        +
Sbjct  207  KPVMQVKRLKWKFRGNNTILVDGLPVEVFWDVHNWLFGNNNNMGNAVFMFQTSLSAEKLW  266

Query  405  EKQSVgedgggggfrgkmvnGC---GLGFETML  316
              QSV +         + +  C   GLGF  +L
Sbjct  267  SNQSVFDPSVLTRSYSQQIKDCQTQGLGFSLIL  299



>ref|XP_004958096.1| PREDICTED: uncharacterized protein LOC101782767 [Setaria italica]
Length=284

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            KKVLQ+K L WKFRGN+ I V+G P++V WDVH WLF     G A+F F+
Sbjct  200  KKVLQVKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLF-TSSSGCAVFLFR  248



>ref|XP_002460890.1| hypothetical protein SORBIDRAFT_02g037000 [Sorghum bicolor]
 gb|EER97411.1| hypothetical protein SORBIDRAFT_02g037000 [Sorghum bicolor]
Length=284

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            KKVLQ+K L WKFRGN+ I V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KKVLQVKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLFGSS-NGCAVFLFQ  247



>emb|CDO99050.1| unnamed protein product [Coffea canephora]
Length=304

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+KHL+WKFRGN  I V+G P++V WDV++WLF +   G A+F F+
Sbjct  206  KTVMQVKHLQWKFRGNYTILVDGLPVEVFWDVYNWLFGNSGLGNAVFVFQ  255



>dbj|BAJ95878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTTSNAVFMFQ  255



>gb|EMS52757.1| hypothetical protein TRIUR3_04572 [Triticum urartu]
Length=235

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  149  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGPTTASNAVFMFQ  198



>ref|XP_010942142.1| PREDICTED: uncharacterized protein LOC105060228 [Elaeis guineensis]
Length=389

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 15/70 (21%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFP-IQVSWDVHSWLFDDDED--------------GYA  424
            K+VLQ++ L WKFRG+ER+EVEG   IQVSWD+H+WLF   ++              G+A
Sbjct  220  KRVLQVRRLGWKFRGSERVEVEGGTRIQVSWDLHNWLFQPKDEPPATASTAAAAAELGHA  279

Query  423  LFTFKFEKQS  394
            +F F+FE+++
Sbjct  280  VFVFRFEREA  289



>ref|XP_004493685.1| PREDICTED: uncharacterized protein LOC101510231 [Cicer arietinum]
Length=305

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN+ I V+GFP++V WDVH+WLF +   G A+F F+
Sbjct  207  SKMVMQVKQLKWKFRGNQTILVDGFPVEVFWDVHNWLFGNTM-GNAVFMFQ  256



>emb|CDY56275.1| BnaA09g55790D, partial [Brassica napus]
Length=153

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 76/148 (51%), Gaps = 30/148 (20%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-----ALFTFKFEKQ  397
            +K VL+IK L+WKFRGN ++ ++   IQ+SWDV++W+F D +        A+F  +FE Q
Sbjct  23   NKSVLKIKQLQWKFRGNAKVVIDDVTIQISWDVYNWMFVDKDKANLVKVPAVFLLRFENQ  82

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKK----GLlrssrsssssslsstsasssctSV  229
             V                   G + ++MKK     ++    +S   S  ++S     +SV
Sbjct  83   EVE------------------GNDVLMMKKRERDCVVLGKENSRMLSFRASSYGHWSSSV  124

Query  228  MEWESAEENELKD---PPGFSLLVYAWK  154
            MEW + +E + +       FSL+VYAW+
Sbjct  125  MEWSTCKEEDERSFGHKSWFSLVVYAWR  152



>ref|XP_002873490.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49749.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 7/60 (12%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-------GYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF            G+A+F F+FE
Sbjct  215  SKQVLQIKRLRWKFRGNEKVEIDGVQVQISWDVYNWLFQSKNSGDGGGGGGHAVFMFRFE  274



>gb|ABR17303.1| unknown [Picea sitchensis]
Length=270

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+KHL WKFRGN+ I V+G PI++ WDVH WLF+    G+A+F FK
Sbjct  179  VVQVKHLIWKFRGNQTISVDGLPIEMFWDVHDWLFNPSL-GHAVFMFK  225



>ref|XP_009402136.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402137.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402138.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+QIK L WKFRGN+ I V+G P++V WDVHSWLF     G A+F F+
Sbjct  204  KRVMQIKRLAWKFRGNQTILVDGLPVEVFWDVHSWLF-GSPTGNAVFMFQ  252



>gb|EMT25403.1| hypothetical protein F775_31443 [Aegilops tauschii]
Length=292

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGPTTTSNAVFMFQ  255



>ref|XP_009407751.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407752.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
Length=287

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+QIK L WKFRGN+ I ++G P++V WDVHSWLF     G A+F F+
Sbjct  202  KRVMQIKRLAWKFRGNQTILIDGLPVEVFWDVHSWLFGPS-SGNAVFMFQ  250



>ref|NP_196661.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB96855.1| putative protein [Arabidopsis thaliana]
 gb|AAL15307.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM51579.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM63680.1| unknown [Arabidopsis thaliana]
 gb|AED91619.1| uncharacterized protein AT5G11000 [Arabidopsis thaliana]
Length=389

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 7/60 (12%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-------GYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF            G+A+F F+FE
Sbjct  215  SKQVLQIKRLRWKFRGNEKVEIDGVHVQISWDVYNWLFQSKSSGDGGGGGGHAVFMFRFE  274



>ref|XP_010417285.1| PREDICTED: uncharacterized protein LOC104703050 [Camelina sativa]
Length=373

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 34/152 (22%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQ  397
            DK VL+I  L+WKFRGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q
Sbjct  239  DKSVLKINQLQWKFRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQ  298

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asss  241
             V                   G + ++M K +  +      +S + +         +SS 
Sbjct  299  EVE------------------GNDALMMNKRVRDNVVLRKENSPTPSFWETSYGHWSSSR  340

Query  240  ctSVMEWESAEENELKD---PPGFSLLVYAWK  154
             +SVMEW S  E + +       FSL++YAW+
Sbjct  341  MSSVMEWSSCREEDERSFGCKSWFSLVIYAWR  372



>ref|XP_011079867.1| PREDICTED: uncharacterized protein LOC105163276 [Sesamum indicum]
Length=303

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K VLQ+ HLKWKFRGN+ I V+G  +++ WDVHSWLF    DG A+F F+
Sbjct  206  KAVLQVTHLKWKFRGNQTILVDGISVEIYWDVHSWLF-GTLDGNAIFLFR  254



>ref|XP_010453134.1| PREDICTED: uncharacterized protein LOC104735112 [Camelina sativa]
Length=396

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 9/62 (15%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED---------GYALFTFK  409
             K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF              G+A+F F+
Sbjct  216  SKQVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKSSGDGGGGGGGGHAVFMFR  275

Query  408  FE  403
            FE
Sbjct  276  FE  277



>ref|XP_010419653.1| PREDICTED: uncharacterized protein LOC104705366 [Camelina sativa]
Length=395

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-----DDEDGYALFTFKFE  403
             K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF      D   G+A+F F+FE
Sbjct  217  SKQVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKSSGDGGGGHAVFMFRFE  274



>ref|XP_008808239.1| PREDICTED: uncharacterized protein LOC103720353 [Phoenix dactylifera]
Length=437

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 16/71 (23%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFP-IQVSWDVHSWLFDDDED---------------GY  427
            K++LQ++ L+WKFRG+ER+EVEG   IQVSWD+H+WLF   ++               G+
Sbjct  267  KRLLQVRRLRWKFRGSERVEVEGGARIQVSWDLHNWLFQPKDEPPATASTAAAAAAELGH  326

Query  426  ALFTFKFEKQS  394
            A+F F+F++++
Sbjct  327  AVFVFRFDREA  337



>emb|CBI26241.3| unnamed protein product [Vitis vinifera]
Length=261

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  164  SKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  213



>ref|XP_010552768.1| PREDICTED: uncharacterized protein LOC104823045 [Tarenaya hassleriana]
Length=298

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE-DGYALFTFKFEKQS  394
            K+++QI+ LKWKFRGN+ + ++G P+ V WDVHSWLF +   D  A+F F+ +++S
Sbjct  207  KRLVQIRRLKWKFRGNDTVFIDGLPVDVFWDVHSWLFGNAAGDNAAVFMFRADERS  262



>gb|ACU20214.1| unknown [Glycine max]
Length=300

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK--------F  406
             K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F F+        +
Sbjct  205  SKTVMKVKRLKWKFRGNHTILVDGVPVEVLWDVHSWLFGNAMGNNAVFMFQTCISNDKMW  264

Query  405  EKQSVgedgggggfrgkmvnGCGLGFETML  316
            E QSV +       + +     GLGF  +L
Sbjct  265  EGQSVSDPSWASSQQFRDSQLQGLGFSLIL  294



>ref|XP_010491790.1| PREDICTED: uncharacterized protein LOC104769314 [Camelina sativa]
Length=392

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 6/59 (10%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED------GYALFTFKFE  403
             K VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF           G+A+F F+FE
Sbjct  216  SKLVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKNSGDGGGGGHAVFMFRFE  274



>ref|XP_009387555.1| PREDICTED: uncharacterized protein LOC103974443 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ + HL+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  204  LIHVNHLQWKFRGNETVWVEQVPVQVLWDVHDWLFRGPGSGHALFMFK  251



>ref|XP_006846874.1| hypothetical protein AMTR_s00150p00067790 [Amborella trichopoda]
 gb|ERN08455.1| hypothetical protein AMTR_s00150p00067790 [Amborella trichopoda]
Length=344

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 13/137 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVged  382
            D+ V+ ++ L WKFRGN+ IE+EG  + V WDV  W F   E+G+A+F F+ +   VG  
Sbjct  221  DRVVVHVRELAWKFRGNQEIELEGVKVGVYWDVFDWFFGGCENGHAVFMFRADGSDVGSV  280

Query  381  gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAEEN  202
                          GLG +    K+ L   S S  SSS S +S+S S +SV+EW   EE 
Sbjct  281  VWPPS---------GLGVKGR-EKRLLKTGSASGGSSSGSGSSSSCSSSSVLEWVGVEEE  330

Query  201  ELKDPPGFSLLVYAWKS  151
              +   GFSLL+YAWK+
Sbjct  331  VNR---GFSLLLYAWKN  344



>gb|EAZ04414.1| hypothetical protein OsI_26558 [Oryza sativa Indica Group]
Length=284

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ + V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KRVMQVKRLAWKFRGNQTVYVDGLPVEVLWDVHDWLF-GSSNGCAVFLFQ  247



>ref|XP_004247361.1| PREDICTED: uncharacterized protein LOC101254730 [Solanum lycopersicum]
Length=303

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  205  SKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|XP_010649892.1| PREDICTED: uncharacterized protein LOC100246068 [Vitis vinifera]
Length=300

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  203  SKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  252



>ref|XP_003536564.1| PREDICTED: uncharacterized protein LOC100796685 [Glycine max]
Length=300

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK--------F  406
             K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F F+        +
Sbjct  205  SKTVMKVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAMGNNAVFMFQTCISNDKMW  264

Query  405  EKQSVgedgggggfrgkmvnGCGLGFETML  316
            E QSV +       + +     GLGF  +L
Sbjct  265  EGQSVSDPSWASSQQFRDSQLQGLGFSLIL  294



>emb|CAN68226.1| hypothetical protein VITISV_040533 [Vitis vinifera]
Length=300

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  203  SKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  252



>gb|AFK42653.1| unknown [Medicago truncatula]
Length=262

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN+ + V+GFP++V WDVH+WLF +   G A+F F+
Sbjct  166  KIVMQVKQLKWKFRGNQTVLVDGFPVEVFWDVHNWLFGNAM-GNAVFMFQ  214



>ref|XP_009601952.1| PREDICTED: uncharacterized protein LOC104097132 [Nicotiana tomentosiformis]
Length=302

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  205  SKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|XP_006360806.1| PREDICTED: uncharacterized protein LOC102583145 [Solanum tuberosum]
Length=303

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  205  SKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|XP_006433029.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 ref|XP_006471721.1| PREDICTED: uncharacterized protein LOC102630218 isoform X1 [Citrus 
sinensis]
 ref|XP_006471722.1| PREDICTED: uncharacterized protein LOC102630218 isoform X2 [Citrus 
sinensis]
 gb|ESR46269.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 gb|KDO41101.1| hypothetical protein CISIN_1g022287mg [Citrus sinensis]
Length=299

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++KHL+WKFRGN  I V+G P++V WDVH+WLF     G A+F FK
Sbjct  203  KSVMKVKHLRWKFRGNHTILVDGLPVEVFWDVHNWLFGASV-GNAVFMFK  251



>gb|KEH23778.1| plant/T24G3-80 protein [Medicago truncatula]
Length=307

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN+ + V+GFP++V WDVH+WLF +   G A+F F+
Sbjct  210  SKIVMQVKQLKWKFRGNQTVLVDGFPVEVFWDVHNWLFGNAM-GNAVFMFQ  259



>ref|XP_004981359.1| PREDICTED: uncharacterized protein LOC101774579 [Setaria italica]
Length=291

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+KHL WKFRGN+ I ++G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKHLAWKFRGNQTILIDGLPVEVFWDVHSWLFGSTASN-AVFMFQ  254



>ref|XP_011071576.1| PREDICTED: uncharacterized protein LOC105156990 [Sesamum indicum]
Length=302

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+KHL+WKFRGN  I V+G P+ V WDVH+WLF  +  G A+F F+
Sbjct  204  SKPVMQVKHLRWKFRGNCTILVDGIPVDVFWDVHNWLFGSNL-GSAVFMFQ  253



>ref|XP_004146978.1| PREDICTED: uncharacterized protein LOC101203661 [Cucumis sativus]
Length=318

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEK  400
             K  +QIK LKWKFRGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  210  SKTAMQIKRLKWKFRGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  264



>ref|XP_004158912.1| PREDICTED: uncharacterized protein LOC101227560 [Cucumis sativus]
 gb|KGN44806.1| hypothetical protein Csa_7G388390 [Cucumis sativus]
Length=319

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEK  400
             K  +QIK LKWKFRGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  210  SKTAMQIKRLKWKFRGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  264



>ref|XP_008451346.1| PREDICTED: uncharacterized protein LOC103492661 [Cucumis melo]
Length=317

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFEK  400
             K  +QIK LKWKFRGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  205  SKTAMQIKRLKWKFRGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  259



>gb|KJB22972.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
 gb|KJB22973.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
Length=173

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF  +  G A+F F+
Sbjct  77   KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLF-GNALGNAVFMFQ  125



>gb|EAY92263.1| hypothetical protein OsI_13984 [Oryza sativa Indica Group]
Length=140

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedg  379
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+  +       
Sbjct  55   KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTSN-AVFMFQTCQAPEKSMP  113

Query  378  ggggfrgkmvnGCGLGFETML  316
                   +     GLGF  +L
Sbjct  114  WSYSQVFRESQLQGLGFSLIL  134



>gb|KFK25379.1| hypothetical protein AALP_AA8G105700 [Arabis alpina]
Length=377

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 6/59 (10%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD------DEDGYALFTFKFE  403
             K VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF           G+A+F F+FE
Sbjct  210  SKMVLQIKRLRWKFRGNEKVEIDGVVVQISWDVYNWLFQRGGDGGSGGGGHAVFMFRFE  268



>ref|XP_008455804.1| PREDICTED: uncharacterized protein LOC103495897 [Cucumis melo]
Length=299

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  202  SKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  251



>ref|XP_004139223.1| PREDICTED: uncharacterized protein LOC101220430 [Cucumis sativus]
 ref|XP_004156452.1| PREDICTED: uncharacterized LOC101220430 [Cucumis sativus]
Length=299

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  202  SKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  251



>gb|KGN60826.1| hypothetical protein Csa_2G011590 [Cucumis sativus]
Length=335

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  238  SKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  287



>ref|XP_007144641.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
 gb|ESW16635.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
Length=300

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVHSWLF +   G A+F F+
Sbjct  204  SKTVMQVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAM-GNAVFMFQ  253



>emb|CDP03641.1| unnamed protein product [Coffea canephora]
Length=278

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             + VLQ+K L+WKFRGNE I V+G P++V WDVHSW F +   G A+F F+
Sbjct  182  SRAVLQVKRLRWKFRGNETILVDGLPVEVYWDVHSWFFGNVM-GNAVFLFQ  231



>ref|NP_001143196.1| uncharacterized protein LOC100275698 [Zea mays]
 gb|ACG29652.1| hypothetical protein [Zea mays]
Length=284

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            KKVL +K L WKFRGN+ I V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KKVLHLKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLF-GSTNGCAVFLFQ  247



>gb|KHN03804.1| hypothetical protein glysoja_011033 [Glycine soja]
Length=300

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F F+
Sbjct  205  SKTVMKVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAMGNNAVFMFQ  255



>ref|XP_008651185.1| PREDICTED: uncharacterized protein LOC100275698 isoform X1 [Zea 
mays]
 gb|ACF82722.1| unknown [Zea mays]
 gb|ACN25273.1| unknown [Zea mays]
 tpg|DAA63241.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
 tpg|DAA63242.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
Length=284

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            KKVL +K L WKFRGN+ I V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KKVLHLKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLF-GSTNGCAVFLFQ  247



>gb|AFG57306.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57307.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57308.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57309.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57310.1| hypothetical protein 0_630_01, partial [Pinus taeda]
Length=132

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K  +++  L WKFRGN+ I VEG P+Q+ WDVH WLF+    G+ALF FK
Sbjct  54   KLAVEVNQLPWKFRGNDTIYVEGVPVQILWDVHDWLFNPGI-GHALFIFK  102



>gb|AFG57303.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57304.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57313.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57314.1| hypothetical protein 0_630_01, partial [Pinus taeda]
Length=132

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K  +++  L WKFRGN+ I VEG P+Q+ WDVH WLF+    G+ALF FK
Sbjct  54   KLAVEVNQLPWKFRGNDTIYVEGVPVQILWDVHDWLFNPGL-GHALFIFK  102



>gb|EMT06649.1| hypothetical protein F775_13550 [Aegilops tauschii]
Length=283

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+VLQ+K L WKFRGN+   V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KRVLQVKRLAWKFRGNQTFYVDGLPVEVLWDVHDWLF-GSSNGCAVFLFQ  247



>gb|AFG57305.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57311.1| hypothetical protein 0_630_01, partial [Pinus taeda]
Length=132

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K  +++  L WKFRGN+ I VEG P+Q+ WDVH WLF+    G+ALF FK
Sbjct  54   KLAVEVNQLPWKFRGNDTICVEGVPVQILWDVHDWLFNPGL-GHALFIFK  102



>ref|XP_003518919.1| PREDICTED: uncharacterized protein LOC100793503 [Glycine max]
 gb|KHN18875.1| hypothetical protein glysoja_028244 [Glycine soja]
Length=301

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVHSWLF +   G A+F F+
Sbjct  204  SKTVMQVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAM-GNAVFMFQ  253



>ref|XP_008804337.1| PREDICTED: uncharacterized protein LOC103717650 [Phoenix dactylifera]
Length=288

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  203  KRVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHNWLF-GPTTGNAVFMFQ  251



>ref|XP_007162443.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
 gb|ESW34437.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
Length=301

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  204  SKTVMQVKQLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  253



>gb|EYU46571.1| hypothetical protein MIMGU_mgv1a026066mg [Erythranthe guttata]
Length=252

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+VLQ+ HLKWKFRGN+ I V+G  ++V WDV+SWLF D   G A+F F+
Sbjct  159  KEVLQVTHLKWKFRGNQSILVDGVSVEVYWDVYSWLF-DSVVGNAIFLFR  207



>ref|XP_010674843.1| PREDICTED: uncharacterized protein LOC104890923 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K ++Q+K L+WKFRGN  I ++G P++V WDVHSWLF     G A+F F+
Sbjct  203  KNLMQVKRLRWKFRGNHTILIDGLPVEVFWDVHSWLFGSSP-GSAVFMFR  251



>ref|XP_008783101.1| PREDICTED: uncharacterized protein LOC103702440 [Phoenix dactylifera]
Length=273

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ + +L+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  198  LIHVSNLQWKFRGNETVLVEKVPVQVFWDVHDWLFGTPGTGHALFIFK  245



>ref|XP_006657868.1| PREDICTED: uncharacterized protein LOC102710887 [Oryza brachyantha]
Length=284

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ + V+G P++V WDVH WLF     G A+F F+
Sbjct  199  KRVMQLKRLAWKFRGNQTVYVDGLPVEVLWDVHEWLFGSS-SGCAVFLFQ  247



>gb|KJB42120.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42121.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42122.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42123.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
Length=249

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  152  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  200



>gb|ACN25495.1| unknown [Zea mays]
Length=236

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedg  379
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+  +       
Sbjct  151  KPVMQVKRLAWKFRGNQAILVDGLPVEVFWDVHSWLFGSTASN-AVFMFQTRQAPEKSLP  209

Query  378  ggggfrgkmvnGCGLGFETML  316
                   +     GLGF  +L
Sbjct  210  WSYSQNFRESQLQGLGFSLIL  230



>ref|XP_003564146.1| PREDICTED: uncharacterized protein LOC100837549 [Brachypodium 
distachyon]
Length=291

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedg  379
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+  +       
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSSTSN-AVFMFQTSQAPEKSMP  264

Query  378  ggggfrgkmvnGCGLGFETML  316
                   +     GLGF  +L
Sbjct  265  WSYSQIFRESQLQGLGFSLIL  285



>ref|XP_009408456.1| PREDICTED: uncharacterized protein LOC103990890 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ I ++G P++V WDVHSWLF     G A+F F+
Sbjct  203  KRVMQVKRLAWKFRGNQTILIDGLPVEVFWDVHSWLF-GVPGGNAVFMFQ  251



>ref|XP_006444048.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 ref|XP_006479703.1| PREDICTED: uncharacterized protein LOC102609980 [Citrus sinensis]
 gb|ESR57288.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 gb|KDO68699.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68700.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68701.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
Length=302

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  206  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  254



>ref|XP_007050578.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007050579.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94735.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94736.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=246

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  150  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  198



>ref|XP_010689671.1| PREDICTED: uncharacterized protein LOC104903342 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGNE + V   PIQV WDVH+WLF +   G  LF FK
Sbjct  219  LIHVKNLQWKFRGNEMVVVNKTPIQVLWDVHAWLFSNPGTGCGLFVFK  266



>gb|KJB45005.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45006.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45007.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45008.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
Length=303

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K ++Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  205  KALMQVKRLRWKFRGNHTILVDGMAVEVYWDVHNWLFGTSLGGSAVFMFK  254



>ref|XP_010929447.1| PREDICTED: uncharacterized protein LOC105050916 [Elaeis guineensis]
Length=299

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ + +L+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  207  LIHVDNLQWKFRGNETVMVEKVPVQVFWDVHDWLFGAPGTGHALFIFK  254



>ref|XP_010910592.1| PREDICTED: uncharacterized protein LOC105036529 [Elaeis guineensis]
Length=290

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  205  KRVMQVKRLMWKFRGNQTILVDGLPVEVFWDVHNWLF-GAPTGNAVFMFQ  253



>ref|XP_010923391.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923392.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923393.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
Length=288

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  203  KRVMQVKRLGWKFRGNQTILVDGLPVEVFWDVHNWLF-GTPTGNAVFMFQ  251



>ref|XP_010455167.1| PREDICTED: uncharacterized protein LOC104736806 [Camelina sativa]
Length=288

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQS  394
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+  + +
Sbjct  202  KTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFRTTQST  256



>ref|XP_006851632.1| hypothetical protein AMTR_s00040p00202330 [Amborella trichopoda]
 gb|ERN13162.1| hypothetical protein AMTR_s00040p00202330 [Amborella trichopoda]
Length=273

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+ +K L WKFRGN+ I V+G PI + WDVH W F     GYA+F FK
Sbjct  189  KMVVHVKRLLWKFRGNQTILVDGSPIDMLWDVHDWFFSPGPSGYAVFMFK  238



>ref|XP_006294490.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
 gb|EOA27388.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
Length=353

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 74/153 (48%), Gaps = 35/153 (23%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQ  397
            DK VL+I  L+WKFRGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q
Sbjct  218  DKSVLKIDKLQWKFRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKVPAVFLLRFENQ  277

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsst---------sass  244
             V                   G + ++M K +  +      +S + +         S+ +
Sbjct  278  EVE------------------GNDALMMNKRVRDNVVLRKENSKTPSFWATSYGHWSSFT  319

Query  243  sctSVMEWESAEENELKD---PPGFSLLVYAWK  154
               +VMEW S  E + +       FSL++YAW+
Sbjct  320  RMPNVMEWSSCREEDERSFGYKSWFSLVIYAWR  352



>ref|XP_002880661.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56920.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 72/152 (47%), Gaps = 34/152 (22%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQ  397
            DK VL+I  L+WKFRGN +I ++G  IQ+ WDV++WLF D      +   A+F  +FE Q
Sbjct  220  DKSVLKINQLQWKFRGNSKIVIDGVTIQIIWDVYNWLFSDKDKVKPDKVPAVFLLRFENQ  279

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asss  241
             V                   G + ++M K +         +S + +          SS 
Sbjct  280  DVE------------------GNDVLMMNKRVRDDVVLRKENSRTPSFWGTSYGHWCSSR  321

Query  240  ctSVMEWESAEENELK---DPPGFSLLVYAWK  154
             +SVMEW S  E + +       FSL++YAW+
Sbjct  322  MSSVMEWPSCREEDERSFGSKSWFSLIIYAWR  353



>emb|CDX76763.1| BnaC08g33490D [Brassica napus]
Length=349

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 77/148 (52%), Gaps = 30/148 (20%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-----ALFTFKFEKQ  397
            +KKVL+I+ L+WKFRGN ++ ++   IQ+SWDV++W+F D +        A+F  +FE Q
Sbjct  219  NKKVLKIEQLRWKFRGNAKVVIDDVTIQISWDVYNWMFVDKDKANLAKVPAVFLLRFENQ  278

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKK----GLlrssrsssssslsstsasssctSV  229
             V                   G + ++MKK     ++    +S   S  ++S     +SV
Sbjct  279  EVE------------------GNDVLMMKKRERDCVVLGKENSRMLSFRASSYGHWSSSV  320

Query  228  MEWESAEENELKD---PPGFSLLVYAWK  154
            MEW + +E + +       FSL+VYAW+
Sbjct  321  MEWSTCKEEDERSFGHKSWFSLVVYAWR  348



>ref|XP_007050577.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94734.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=310

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  214  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  262



>gb|KJB42124.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
Length=306

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  209  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  257



>ref|XP_006838233.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
 gb|ERN00802.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
Length=301

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K VLQ+K L WKFRGN  I V+G P++V WDVH+WLF     G A+F FK
Sbjct  202  KMVLQVKQLVWKFRGNHTILVDGLPVEVYWDVHNWLFSQTM-GSAVFMFK  250



>gb|KJB22971.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
Length=307

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF  +  G A+F F+
Sbjct  211  KTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLF-GNALGNAVFMFQ  259



>ref|XP_009117076.1| PREDICTED: uncharacterized protein LOC103842203 [Brassica rapa]
Length=350

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 77/148 (52%), Gaps = 30/148 (20%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-----ALFTFKFEKQ  397
            +KKVL+I+ L+WKFRGN ++ ++   IQ+SWDV++W+F D +        A+F  +FE Q
Sbjct  220  NKKVLKIEQLQWKFRGNAKVVIDDLTIQLSWDVYNWMFVDKDKANLVKVPAVFLLRFENQ  279

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKG----LlrssrsssssslsstsasssctSV  229
             V                   G + ++MKK     L+    +S   S  ++S     +SV
Sbjct  280  EVE------------------GNDVLMMKKRERDYLVLGKENSRMLSFRASSYGHWSSSV  321

Query  228  MEWESAEENELKD---PPGFSLLVYAWK  154
            MEW + +E + +       FSL+VYAW+
Sbjct  322  MEWSTCKEEDERSFGHKSWFSLVVYAWR  349



>ref|XP_009792059.1| PREDICTED: uncharacterized protein LOC104239187 [Nicotiana sylvestris]
Length=302

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+++KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  205  SKTVMKVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>gb|KDP22998.1| hypothetical protein JCGZ_01720 [Jatropha curcas]
Length=721

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+ +K+L+WKFRGN+ + V   P+QV WDVH WLF++   G+ LF FK
Sbjct  626  VIHVKNLQWKFRGNQTVMVNTQPVQVFWDVHDWLFNNAATGHGLFIFK  673



>ref|XP_011032694.1| PREDICTED: uncharacterized protein LOC105131425 [Populus euphratica]
Length=285

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  201  KMVMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNSM-GNAVFMFQ  249



>ref|XP_008802684.1| PREDICTED: uncharacterized protein LOC103716457 [Phoenix dactylifera]
Length=289

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  204  KRVMQVKRLVWKFRGNQTILVDGLPVEVFWDVHNWLF-GAPTGNAVFMFQ  252



>ref|XP_002307590.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
 gb|EEE94586.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
Length=300

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  202  SKMVMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNSM-GNAVFMFQ  251



>ref|XP_001770719.1| predicted protein [Physcomitrella patens]
 gb|EDQ64543.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF +   G+A+F F+
Sbjct  203  VVQVKRLMWKFRGNQTIVVDGAPVEVFWDVHSWLF-NPRAGHAVFMFQ  249



>ref|XP_010253022.1| PREDICTED: uncharacterized protein LOC104594441 [Nelumbo nucifera]
Length=326

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ + +L+WKFRGNE I V   P+QV WDVH WLF     G+ LF FK
Sbjct  219  LIHVTNLQWKFRGNETIRVNTIPVQVFWDVHDWLFSGQPTGHGLFIFK  266



>ref|XP_009151242.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 ref|XP_009151243.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 emb|CDX86191.1| BnaA06g29080D [Brassica napus]
Length=293

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  204  KTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSAGNAVFMFR  253



>ref|XP_006395009.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
 gb|ESQ32295.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
Length=288

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  202  KTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFAMPSAGNAVFMFR  251



>ref|XP_009392096.1| PREDICTED: uncharacterized protein LOC103978120 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ + +L+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  199  LIHVSNLQWKFRGNETVWVEQVPVQVFWDVHGWLFRGPGSGHALFIFK  246



>emb|CBI28703.3| unnamed protein product [Vitis vinifera]
Length=273

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  176  KMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  224



>ref|NP_001167908.1| hypothetical protein [Zea mays]
 gb|ACN25441.1| unknown [Zea mays]
 gb|ACN26475.1| unknown [Zea mays]
 tpg|DAA52032.1| TPA: hypothetical protein ZEAMMB73_540283 [Zea mays]
Length=294

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedg  379
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+  +       
Sbjct  209  KPVMQVKRLAWKFRGNQAILVDGLPVEVFWDVHSWLFGSTASN-AVFMFQTRQAPEKSLP  267

Query  378  ggggfrgkmvnGCGLGFETML  316
                   +     GLGF  +L
Sbjct  268  WSYSQNFRESQLQGLGFSLIL  288



>ref|XP_010277409.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
 ref|XP_010277418.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
Length=298

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  202  KTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLF-GPALGSAVFMFQ  250



>gb|KHN10674.1| hypothetical protein glysoja_019105 [Glycine soja]
Length=304

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  205  SKTVMQVKQLKWKFRGNHTILVDGIPVEVFWDVHNWLFGNAM-GDAVFMFQ  254



>ref|XP_003632331.1| PREDICTED: uncharacterized protein LOC100853449 [Vitis vinifera]
Length=300

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  202  SKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  251



>ref|XP_006288375.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
 gb|EOA21273.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
Length=289

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  202  KTMLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFR  251



>ref|XP_010256015.1| PREDICTED: uncharacterized protein LOC104596517 [Nelumbo nucifera]
Length=298

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  202  KTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLF-GPALGSAVFMFQ  250



>gb|KDP21447.1| hypothetical protein JCGZ_21918 [Jatropha curcas]
Length=299

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  203  KIVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  251



>ref|XP_003617887.1| Kinesin-4 [Medicago truncatula]
Length=1503

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  546   QIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             +I +L WKFRGNE + V   P+Q+ WDVH WLF+D   G A+F FK
Sbjct  1412  RIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFK  1457



>ref|XP_010228241.1| PREDICTED: uncharacterized protein LOC100838117 [Brachypodium 
distachyon]
Length=299

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  211  KPVMQVKRLAWKFRGNQTIIVDGLPVEVFWDVHSWLFSSTTSN-AVFMFQ  259



>gb|AET00846.2| kinesin heavy chain, putative [Medicago truncatula]
Length=1462

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  546   QIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             +I +L WKFRGNE + V   P+Q+ WDVH WLF+D   G A+F FK
Sbjct  1371  RIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFK  1416



>ref|XP_010041438.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 ref|XP_010041445.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 gb|KCW84880.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
 gb|KCW84881.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
Length=299

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF +   G A+F FK
Sbjct  202  SKSVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLF-NPSSGNAVFMFK  251



>ref|XP_011090719.1| PREDICTED: uncharacterized protein LOC105171343 isoform X2 [Sesamum 
indicum]
Length=296

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V++I HL+WKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  205  KTVMRINHLQWKFRGNYTILVDGLPVEVFWDVHNWLFGPSL-GSAVFMFQ  253



>ref|XP_010421680.1| PREDICTED: uncharacterized protein LOC104707100 [Camelina sativa]
Length=288

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQS  394
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+  + +
Sbjct  202  KILLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFRTTQST  256



>ref|XP_003521248.2| PREDICTED: uncharacterized protein LOC100799355 [Glycine max]
Length=313

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  205  SKTVMQVKQLKWKFRGNHTILVDGIPVEVFWDVHNWLFGNAM-GDAVFMFQ  254



>ref|NP_198167.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL90906.1| AT5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AAN18148.1| At5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AED93776.1| uncharacterized protein AT5G28150 [Arabidopsis thaliana]
Length=289

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  203  KTLLQVKRLKWKFRGNDTIVVNKMTVEVLWDVHSWLFGLPTTGNAVFMFR  252



>gb|ACU19762.1| unknown [Glycine max]
Length=257

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  203  SKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGGTSLGNAVFMFR  253



>ref|XP_008457940.1| PREDICTED: uncharacterized protein LOC103497505 [Cucumis melo]
Length=110

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALFTFKFEKQS  394
            K+VL+I+ LKWKFRGNERI+V G  + V WDV++ +F+ +++  G ALF  + E+++
Sbjct  50   KRVLEIERLKWKFRGNERIKVAGVQMDVYWDVYNLVFELEKENRGNALFMIRVEEEN  106



>emb|CDY52485.1| BnaC07g49460D [Brassica napus]
Length=293

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  204  KTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSVGNAVFMFR  253



>gb|EMS45281.1| hypothetical protein TRIUR3_16464 [Triticum urartu]
Length=283

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+VLQ+K L W FRGN+   V+G P++V WDVH WLF    +G A+F F+
Sbjct  199  KRVLQVKRLAWNFRGNQMFYVDGLPVEVLWDVHDWLF-GSSNGCAVFLFQ  247



>ref|XP_002466252.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
 gb|EER93250.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
Length=291

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTSN-AVFMFQ  254



>ref|XP_010546610.1| PREDICTED: uncharacterized protein LOC104818644 [Tarenaya hassleriana]
Length=286

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K ++Q+K LKWKFRGN+ I V+   ++V WDVHSWLF     G A+F F+
Sbjct  202  KPMMQVKRLKWKFRGNDTIIVDRMAVEVLWDVHSWLFGIPSTGNAVFMFR  251



>emb|CAN61445.1| hypothetical protein VITISV_024138 [Vitis vinifera]
Length=416

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  202  SKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  251



>ref|XP_002872306.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48565.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  202  KTLLQVKRLKWKFRGNDTIIVNRMAVEVLWDVHSWLFGLPPAGNAVFMFR  251



>gb|AFW67285.1| hypothetical protein ZEAMMB73_929047 [Zea mays]
Length=291

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTASN-AVFMFQ  254



>ref|XP_011090718.1| PREDICTED: uncharacterized protein LOC105171343 isoform X1 [Sesamum 
indicum]
Length=320

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V++I HL+WKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  205  KTVMRINHLQWKFRGNYTILVDGLPVEVFWDVHNWLFGPSL-GSAVFMFQ  253



>ref|XP_002520723.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41685.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  203  KMVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGSGM-GNAVFMFQ  251



>ref|NP_001060057.1| Os07g0572300 [Oryza sativa Japonica Group]
 dbj|BAC84673.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21971.1| Os07g0572300 [Oryza sativa Japonica Group]
 gb|EAZ40371.1| hypothetical protein OsJ_24817 [Oryza sativa Japonica Group]
 dbj|BAG93762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K+V+Q+K L WKFRGN+ + V+G P++V WDVH WLF    +  A+F F+
Sbjct  199  KRVMQVKRLAWKFRGNQTVYVDGLPVEVLWDVHDWLF-GSSNKCAVFLFQ  247



>ref|XP_009592922.1| PREDICTED: uncharacterized protein LOC104089679 [Nicotiana tomentosiformis]
Length=309

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ IK+L+WKFRGNE + V   P+QV WDVH+WLF     G+ LF FK
Sbjct  213  LIHIKNLQWKFRGNETVLVNKQPVQVLWDVHAWLFCSPGSGHGLFIFK  260



>ref|XP_010429511.1| PREDICTED: uncharacterized protein LOC104713983 isoform X1 [Camelina 
sativa]
Length=353

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 73/152 (48%), Gaps = 34/152 (22%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQ  397
            +K VL+I  L+WK RGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q
Sbjct  219  NKSVLKINQLQWKCRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQ  278

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asss  241
             V                   G + ++M K +  +      +S + +          SS 
Sbjct  279  EVE------------------GNDALMMNKRVRDNVVLRKENSRTPSFWATSYGHWPSSR  320

Query  240  ctSVMEWESAEENELKD---PPGFSLLVYAWK  154
             +SVMEW S  E + +       FSL++YAW+
Sbjct  321  MSSVMEWSSCREEDERSFGCKSWFSLVIYAWR  352



>ref|XP_011032437.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032438.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032439.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032440.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032441.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032442.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032443.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032444.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032446.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032447.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032448.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032449.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032450.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032452.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032453.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032454.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032455.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032456.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032457.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032458.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032459.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032460.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032461.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
Length=299

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  I+V WDVHSWLF     G A+F FK
Sbjct  203  KTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHSWLFGASV-GNAVFMFK  251



>ref|XP_006366122.1| PREDICTED: uncharacterized protein LOC102584925 [Solanum tuberosum]
Length=308

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ IK+L+WKFRGNE + V   P+QV WDVH+WLF     G+ LF FK
Sbjct  212  LIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFK  259



>ref|XP_002524594.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37802.1| conserved hypothetical protein [Ricinus communis]
Length=311

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+ +K+L+WKFRGN+ + V   P+QV WDVH WLF+    G+ LF FK
Sbjct  215  VIHVKNLQWKFRGNQTVIVNKQPVQVFWDVHDWLFNTTGTGHGLFIFK  262



>ref|XP_004252365.1| PREDICTED: uncharacterized protein LOC101249896 [Solanum lycopersicum]
Length=308

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ IK+L+WKFRGNE + V   P+QV WDVH+WLF     G+ LF FK
Sbjct  212  LIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFK  259



>ref|XP_006650760.1| PREDICTED: uncharacterized protein LOC102720690 [Oryza brachyantha]
Length=291

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSMTSN-AVFMFQ  254



>ref|XP_009778863.1| PREDICTED: uncharacterized protein LOC104228156 [Nicotiana sylvestris]
Length=309

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ IK+L+WKFRGNE + V   P+QV WDVH+WLF     G+ LF FK
Sbjct  213  LIHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFK  260



>ref|XP_010429513.1| PREDICTED: uncharacterized protein LOC104713983 isoform X2 [Camelina 
sativa]
Length=353

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 73/152 (48%), Gaps = 34/152 (22%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQ  397
            +K VL+I  L+WK RGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q
Sbjct  219  NKSVLKINQLQWKCRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQ  278

Query  396  SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asss  241
             V                   G + ++M K +  +      +S   +         +SS 
Sbjct  279  EVE------------------GNDALMMNKRVRDNVVLRKENSQIPSFWATSYGHWSSSR  320

Query  240  ctSVMEWESAEENELKD---PPGFSLLVYAWK  154
             +SVMEW S  E + +       FSL++YAW+
Sbjct  321  LSSVMEWSSCREEDERSFGCKSWFSLVIYAWR  352



>ref|XP_003536115.1| PREDICTED: uncharacterized protein LOC100778089 [Glycine max]
 gb|KHN16187.1| hypothetical protein glysoja_012163 [Glycine soja]
Length=301

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  203  SKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGGTSLGNAVFMFR  253



>ref|XP_008380035.1| PREDICTED: uncharacterized protein LOC103443030 [Malus domestica]
 ref|XP_008365566.1| PREDICTED: uncharacterized protein LOC103429200 [Malus domestica]
Length=310

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ ++V   P+QV WDVH WLF     G+ LF FK
Sbjct  213  LIHVKNLQWKFRGNQTVQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFK  260



>ref|XP_011026156.1| PREDICTED: uncharacterized protein LOC105126841 [Populus euphratica]
Length=299

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  205  VMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  251



>ref|XP_008218232.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218233.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218234.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218235.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
Length=299

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  202  SKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_007207341.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
 gb|EMJ08540.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
Length=299

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  202  SKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>gb|EPS66867.1| hypothetical protein M569_07907 [Genlisea aurea]
Length=313

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  412
            K V+QI+HL+WKFRGN    V+G P+QV +DVH+WLF     G A+F F
Sbjct  209  KTVVQIRHLQWKFRGNAAFRVDGLPVQVYYDVHNWLFGHCL-GNAVFLF  256



>ref|XP_010494083.1| PREDICTED: uncharacterized protein LOC104771271 [Camelina sativa]
Length=288

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQS  394
            K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F  +  + +
Sbjct  202  KTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMLRTTQST  256



>ref|XP_004302026.1| PREDICTED: uncharacterized protein LOC101296394 [Fragaria vesca 
subsp. vesca]
Length=303

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  207  KTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGSSP-GSAVFMFK  255



>ref|XP_001772274.1| predicted protein [Physcomitrella patens]
 gb|EDQ62927.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF +   G+A+F F+
Sbjct  203  VVQVKRLAWKFRGNQTIIVDGNPVEVFWDVHNWLF-NPRVGHAVFMFQ  249



>ref|XP_008345708.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
 ref|XP_008345709.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
Length=299

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  202  SKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_008388659.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388660.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388661.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
Length=299

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  202  SKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>gb|EEE60141.1| hypothetical protein OsJ_13031 [Oryza sativa Japonica Group]
Length=269

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  184  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGLTTSN-AVFMFQ  232



>ref|XP_009364535.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364536.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364537.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364538.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364540.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
Length=299

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  202  SKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_004305864.1| PREDICTED: uncharacterized protein LOC101301230 [Fragaria vesca 
subsp. vesca]
 ref|XP_011467624.1| PREDICTED: uncharacterized protein LOC101301230 [Fragaria vesca 
subsp. vesca]
Length=312

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ + V   P+QV WDVH WLF     G+ LF FK
Sbjct  213  LVHVKNLQWKFRGNQTVMVNMLPVQVFWDVHDWLFSSPGTGHGLFIFK  260



>ref|XP_004495197.1| PREDICTED: uncharacterized protein LOC101503605 [Cicer arietinum]
Length=289

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
             K V+++K LKWKFRGN  I V+G P++V WDVH+WLF  +  G A+F F+
Sbjct  206  SKTVMKVKRLKWKFRGNHTILVDGVPVEVFWDVHNWLF-GNAIGNAVFLFQ  255



>ref|XP_003562863.1| PREDICTED: uncharacterized protein LOC100826732 [Brachypodium 
distachyon]
Length=286

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQ  397
            K+VLQ+K L W FRGN+ + V+G PI+V WDVH WLF    +  A+F F+  K 
Sbjct  201  KRVLQVKRLTWNFRGNQTVFVDGLPIEVLWDVHDWLF-GSSNRCAVFLFQSGKS  253



>ref|NP_001051637.1| Os03g0806700 [Oryza sativa Japonica Group]
 gb|AAP21412.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99447.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13551.1| Os03g0806700 [Oryza sativa Japonica Group]
 dbj|BAG88202.1| unnamed protein product [Oryza sativa Japonica Group]
Length=291

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  206  KPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGLTTSN-AVFMFQ  254



>ref|XP_003539811.1| PREDICTED: uncharacterized protein LOC100794621 [Glycine max]
Length=317

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L+W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  233  KTVIRVKRLQWNFRGNQTIFVDGLLVDLLWDVHDWFFNPSSSGYAVFMFR  282



>ref|XP_002512236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49688.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  203  KTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFGSSV-GNAVFMFK  251



>emb|CBI34200.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  167  KIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  215



>gb|KHN21116.1| hypothetical protein glysoja_006595 [Glycine soja]
Length=317

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L+W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  233  KTVIRVKRLQWNFRGNQTIFVDGLLVDLLWDVHDWFFNPSSSGYAVFMFR  282



>ref|XP_008342273.1| PREDICTED: uncharacterized protein LOC103405081 [Malus domestica]
Length=308

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ ++V   P+QV WDVH WLF     G+ LF FK
Sbjct  212  LIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFK  259



>ref|XP_008353616.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353617.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353618.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
Length=309

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ ++V   P+QV WDVH WLF     G+ LF FK
Sbjct  213  LIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFK  260



>ref|XP_004490568.1| PREDICTED: uncharacterized protein LOC101492045 [Cicer arietinum]
Length=310

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            +L +K+L+WKFRGN+ + V   P+QV WDVH WLF     G  LF FK
Sbjct  214  LLHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGTGLFIFK  261



>ref|XP_003544282.1| PREDICTED: uncharacterized protein LOC100810973 [Glycine max]
 gb|KHN40039.1| hypothetical protein glysoja_009416 [Glycine soja]
Length=305

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ + V   P+QV WDVH WLF     G+ LF FK
Sbjct  210  LIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGHGLFIFK  257



>gb|KDP23639.1| hypothetical protein JCGZ_23472 [Jatropha curcas]
Length=299

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  203  KTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFGTSV-GNAVFMFK  251



>ref|XP_003606250.1| hypothetical protein MTR_4g055230 [Medicago truncatula]
 gb|AES88447.1| DUF868 family protein [Medicago truncatula]
Length=306

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L+W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  222  KNVIRVKRLQWNFRGNQTIFVDGLLVDLLWDVHDWFFNPQASGYAVFMFR  271



>ref|XP_002977922.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
 gb|EFJ21260.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
Length=294

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF+    G A+F F+
Sbjct  204  VIQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNPSL-GNAVFMFQ  250



>ref|XP_002986948.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
 gb|EFJ12030.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
Length=297

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF+    G A+F F+
Sbjct  207  VIQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNPSL-GNAVFMFQ  253



>gb|AFG57312.1| hypothetical protein 0_630_01, partial [Pinus taeda]
Length=132

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K  +++  L WKFRGN+ I VEG P+Q+  DVH WLF+    G+ALF FK
Sbjct  54   KLAVEVNQLPWKFRGNDTICVEGVPVQILLDVHDWLFNPGL-GHALFIFK  102



>ref|XP_006382769.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
 gb|ERP60566.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
Length=299

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  I+V WDVH+WLF     G A+F FK
Sbjct  203  KTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHNWLFGASV-GNAVFMFK  251



>emb|CAN64151.1| hypothetical protein VITISV_041021 [Vitis vinifera]
Length=305

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  203  KIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  251



>ref|XP_010644630.1| PREDICTED: uncharacterized protein LOC100852612 [Vitis vinifera]
Length=308

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++++ +L W+FRGNE + +   PIQ+ WDVH WLF+    G+ALF FK
Sbjct  212  LIRVMNLHWRFRGNETVFLNNLPIQIFWDVHDWLFNSPSLGHALFIFK  259



>ref|XP_002277386.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659902.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659903.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659904.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659905.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659906.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659907.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659908.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659909.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659910.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659911.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659912.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659913.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
Length=305

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  203  KIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  251



>gb|ACU18815.1| unknown [Glycine max]
Length=324

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  240  KTVIRVKRLHWNFRGNQTIFVDGLLVDLLWDVHDWFFNPSSSGYAVFMFR  289



>gb|KHN38664.1| hypothetical protein glysoja_008213 [Glycine soja]
Length=325

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  241  KTVIRVKRLHWNFRGNQTIFVDGLLVDLLWDVHDWFFNPSSSGYAVFMFR  290



>ref|XP_003538138.1| PREDICTED: uncharacterized protein LOC100797969 [Glycine max]
Length=325

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+++K L W FRGN+ I V+G  + + WDVH W F+    GYA+F F+
Sbjct  241  KTVIRVKRLHWNFRGNQTIFVDGLLVDLLWDVHDWFFNPSSSGYAVFMFR  290



>ref|XP_007217278.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
 gb|EMJ18477.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
Length=309

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ + V   P+QV WDVH WLF     G+ LF FK
Sbjct  213  LIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLFTSPSTGHGLFIFK  260



>gb|KHN33661.1| hypothetical protein glysoja_013667 [Glycine soja]
Length=247

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G  ++V WDVH+WLF +   G A+F F+
Sbjct  151  KTVMQVKQLKWKFRGNHTIVVDGISVEVFWDVHNWLFGNAM-GNAVFMFQ  199



>gb|EYU33727.1| hypothetical protein MIMGU_mgv1a0262881mg, partial [Erythranthe 
guttata]
Length=302

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  549  LQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            +++ +L W+FRGNE I V+ FP+Q+ WDVH WL++    G  +F F+
Sbjct  215  IRVPNLHWRFRGNETIVVDDFPVQILWDVHDWLYNGTHSGVGIFVFR  261



>gb|EEC80133.1| hypothetical protein OsI_21920 [Oryza sativa Indica Group]
Length=333

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSV  391
            +K LQ++ L+WKFRG+ER+++    ++VSWD+H WLF    D  A+F  +FE   V
Sbjct  168  EKALQVRRLRWKFRGSERLDLPRGRVRVSWDLHGWLF--AADAVAVFVLRFETADV  221



>ref|XP_008229762.1| PREDICTED: uncharacterized protein LOC103329112 [Prunus mume]
Length=309

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++ +K+L+WKFRGN+ + V   P+QV WDVH WLF     G+ LF FK
Sbjct  213  LIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLFTSPSTGHGLFIFK  260



>ref|XP_010103965.1| hypothetical protein L484_020218 [Morus notabilis]
 gb|EXB97668.1| hypothetical protein L484_020218 [Morus notabilis]
Length=1381

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = -3

Query  549   LQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKF  406
             +++ +L W+FRGNE +     PIQ+ WDVH WLF     G+ LF FK 
Sbjct  1285  IRVMNLNWRFRGNETLMANNVPIQIFWDVHDWLFTSPGSGHGLFIFKL  1332



>ref|XP_006604441.1| PREDICTED: uncharacterized protein LOC100786850 [Glycine max]
 gb|KHN02571.1| hypothetical protein glysoja_002595 [Glycine soja]
Length=301

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            K V+Q+K LKWKFRGN  I V+G  ++V WDVH+WLF +   G A+F F+
Sbjct  205  KTVMQVKQLKWKFRGNHTIVVDGISVEVFWDVHNWLFGNAM-GNAVFMFQ  253



>ref|XP_010676107.1| PREDICTED: uncharacterized protein LOC104892001 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE-DGYALFTFKFE  403
            + V+Q+ +L W+FRGNE + V   P+Q+ WDVH WLF      G+ LF FK E
Sbjct  206  RAVVQVMNLSWRFRGNETVLVNNVPVQIFWDVHDWLFSSSPGTGHGLFIFKPE  258



>emb|CAN62312.1| hypothetical protein VITISV_018204 [Vitis vinifera]
Length=753

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -3

Query  561  DKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            +KKV+Q+K L+W FRGN+ I V+G  + + WDVH W F +   G A+F F+
Sbjct  560  NKKVIQVKRLRWNFRGNQTIFVDGLLVDMMWDVHDWFF-NPSSGSAVFMFR  609



>gb|EEE65210.1| hypothetical protein OsJ_20353 [Oryza sativa Japonica Group]
Length=351

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSV  391
            +K LQ++ L+WKFRG+ER+++    ++VSWD+H WLF    D  A+F  +FE   V
Sbjct  186  EKALQVRRLRWKFRGSERLDLPRGRVRVSWDLHGWLF--AADAVAVFVLRFETADV  239



>ref|XP_006299727.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
 gb|EOA32625.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
Length=306

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++Q+K+L+WKFRGNE + V+  P+QV WDV+ WLF     G+ +F FK
Sbjct  207  LVQVKNLQWKFRGNETVLVDKQPVQVFWDVYDWLFSTPGTGHGMFIFK  254



>dbj|BAD72575.1| hypothetical protein [Oryza sativa Japonica Group]
Length=384

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSV  391
            +K LQ++ L+WKFRG+ER+++    ++VSWD+H WLF    D  A+F  +FE   V
Sbjct  186  EKALQVRRLRWKFRGSERLDLPRGRVRVSWDLHGWLF--AADAVAVFVLRFETADV  239



>ref|XP_010278217.1| PREDICTED: uncharacterized protein LOC104612487 [Nelumbo nucifera]
Length=300

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -3

Query  558  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            +KV+++K L+W FRGN+ I V+G  + + WDVH W F+ D  GYA+F F+
Sbjct  217  RKVIRVKRLQWNFRGNQTIFVDGLLVDMMWDVHDWFFNPDS-GYAVFMFR  265



>ref|XP_006418603.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
 gb|ESQ37039.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
Length=303

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++Q+K+L+WKFRGN+ + V+  P+QV WDV+ WLF     G+ LF FK
Sbjct  207  LVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSSPGTGHGLFIFK  254



>ref|XP_002883629.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59888.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  552  VLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  409
            ++Q+K+L+WKFRGN+ + V+  P+QV WDV+ WLF     G+ LF FK
Sbjct  207  LIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSTPGTGHGLFIFK  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880