BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041C13

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAC93946.1|  lacZ alpha peptide                                   48.5    1e-04   Cloning vector pSET152
ref|WP_001365265.1|  hypothetical protein                             46.6    3e-04   Escherichia coli [E. coli]
emb|CED95120.1|  LacZalpha                                            45.4    8e-04   synthetic construct
gb|ACK75959.1|  lacZ alpha peptide                                    45.4    9e-04   Cloning vector pUCLIB
gb|AHH11881.1|  Beta-galactosidase                                    45.4    9e-04   Borrelia coriaceae Co53
gb|AAB00807.1|  ZZ:beta-Gal' IgG-binding fusion protein               47.4    9e-04   Cloning vector pKP497
gb|ADO79610.1|  LacZ alpha peptide                                    45.4    0.001   Cloning vector pGNS-BAC
gb|AHE38469.1|  beta-galactosidase alpha peptide                      45.4    0.001   Cloning vector pGGM000
gb|AHE38449.1|  beta-galactosidase alpha peptide                      45.4    0.001   Cloning vector pGGD000
gb|AFL92704.1|  beta-galactosidase                                    45.8    0.001   Cloning vector pBR103



>emb|CAC93946.1| lacZ alpha peptide [Cloning vector pSET152]
 gb|ADB65775.1| lacZ alpha peptide [Cloning vector pOJ260]
Length=114

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKCP  70
           WRLMRYFLLTHLCGISHRI  P
Sbjct  75  WRLMRYFLLTHLCGISHRINSP  96



>ref|WP_001365265.1| hypothetical protein [Escherichia coli]
 ref|YP_006953588.1| hypothetical protein [Escherichia coli]
 gb|AER93370.1| hypothetical protein [Escherichia coli]
 gb|EIG91830.1| hypothetical protein EC970246_D0001 [Escherichia coli 97.0246]
Length=72

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  90  DIKFLQPGHFMRCEIPHRCVRRKYRIRRQA  1
            ++ ++  H MRCEIPHRCVRRKYRIRR +
Sbjct  3   SVRIIRKEHHMRCEIPHRCVRRKYRIRRSS  32



>emb|CED95120.1| LacZalpha, partial [synthetic construct]
Length=86

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  56  WRLMRYFLLTHLCGISHRIWC  76



>gb|ACK75959.1| lacZ alpha peptide [Cloning vector pUCLIB]
Length=83

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  53  WRLMRYFLLTHLCGISHRIWC  73



>gb|AHH11881.1| Beta-galactosidase [Borrelia coriaceae Co53]
Length=84

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  54  WRLMRYFLLTHLCGISHRIWC  74



>gb|AAB00807.1| ZZ:beta-Gal' IgG-binding fusion protein [Cloning vector pKP497]
Length=215

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    WRLMRYFLLTHLCGISHRIKC  67
            WRLMRYFLLTHLCGISHRI C
Sbjct  185  WRLMRYFLLTHLCGISHRIWC  205



>gb|ADO79610.1| LacZ alpha peptide [Cloning vector pGNS-BAC]
Length=94

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  64  WRLMRYFLLTHLCGISHRIWC  84



>gb|AHE38469.1| beta-galactosidase alpha peptide [Cloning vector pGGM000]
 gb|AHE38473.1| beta-galactosidase alpha peptide [Cloning vector pGGN000]
 gb|AHE38477.1| beta-galactosidase alpha peptide [Cloning vector pGGY001]
 gb|AHE38481.1| beta-galactosidase alpha peptide [Cloning vector pGGY003]
 gb|AHE38485.1| beta-galactosidase alpha peptide [Cloning vector pGGZ001]
 gb|AHE38489.1| beta-galactosidase alpha peptide [Cloning vector pGGZ003]
Length=83

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  53  WRLMRYFLLTHLCGISHRIWC  73



>gb|AHE38449.1| beta-galactosidase alpha peptide [Cloning vector pGGD000]
 gb|AHE38465.1| beta-galactosidase alpha peptide [Cloning vector pGGI000]
Length=103

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   WRLMRYFLLTHLCGISHRIKC  67
           WRLMRYFLLTHLCGISHRI C
Sbjct  73  WRLMRYFLLTHLCGISHRIWC  93



>gb|AFL92704.1| beta-galactosidase [Cloning vector pBR103]
Length=119

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    WRLMRYFLLTHLCGISHRIKC  67
            WRLMRYFLLTHLCGISHRI C
Sbjct  89   WRLMRYFLLTHLCGISHRIWC  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550