BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041B21

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347553.1|  PREDICTED: aluminum-activated malate transpo...  89.7    3e-17   Solanum tuberosum [potatoes]
ref|XP_004235305.1|  PREDICTED: aluminum-activated malate transpo...  88.2    1e-16   
ref|XP_009619311.1|  PREDICTED: aluminum-activated malate transpo...  83.6    4e-15   Nicotiana tomentosiformis
ref|XP_009795348.1|  PREDICTED: aluminum-activated malate transpo...  82.4    1e-14   Nicotiana sylvestris
gb|EYU45360.1|  hypothetical protein MIMGU_mgv1a003565mg              79.7    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_006347472.1|  PREDICTED: aluminum-activated malate transpo...  77.0    6e-13   Solanum tuberosum [potatoes]
ref|XP_011075828.1|  PREDICTED: aluminum-activated malate transpo...  77.0    8e-13   Sesamum indicum [beniseed]
ref|XP_009628763.1|  PREDICTED: aluminum-activated malate transpo...  72.8    2e-11   Nicotiana tomentosiformis
ref|XP_009803276.1|  PREDICTED: aluminum-activated malate transpo...  72.4    2e-11   Nicotiana sylvestris
ref|XP_004135406.1|  PREDICTED: aluminum-activated malate transpo...  70.5    9e-11   Cucumis sativus [cucumbers]
ref|XP_004242127.1|  PREDICTED: aluminum-activated malate transpo...  70.1    1e-10   Solanum lycopersicum
gb|KDO38904.1|  hypothetical protein CISIN_1g048543mg                 67.0    4e-10   Citrus sinensis [apfelsine]
gb|EYU19727.1|  hypothetical protein MIMGU_mgv1a003372mg              68.2    5e-10   Erythranthe guttata [common monkey flower]
ref|XP_008446577.1|  PREDICTED: aluminum-activated malate transpo...  67.4    1e-09   Cucumis melo [Oriental melon]
ref|XP_006484436.1|  PREDICTED: aluminum-activated malate transpo...  67.0    1e-09   Citrus sinensis [apfelsine]
ref|XP_006437702.1|  hypothetical protein CICLE_v10031089mg           67.0    1e-09   Citrus clementina [clementine]
ref|XP_008350864.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  66.2    2e-09   
ref|XP_004297128.1|  PREDICTED: aluminum-activated malate transpo...  65.5    4e-09   Fragaria vesca subsp. vesca
ref|XP_010102835.1|  Aluminum-activated malate transporter 4          64.3    1e-08   Morus notabilis
ref|XP_004512938.1|  PREDICTED: aluminum-activated malate transpo...  64.3    1e-08   Cicer arietinum [garbanzo]
ref|XP_007046271.1|  Aluminum activated malate transporter family...  63.9    1e-08   
gb|KJB50732.1|  hypothetical protein B456_008G184400                  63.5    2e-08   Gossypium raimondii
gb|KJB50733.1|  hypothetical protein B456_008G184400                  63.5    2e-08   Gossypium raimondii
ref|XP_006341623.1|  PREDICTED: aluminum-activated malate transpo...  63.5    2e-08   Solanum tuberosum [potatoes]
gb|KJB50731.1|  hypothetical protein B456_008G184400                  63.5    2e-08   Gossypium raimondii
ref|XP_007222460.1|  hypothetical protein PRUPE_ppa003480mg           63.5    2e-08   Prunus persica
ref|XP_011021871.1|  PREDICTED: aluminum-activated malate transpo...  63.5    2e-08   Populus euphratica
ref|XP_008243200.1|  PREDICTED: aluminum-activated malate transpo...  63.5    2e-08   Prunus mume [ume]
ref|XP_009616234.1|  PREDICTED: aluminum-activated malate transpo...  62.4    4e-08   
gb|KHG13463.1|  Aluminum-activated malate transporter 6 -like pro...  62.0    4e-08   Gossypium arboreum [tree cotton]
emb|CAN68659.1|  hypothetical protein VITISV_002161                   62.0    5e-08   Vitis vinifera
ref|XP_002278978.1|  PREDICTED: aluminum-activated malate transpo...  62.0    6e-08   Vitis vinifera
emb|CBI27043.3|  unnamed protein product                              62.0    7e-08   Vitis vinifera
ref|XP_002312386.2|  hypothetical protein POPTR_0008s11740g           61.2    9e-08   Populus trichocarpa [western balsam poplar]
gb|KDP20105.1|  hypothetical protein JCGZ_05874                       61.2    9e-08   Jatropha curcas
ref|XP_010102834.1|  Aluminum-activated malate transporter 4          60.5    2e-07   Morus notabilis
ref|XP_006374353.1|  hypothetical protein POPTR_0015s06340g           60.5    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010027833.1|  PREDICTED: aluminum-activated malate transpo...  60.5    2e-07   Eucalyptus grandis [rose gum]
ref|XP_007036504.1|  Aluminum-activated malate transporter 9          60.1    2e-07   
gb|KHG29903.1|  Aluminum-activated malate transporter 4 -like pro...  60.1    3e-07   Gossypium arboreum [tree cotton]
gb|EPS71908.1|  hypothetical protein M569_02848                       59.7    3e-07   Genlisea aurea
ref|XP_009764790.1|  PREDICTED: aluminum-activated malate transpo...  59.7    3e-07   Nicotiana sylvestris
ref|XP_010318605.1|  PREDICTED: aluminum-activated malate transpo...  59.7    4e-07   
gb|KDP29386.1|  hypothetical protein JCGZ_18307                       59.3    4e-07   Jatropha curcas
gb|KJB50413.1|  hypothetical protein B456_008G169600                  58.9    5e-07   Gossypium raimondii
ref|XP_010681586.1|  PREDICTED: aluminum-activated malate transpo...  58.9    5e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006441921.1|  hypothetical protein CICLE_v10023819mg           58.9    6e-07   
ref|XP_006440948.1|  hypothetical protein CICLE_v10019485mg           58.9    6e-07   Citrus clementina [clementine]
ref|XP_009360165.1|  PREDICTED: aluminum-activated malate transpo...  55.5    9e-07   Pyrus x bretschneideri [bai li]
ref|XP_006485776.1|  PREDICTED: aluminum-activated malate transpo...  58.2    1e-06   Citrus sinensis [apfelsine]
ref|XP_009356494.1|  PREDICTED: aluminum-activated malate transpo...  58.2    1e-06   
ref|XP_009356502.1|  PREDICTED: aluminum-activated malate transpo...  57.8    1e-06   
ref|XP_010932631.1|  PREDICTED: aluminum-activated malate transpo...  57.8    1e-06   Elaeis guineensis
gb|KHG02535.1|  Aluminum-activated malate transporter 9 -like pro...  57.8    1e-06   Gossypium arboreum [tree cotton]
ref|XP_004298293.1|  PREDICTED: aluminum-activated malate transpo...  57.4    2e-06   Fragaria vesca subsp. vesca
ref|XP_010460370.1|  PREDICTED: aluminum-activated malate transpo...  57.4    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008361730.1|  PREDICTED: aluminum-activated malate transpo...  57.4    2e-06   
ref|XP_010480664.1|  PREDICTED: aluminum-activated malate transpo...  57.0    2e-06   
ref|XP_008361731.1|  PREDICTED: aluminum-activated malate transpo...  57.0    2e-06   
ref|XP_010499104.1|  PREDICTED: aluminum-activated malate transpo...  57.0    3e-06   Camelina sativa [gold-of-pleasure]
gb|EYU40877.1|  hypothetical protein MIMGU_mgv1a0220201mg             53.5    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_002278994.2|  PREDICTED: aluminum-activated malate transpo...  56.2    4e-06   
gb|ACU18485.1|  unknown                                               53.1    4e-06   Glycine max [soybeans]
ref|XP_002529137.1|  conserved hypothetical protein                   56.2    5e-06   Ricinus communis
ref|XP_010094774.1|  Aluminum-activated malate transporter 9          55.8    6e-06   Morus notabilis
ref|XP_008367579.1|  PREDICTED: aluminum-activated malate transpo...  55.8    6e-06   
ref|XP_008374744.1|  PREDICTED: aluminum-activated malate transpo...  55.8    7e-06   Malus domestica [apple tree]
ref|XP_006307134.1|  hypothetical protein CARUB_v10008724mg           55.8    7e-06   Capsella rubella
ref|XP_009360189.1|  PREDICTED: aluminum-activated malate transpo...  55.5    8e-06   Pyrus x bretschneideri [bai li]
emb|CBI15440.3|  unnamed protein product                              55.5    8e-06   Vitis vinifera
ref|XP_002893421.1|  predicted protein                                55.5    8e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010477920.1|  PREDICTED: aluminum-activated malate transpo...  55.5    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008240281.1|  PREDICTED: aluminum-activated malate transpo...  55.5    8e-06   
ref|XP_008812805.1|  PREDICTED: aluminum-activated malate transpo...  55.5    9e-06   
ref|XP_002275995.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   Vitis vinifera
ref|XP_011084604.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   
ref|XP_011084603.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   
ref|XP_010487770.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010487771.1|  PREDICTED: aluminum-activated malate transpo...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007160366.1|  hypothetical protein PHAVU_002G315500g           54.7    1e-05   Phaseolus vulgaris [French bean]
ref|XP_011084602.1|  PREDICTED: aluminum-activated malate transpo...  54.7    1e-05   Sesamum indicum [beniseed]
ref|XP_002314876.2|  hypothetical protein POPTR_0010s13750g           54.7    2e-05   
ref|XP_009410081.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84992.1|  BnaC05g20630D                                        54.3    2e-05   
ref|XP_006362575.1|  PREDICTED: aluminum-activated malate transpo...  53.9    2e-05   
emb|CDY18521.1|  BnaA01g26740D                                        54.3    2e-05   Brassica napus [oilseed rape]
gb|KJB37235.1|  hypothetical protein B456_006G195100                  54.3    2e-05   Gossypium raimondii
ref|XP_004238944.1|  PREDICTED: aluminum-activated malate transpo...  53.9    2e-05   Solanum lycopersicum
ref|XP_004138239.1|  PREDICTED: aluminum-activated malate transpo...  53.9    3e-05   Cucumis sativus [cucumbers]
ref|XP_004170574.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  53.9    3e-05   
ref|XP_006406604.1|  hypothetical protein EUTSA_v10020343mg           53.9    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_002883132.1|  hypothetical protein ARALYDRAFT_898211           53.9    3e-05   Arabidopsis lyrata subsp. lyrata
emb|CDY42102.1|  BnaA09g28580D                                        53.9    3e-05   Brassica napus [oilseed rape]
ref|XP_010265178.1|  PREDICTED: aluminum-activated malate transpo...  53.5    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008453386.1|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   Cucumis melo [Oriental melon]
ref|XP_006297257.1|  hypothetical protein CARUB_v10013270mg           53.5    4e-05   Capsella rubella
ref|NP_188473.1|  aluminum-activated malate transporter 9             53.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20718.1|  Aluminum-activated malate transporter 9               53.5    4e-05   Glycine soja [wild soybean]
ref|XP_009112721.1|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   Brassica rapa
ref|XP_003530009.2|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   Glycine max [soybeans]
ref|XP_006583403.1|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   
ref|XP_010419692.1|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   
ref|XP_008812807.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  53.1    4e-05   
ref|XP_003525258.2|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   
ref|XP_003555230.1|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   
gb|KHN21560.1|  Aluminum-activated malate transporter 9               53.1    5e-05   Glycine soja [wild soybean]
ref|XP_011008233.1|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   Populus euphratica
ref|XP_009617358.1|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   Nicotiana tomentosiformis
gb|KFK44528.1|  hypothetical protein AALP_AA1G268500                  52.8    6e-05   Arabis alpina [alpine rockcress]
ref|XP_011012696.1|  PREDICTED: aluminum-activated malate transpo...  52.8    7e-05   Populus euphratica
emb|CDY26161.1|  BnaA06g12560D                                        52.4    8e-05   Brassica napus [oilseed rape]
ref|XP_009149285.1|  PREDICTED: putative aluminum-activated malat...  52.4    8e-05   Brassica rapa
gb|AAW81734.1|  Putative expressed protein                            52.4    8e-05   Brassica oleracea
ref|XP_010102832.1|  Aluminum-activated malate transporter 9          52.4    8e-05   
emb|CDY19211.1|  BnaC05g14120D                                        52.4    9e-05   Brassica napus [oilseed rape]
ref|XP_010097443.1|  Aluminum-activated malate transporter 9          52.4    9e-05   
ref|XP_006584854.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   Glycine max [soybeans]
ref|XP_003532498.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   Glycine max [soybeans]
gb|EYU40875.1|  hypothetical protein MIMGU_mgv1a003508mg              52.4    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_009347009.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_003517985.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   Glycine max [soybeans]
ref|XP_003630843.1|  hypothetical protein MTR_8g104130                52.0    1e-04   
gb|KFK44001.1|  hypothetical protein AALP_AA1G202000                  51.6    1e-04   Arabis alpina [alpine rockcress]
ref|XP_009761788.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   Nicotiana sylvestris
ref|XP_004298292.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   Fragaria vesca subsp. vesca
ref|XP_007142895.1|  hypothetical protein PHAVU_007G025900g           51.6    2e-04   Phaseolus vulgaris [French bean]
ref|XP_003630841.1|  hypothetical protein MTR_8g104110                51.2    2e-04   Medicago truncatula
ref|XP_010498230.1|  PREDICTED: putative aluminum-activated malat...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
gb|KFK39175.1|  hypothetical protein AALP_AA3G210100                  51.2    2e-04   Arabis alpina [alpine rockcress]
ref|XP_004300533.1|  PREDICTED: aluminum-activated malate transpo...  50.8    3e-04   Fragaria vesca subsp. vesca
ref|XP_006838424.1|  hypothetical protein AMTR_s00002p00112740        50.8    3e-04   Amborella trichopoda
ref|XP_002532651.1|  conserved hypothetical protein                   50.8    3e-04   Ricinus communis
ref|XP_010459458.1|  PREDICTED: putative aluminum-activated malat...  50.8    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009115329.1|  PREDICTED: aluminum-activated malate transpo...  50.4    3e-04   
ref|XP_010465944.1|  PREDICTED: aluminum-activated malate transpo...  50.4    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010477020.1|  PREDICTED: putative aluminum-activated malat...  50.4    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009381461.1|  PREDICTED: aluminum-activated malate transpo...  50.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003533369.2|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   Glycine max [soybeans]
ref|XP_008243202.1|  PREDICTED: aluminum-activated malate transpo...  50.1    5e-04   Prunus mume [ume]
ref|NP_173919.1|  Aluminum activated malate transporter family pr...  50.1    5e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95521.1|  BnaC01g34130D                                        50.4    5e-04   
ref|XP_003524381.1|  PREDICTED: aluminum-activated malate transpo...  50.1    5e-04   Glycine max [soybeans]
gb|KHN21559.1|  Aluminum-activated malate transporter 9               50.1    5e-04   Glycine soja [wild soybean]
gb|KEH27049.1|  aluminum activated malate transporter family protein  50.1    6e-04   Medicago truncatula
ref|XP_010677979.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY24400.1|  BnaCnng04670D                                        49.7    8e-04   Brassica napus [oilseed rape]
ref|XP_010551282.1|  PREDICTED: aluminum-activated malate transpo...  49.7    8e-04   Tarenaya hassleriana [spider flower]
ref|XP_006415877.1|  hypothetical protein EUTSA_v10007220mg           49.7    8e-04   Eutrema salsugineum [saltwater cress]
ref|XP_007046270.1|  Aluminum-activated malate transporter 9          49.3    9e-04   Theobroma cacao [chocolate]



>ref|XP_006347553.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
tuberosum]
Length=571

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 2/115 (2%)
 Frame = +3

Query  288  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGI--PSQSTNRGFLHGFRDRVSAFF  461
            MAAGNAY  SL++SF   S+E LL      S+L  G    S + N  FL   R RVS + 
Sbjct  1    MAAGNAYLGSLKQSFHETSKERLLLLRKGYSDLSVGGGGSSFTGNETFLERIRYRVSEYC  60

Query  462  GDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             +VK+ + KA +MGR DPR IIF+AK+G AL+LVS+L+FFKEP+ YIGS S+WAI
Sbjct  61   NNVKQAASKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPIPYIGSHSIWAI  115



>ref|XP_004235305.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
lycopersicum]
Length=571

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  291  AAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQST-NRGFLHGFRDRVSAFFGD  467
            AAGNAY  SL++SF   S+E LL      S+L  G     T N  FL   R RVS +  +
Sbjct  3    AAGNAYLGSLKQSFHETSKERLLLLRKGYSDLSVGGGGGFTGNENFLERIRYRVSEYCNN  62

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            VK+ + KA +MGR DPR IIF+AK+G AL+LVS+L+FFKEP+ YIGS S+WAI
Sbjct  63   VKQAASKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPIPYIGSHSIWAI  115



>ref|XP_009619311.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
tomentosiformis]
Length=557

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 11/113 (10%)
 Frame = +3

Query  288  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGD  467
            MA  N    SL ++F   S+  LL  G      E+G+  ++       G R+R++ F  +
Sbjct  1    MAEANVDIRSLSQNFNETSKARLLYNGS-----EYGLDVEN------EGLRNRINEFCSN  49

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            VK+   KA EMGRKDPR +IFAAKMG ALSLVS+L+FFKEPLSYIG+ S+WAI
Sbjct  50   VKQGLFKAIEMGRKDPRKVIFAAKMGSALSLVSVLIFFKEPLSYIGTYSIWAI  102



>ref|XP_009795348.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
sylvestris]
Length=566

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFRDRVSAFFGDVKETSIK  488
            SL ++F   S+  LL  G      E+G+ +     N GF     +R++ F  +VK+ S K
Sbjct  11   SLSQNFNETSKARLLHNGS-----EYGLDASFYIENEGFWRRLSNRINEFCSNVKQGSFK  65

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            A EMGRKDPR +IFAAKMG ALSLVS+L+FFKEPLSYIG+ S+WAI
Sbjct  66   AIEMGRKDPRKVIFAAKMGSALSLVSVLIFFKEPLSYIGTYSIWAI  111



>gb|EYU45360.1| hypothetical protein MIMGU_mgv1a003565mg [Erythranthe guttata]
Length=577

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 5/108 (5%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG-FR---DRVSAFFGDVKETS  482
            SLR+SF+   RE LLSR   +S++ +   S   + G LH  FR   DR+S ++ +V   +
Sbjct  7    SLRQSFVERGRERLLSRK-YNSDVGFNDSSYIVHEGCLHWLFRVTVDRISRWWNNVTGIA  65

Query  483  IKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
              AYEMGR DPR ++FAAKMG ALSLVS+L+FFKEPLSYI   S+WAI
Sbjct  66   FSAYEMGRSDPRKVVFAAKMGAALSLVSVLIFFKEPLSYISQYSIWAI  113



>ref|XP_006347472.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
tuberosum]
Length=562

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = +3

Query  318  LRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNR-GFLHGFRDRVSAFFGDVKETSIKA  491
            L ++F   S+E L+ +       E+G+ PS    R GF     +R+     +VK  SIKA
Sbjct  5    LSQNFNETSKERLIPKYS-----EYGLDPSFYVEREGFWRRLCNRIKKSCSNVKHGSIKA  59

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             +MGRKDPR +IFAAKMGLALSLVS+++FFKEPLSYIG+ S+WAI
Sbjct  60   IDMGRKDPRKVIFAAKMGLALSLVSVIIFFKEPLSYIGTYSIWAI  104



>ref|XP_011075828.1| PREDICTED: aluminum-activated malate transporter 4-like [Sesamum 
indicum]
Length=582

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR----DRVSAFFGDVKETS  482
            SLR+SF   S+E LLSR   +S++ +   S     G  H F     + +S ++ DVK T+
Sbjct  7    SLRQSFADRSKERLLSRK-YNSDVGFD-DSFFVYEGCWHRFFRIIGESLSGWWNDVKGTA  64

Query  483  IKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + AYEMGR DPR ++FAAKMG ALSLVS+L+FFKEPLSYIG  S+WAI
Sbjct  65   VSAYEMGRSDPRKVVFAAKMGAALSLVSVLIFFKEPLSYIGKYSIWAI  112



>ref|XP_009628763.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
tomentosiformis]
Length=558

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  303  AYSESLRRSFMGASREGLL-SRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKET  479
            AY  SL++SF+  ++E LL  R G S     G  S + N  FL   R R++ F  DVK+ 
Sbjct  2    AYLGSLKQSFVETNKERLLLPRKGYSELGVGGGASFTGNENFLERLRYRLTEFCNDVKKV  61

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + KA +MGR DPR IIF+AK+G AL+LVS+L+FFKEPL YIG  S+WAI
Sbjct  62   AAKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPLPYIGKHSIWAI  110



>ref|XP_009803276.1| PREDICTED: aluminum-activated malate transporter 5-like [Nicotiana 
sylvestris]
Length=558

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  303  AYSESLRRSFMGASREG-LLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKET  479
            AY  SL++SF+  ++E  LL R G S     G  S + N  FL   R R++ F  DVK+ 
Sbjct  2    AYLGSLKQSFVETNKERILLPRKGYSELGVGGGASFTGNENFLERLRYRLTEFCNDVKKA  61

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + KA +MGR DPR IIF+AK+G AL+LVS+L+FFKEPL YIG  S+WAI
Sbjct  62   AAKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPLPYIGKHSIWAI  110



>ref|XP_004135406.1| PREDICTED: aluminum-activated malate transporter 4-like [Cucumis 
sativus]
 ref|XP_004159319.1| PREDICTED: aluminum-activated malate transporter 4-like [Cucumis 
sativus]
 gb|KGN52065.1| hypothetical protein Csa_5G608530 [Cucumis sativus]
Length=571

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKET  479
            S+R+SF+  +RE LLSR G S   ++G+ S   S +      FR   D V+  +   + T
Sbjct  7    SIRQSFLDQNREKLLSRKGYS---DFGLNSYDGSGDNVKCRCFRTLSDAVTNLWKGCQNT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            S+K YEMGR DPR   FA KMGL+L+L SL++FF++PL  +G  S+WAI
Sbjct  64   SVKLYEMGRSDPRKFFFAVKMGLSLALASLVIFFRQPLKEVGQYSIWAI  112



>ref|XP_004242127.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
lycopersicum]
Length=559

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = +3

Query  318  LRRSFMGASREGLLSRGGCSSELEWGI-PSQSTN-RGFLHGFRDRVSAFFGDVKETSIKA  491
            L ++F   S+E L+ +       E+G+ PS      GF     +R+     +VK+  IKA
Sbjct  5    LSQNFNETSKERLIPKYS-----EYGLDPSFYVEPEGFWRRLCNRIKKSGSNVKQGYIKA  59

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             +MGRKDPR +IFA KMGL LSLVS+++FFKEPLSYIG+ S+WAI
Sbjct  60   IDMGRKDPRKVIFAVKMGLTLSLVSVVIFFKEPLSYIGTYSIWAI  104



>gb|KDO38904.1| hypothetical protein CISIN_1g048543mg, partial [Citrus sinensis]
Length=282

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTN--------RGFLHGFRDRVSAFFGDV  470
            S R SF   S+E LLSR G S   ++G+ S   +        R F     D V  F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDGSEDGIKCRCF-RWISDGVINFWTNL  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +   I+ Y+MGRKDPR  +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAI
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAI  114



>gb|EYU19727.1| hypothetical protein MIMGU_mgv1a003372mg [Erythranthe guttata]
Length=589

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            D+ S ++G++K T+I AYEMGR DPR ++FAAKMG ALSLVS+L+FFKEP +YI   S+W
Sbjct  56   DKFSNWWGNIKATAISAYEMGRSDPRKVVFAAKMGSALSLVSVLIFFKEPSTYITKHSIW  115

Query  621  AI  626
            AI
Sbjct  116  AI  117



>ref|XP_008446577.1| PREDICTED: aluminum-activated malate transporter 4 [Cucumis melo]
Length=572

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S+R+SF+  +RE LLSR G S   + G+ S      +          D V+  +    +T
Sbjct  7    SIRQSFLDQNREKLLSRKGYS---DLGLNSYDGAGDNVKCRCFRTVSDVVTNLWKGFHDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++K YEMGR DPR   FA KMGL+L+L SL++FF++PL  +G  S+WAI
Sbjct  64   TVKLYEMGRSDPRKFFFAVKMGLSLALASLVIFFRQPLKEVGQYSIWAI  112



>ref|XP_006484436.1| PREDICTED: aluminum-activated malate transporter 4-like [Citrus 
sinensis]
Length=572

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTN--------RGFLHGFRDRVSAFFGDV  470
            S R SF   S+E LLSR G S   ++G+ S   +        R F     D V  F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDASEDGIKCRCF-RWISDGVINFWTNL  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +   I+ Y+MGRKDPR  +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAI
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAI  114



>ref|XP_006437702.1| hypothetical protein CICLE_v10031089mg [Citrus clementina]
 gb|ESR50942.1| hypothetical protein CICLE_v10031089mg [Citrus clementina]
Length=572

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTN--------RGFLHGFRDRVSAFFGDV  470
            S R SF   S+E LLSR G S   ++G+ S   +        R F     D V  F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDASEDGIKCRCF-RWISDGVINFWTNL  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +   I+ Y+MGRKDPR  +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAI
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAI  114



>ref|XP_008350864.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
4-like [Malus domestica]
Length=568

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 64/109 (59%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S   SF   S+E LLSR G S   ++G  S     +    G    F D  + F+ + ++T
Sbjct  7    SFHHSFAERSKERLLSRKGYS---DFGFNSSEAGDEHVKCGCFRRFSDGFNNFYNNFQDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MGR DPR  IFA KMG++L+LVSLL+FFKEPL      S+WAI
Sbjct  64   FIKLYQMGRSDPRKAIFATKMGMSLALVSLLIFFKEPLKNASQYSIWAI  112



>ref|XP_004297128.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462925.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462926.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
Length=583

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   ++G+ S          G+     D +  F   V+E 
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSECGEDRVKCGWFGRMSDGLVNFCNSVQEV  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            S+K Y+MGR DPR   FAAKMGL+L++VSLL+FFKEPL      S+WAI
Sbjct  64   SVKLYQMGRSDPRKAYFAAKMGLSLAIVSLLIFFKEPLKDASQYSIWAI  112



>ref|XP_010102835.1| Aluminum-activated malate transporter 4 [Morus notabilis]
 gb|EXB94195.1| Aluminum-activated malate transporter 4 [Morus notabilis]
Length=580

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGF--LHGFR---DRVSAFFGDVKET  479
            SLR SF+  S+E LLSR G S   ++G+ S     G      FR   D ++  + ++   
Sbjct  7    SLRHSFVEKSKERLLSRKGYS---DFGLQSSDGRDGAAKFWCFRFMSDGITNLWNNLHNM  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             ++ YEMGR DPR  +FA KMGL+L+LVSL++FFKEPL  +   ++WAI
Sbjct  64   FVELYEMGRSDPRKFVFAIKMGLSLALVSLVIFFKEPLKNVSQYAIWAI  112



>ref|XP_004512938.1| PREDICTED: aluminum-activated malate transporter 9-like [Cicer 
arietinum]
Length=597

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  375  SSELEWGIPSQSTNRGF-LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLA  551
            S E  + +P  S  R     GF D +   + +VK  ++ A+EMGR DPR IIF+AKMG+A
Sbjct  45   SDEDYFAVPGNSKRRCCSFRGFSDGIVELWKNVKRVTVSAWEMGRSDPRKIIFSAKMGVA  104

Query  552  lslvsllvffKEPLSYIGSKSVWAI  626
            L L+SLL+F K+P   +G  SVWAI
Sbjct  105  LILISLLIFLKQPFQDVGRYSVWAI  129



>ref|XP_007046271.1| Aluminum activated malate transporter family protein isoform 
1 [Theobroma cacao]
 gb|EOY02103.1| Aluminum activated malate transporter family protein isoform 
1 [Theobroma cacao]
Length=568

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKET  479
            S  RS    S+E LLSR G S   E+G+ S   S +      FR   D ++ F+  ++E+
Sbjct  5    SFLRSSTDESKERLLSRKGYS---EFGLNSSDGSEDGVKCRCFRSCSDSINKFWDGLQES  61

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            S+K YEMG+ DPR + FAAKMG +L++VSLL+FFKEPL      S+WAI
Sbjct  62   SVKLYEMGQSDPRKVFFAAKMGFSLAMVSLLIFFKEPLRNASQYSIWAI  110



>gb|KJB50732.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=538

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%), Gaps = 10/108 (9%)
 Frame = +3

Query  324  RSFM--GASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKETS  482
            RSF+    S+E LL R G S   E+G  S   S +R     FR   D +  F+  ++E  
Sbjct  4    RSFLRGTESKEKLLPRKGYS---EFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELF  60

Query  483  IKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +K YEMGR DPR +IFA KMG +L  +SLL+ FKEPL      S+WAI
Sbjct  61   VKLYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAI  108



>gb|KJB50733.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=556

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = +3

Query  324  RSFM--GASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIK  488
            RSF+    S+E LL R G  SE  +     S +R     FR   D +  F+  ++E  +K
Sbjct  4    RSFLRGTESKEKLLPRKG-YSEFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELFVK  62

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             YEMGR DPR +IFA KMG +L  +SLL+ FKEPL      S+WAI
Sbjct  63   LYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAI  108



>ref|XP_006341623.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
tuberosum]
Length=604

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 69/114 (61%), Gaps = 10/114 (9%)
 Frame = +3

Query  309  SESLRRSFMGA-SREGLLS--RGGCSSELEWGIPS----QSTNRGFLHGFRDRVSAFFGD  467
            S S R+SF     +E LLS   G   +EL  G P     Q T+ G    FR++ S  + D
Sbjct  5    SNSFRKSFEDRRVKERLLSLCNGVDYTELP-GFPHSLDYQETS-GCCSSFREKFSELWKD  62

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEP-LSYIGSKSVWAI  626
             K  S+KA EMGR DPR IIF+AKMGLAL L+SL +FFKEP +  +G  SVWAI
Sbjct  63   WKRVSVKAMEMGRTDPRKIIFSAKMGLALILMSLFIFFKEPAVKELGKYSVWAI  116



>gb|KJB50731.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=562

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = +3

Query  324  RSFM--GASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIK  488
            RSF+    S+E LL R G  SE  +     S +R     FR   D +  F+  ++E  +K
Sbjct  4    RSFLRGTESKEKLLPRKG-YSEFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELFVK  62

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             YEMGR DPR +IFA KMG +L  +SLL+ FKEPL      S+WAI
Sbjct  63   LYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAI  108



>ref|XP_007222460.1| hypothetical protein PRUPE_ppa003480mg [Prunus persica]
 gb|EMJ23659.1| hypothetical protein PRUPE_ppa003480mg [Prunus persica]
Length=571

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   ++G+ S  T       G      D  + F    ++T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSETGDDHVKCGCFRAVSDGFNNFCKSFQDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  +FAAKMG +LS+VSLL+FFKEPL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAVFAAKMGTSLSIVSLLIFFKEPLKDVSQYSIWAI  112



>ref|XP_011021871.1| PREDICTED: aluminum-activated malate transporter 4 [Populus euphratica]
 ref|XP_011021877.1| PREDICTED: aluminum-activated malate transporter 4 [Populus euphratica]
Length=555

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKE  476
            SLR SF   S+E L+SR      G   SE +     ++  R       DR+ +F+  V+ 
Sbjct  7    SLRHSFEERSKERLISRKEYPDFGLNRSEND----EEAGKRRCFASLSDRIVSFWNGVRN  62

Query  477  TSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++I+ YEMG+ DPR   FA KMGL+L+LVSL++F KEPL  +   S+WAI
Sbjct  63   SAIELYEMGQADPRKYFFAVKMGLSLALVSLVIFLKEPLKDVSQYSIWAI  112



>ref|XP_008243200.1| PREDICTED: aluminum-activated malate transporter 4-like [Prunus 
mume]
Length=571

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   ++G+ S  T       G      D  + F    ++T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSETGDDHVKCGCFRAVSDGFNNFCKSFQDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  +FA KMG++LS+VSLL+FFKEPL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAVFAVKMGMSLSIVSLLIFFKEPLKDVSQYSIWAI  112



>ref|XP_009616234.1| PREDICTED: aluminum-activated malate transporter 9 [Nicotiana 
tomentosiformis]
Length=601

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSR-GGCSSELEWGIPS--QSTNRGFLHGFRDRVSAFFGDVKETSI  485
            S R+SF    RE L S   G  +EL    P+     N G    FR++    + D    ++
Sbjct  7    SFRKSF-EEKRERLFSSCNGDYTELPGFNPTLDYPENPGCFSSFREKFRELWKDWSSVAV  65

Query  486  KAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            KA EMGR DPR I+F+AKMGLAL L+SLL+FFKEP+  +   SVWAI
Sbjct  66   KAMEMGRSDPRKIVFSAKMGLALMLISLLIFFKEPVEELSRYSVWAI  112



>gb|KHG13463.1| Aluminum-activated malate transporter 6 -like protein [Gossypium 
arboreum]
Length=380

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRX  521
            S+E LLS+ GCS     G   +   RG           F+   ++ S K Y+MGR DPR 
Sbjct  12   SKERLLSKKGCSG---LGAADEGAKRGCFRSCCGSTDNFWNGFQQVSAKLYKMGRSDPRK  68

Query  522  IIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + FA KMGL+L++VSLL+ FKEPL  +   SVWAI
Sbjct  69   VFFAMKMGLSLTVVSLLMLFKEPLRGVSQYSVWAI  103



>emb|CAN68659.1| hypothetical protein VITISV_002161 [Vitis vinifera]
Length=559

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS----QSTNRGFLHGFR-DRVSAFFGDVKET  479
            S R SF+  S+E LLSR G S   E+G+ S        +     +R D +  F+  +++T
Sbjct  7    SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + + +EM R DPR + FAAKMGL+L++VSL +F KEPL  +   S+WAI
Sbjct  64   ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAI  112



>ref|XP_002278978.1| PREDICTED: aluminum-activated malate transporter 4 [Vitis vinifera]
Length=583

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS----QSTNRGFLHGFR-DRVSAFFGDVKET  479
            S R SF+  S+E LLSR G S   E+G+ S        +     +R D +  F+  +++T
Sbjct  7    SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + + +EM R DPR + FAAKMGL+L++VSL +F KEPL  +   S+WAI
Sbjct  64   ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAI  112



>emb|CBI27043.3| unnamed protein product [Vitis vinifera]
Length=1070

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS----QSTNRGFLHGFR-DRVSAFFGDVKET  479
            S R SF+  S+E LLSR G S   E+G+ S        +     +R D +  F+  +++T
Sbjct  494  SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  550

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + + +EM R DPR + FAAKMGL+L++VSL +F KEPL  +   S+WAI
Sbjct  551  ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAI  599



>ref|XP_002312386.2| hypothetical protein POPTR_0008s11740g [Populus trichocarpa]
 gb|EEE89753.2| hypothetical protein POPTR_0008s11740g [Populus trichocarpa]
Length=556

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 5/108 (5%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  482
            SLR SF   S+E L+SR        +  E  I      R F     DR+ +F+  V+ ++
Sbjct  7    SLRHSFEERSKERLISRKEYPDFGLNRSENDIEEAGKCRCF-GSLSDRIVSFWNGVRNSA  65

Query  483  IKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            I+ Y+MG+ DPR  +FA KMGL+L+LVSL++F KEPL  +   S+WAI
Sbjct  66   IELYKMGQADPRKYLFAVKMGLSLALVSLVIFLKEPLKDVSQYSIWAI  113



>gb|KDP20105.1| hypothetical protein JCGZ_05874 [Jatropha curcas]
Length=587

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 10/99 (10%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS---QSTNRGFLHGFR---DRVSAFFGDVKE  476
            S R +F    RE LLS  G S   E G P+   +  N      +R   D V+ F   V++
Sbjct  7    SFRYTF-AEKRERLLSTKGYS---EIGFPNIYEEQYNSRNCCSYRFWCDNVAGFCRSVQD  62

Query  477  TSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPL  593
             +IKAYEMGR DPR I+FAAKMGLAL L+S+L+F KEP+
Sbjct  63   VAIKAYEMGRSDPRKIVFAAKMGLALMLISMLIFLKEPI  101



>ref|XP_010102834.1| Aluminum-activated malate transporter 4 [Morus notabilis]
 gb|EXB94194.1| Aluminum-activated malate transporter 4 [Morus notabilis]
Length=583

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +3

Query  309  SESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-GFLHGFR------DRVSAFFGD  467
            S  L   F   S+E LL      S+    I   S +R G  + FR      D ++ F+ +
Sbjct  2    SAKLEPCFAKKSKERLLLPRKVFSDFSLPIAGSSDDRDGSANEFRCFRSMSDGIANFWNN  61

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
            + +T ++ YEMGR DPR + FAAK+GLAL++VSL +FFKEPL  I   ++WA
Sbjct  62   LHKTLVQLYEMGRSDPRKVAFAAKVGLALAIVSLAIFFKEPLKDINQYAIWA  113



>ref|XP_006374353.1| hypothetical protein POPTR_0015s06340g [Populus trichocarpa]
 gb|ERP52150.1| hypothetical protein POPTR_0015s06340g [Populus trichocarpa]
Length=587

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = +3

Query  324  RSFMGASREGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIK  488
            R  +   RE LLS   C SE+     +  +   + N        D++      V++ + +
Sbjct  9    RHSLAEKRERLLSTTKCYSEIVFPNIQEDLDEPTRNCCSYRFLSDKIVGLCKQVQDVAYR  68

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             Y+MG+ DPR I+F+AKMGLAL L+SLL+F KEP+  +    VWAI
Sbjct  69   GYQMGKSDPRKIVFSAKMGLALMLISLLIFLKEPIKELSQHFVWAI  114



>ref|XP_010027833.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW54460.1| hypothetical protein EUGRSUZ_I00408 [Eucalyptus grandis]
Length=571

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIP-SQSTNRGF----LHGFRDRVSAFFGDVKET  479
            S R SF+  S+E LLSR   S   ++G+  +  ++ G          D V   +  +++ 
Sbjct  7    SFRHSFLERSKERLLSRKEYS---DFGMTDADGSDYGVKCRCFRSISDWVVNCWNGLQDV  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             +K YEMGR DPR  +FA KMGL+L+LVSL++FFKEPL+ +   S+WAI
Sbjct  64   VVKLYEMGRSDPRKFVFAVKMGLSLALVSLVIFFKEPLADVSQYSIWAI  112



>ref|XP_007036504.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
 gb|EOY21005.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
Length=583

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +3

Query  417  RGFLHGF-RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPL  593
            R F + F  D+++ F+ DV++ + +A++MG+ DPR IIF+AKMGLAL L+S L+F KEP 
Sbjct  41   RCFSYRFISDKITGFWKDVQDVAGEAWQMGKSDPRKIIFSAKMGLALMLISFLIFLKEPF  100

Query  594  SYIGSKSVWAI  626
              +   SVWAI
Sbjct  101  KELSQYSVWAI  111



>gb|KHG29903.1| Aluminum-activated malate transporter 4 -like protein [Gossypium 
arboreum]
Length=562

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = +3

Query  324  RSFM--GASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIK  488
            RSF+    S+E LL R G  SE  +     S +R     FR   D +  F+  ++   +K
Sbjct  4    RSFLRGTESKERLLPRKG-YSEFGFNSSDVSEDRVKCRCFRSCCDSIDNFWSGLQGLFVK  62

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             YEMGR DPR +IFA KMG +L  +SLL+ FKEPL      S+WAI
Sbjct  63   LYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAI  108



>gb|EPS71908.1| hypothetical protein M569_02848, partial [Genlisea aurea]
Length=494

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
             R+  SA++ +    +I +YEMGR DPR ++FAAK+GLALSLVSLL+FFKEP +YI    
Sbjct  5    LREGTSAWWKNASAIAITSYEMGRSDPRKVVFAAKVGLALSLVSLLIFFKEPSTYITKHY  64

Query  615  VWAI  626
            VWAI
Sbjct  65   VWAI  68



>ref|XP_009764790.1| PREDICTED: aluminum-activated malate transporter 9 [Nicotiana 
sylvestris]
Length=645

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  414  NRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPL  593
            N G    FR++    + D    ++KA EMGR DPR I+F+AKMGLAL L+SLL+FFKEP+
Sbjct  87   NLGCFSYFREKFREVWKDWSSVAVKAMEMGRSDPRKIVFSAKMGLALMLISLLIFFKEPV  146

Query  594  SYIGSKSVWAI  626
              +   SVWAI
Sbjct  147  EELSRYSVWAI  157



>ref|XP_010318605.1| PREDICTED: aluminum-activated malate transporter 9 [Solanum lycopersicum]
Length=609

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  420  GFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEP-LS  596
            G    FR+R S  + D K  S+KA EMGR DPR IIF+AKMGLAL L+SLL+FFKEP + 
Sbjct  49   GCCSSFRERFSELWKDWKRVSVKAMEMGRTDPRKIIFSAKMGLALILISLLIFFKEPAVK  108

Query  597  YIGSKSVWAI  626
             +G  SVWAI
Sbjct  109  ELGKYSVWAI  118



>gb|KDP29386.1| hypothetical protein JCGZ_18307 [Jatropha curcas]
Length=562

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQS---------TNRGFLHGFRDRVSAFFGD  467
            SLR +F   S+E LLSR    S   +G+ S             R FL  F D +   +G 
Sbjct  7    SLRHNFAETSKERLLSRNNIYSN--FGLNSSEGGDDQDGSFKCRCFL-SFSDWIINLWGR  63

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSY--IGSKSVWAI  626
             K  +I+ Y MGR DPR ++F  KMGL+L+LVSL++FFKEPL    +   S+WAI
Sbjct  64   TKAAAIELYNMGRTDPRKVVFGIKMGLSLALVSLVIFFKEPLKIRNVNQYSIWAI  118



>gb|KJB50413.1| hypothetical protein B456_008G169600 [Gossypium raimondii]
Length=540

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 3/95 (3%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRX  521
            S+E LLS+ GCS     G   +    G           F+   ++ S K Y+MGR DPR 
Sbjct  12   SKERLLSKKGCSG---LGGAEEGAKSGCFRSCCGSTDNFWNGFQQVSAKLYKMGRSDPRK  68

Query  522  IIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + FA KMGL+L++VSLL+ FKEPL  +   SVWAI
Sbjct  69   VFFAMKMGLSLTVVSLLMLFKEPLRGVSQYSVWAI  103



>ref|XP_010681586.1| PREDICTED: aluminum-activated malate transporter 4 [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 17/121 (14%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCS----------SELEWGIPS----QSTNRGFLHGFR---D  443
            SLR+SF+  S+E  LSR G S          +EL  G+       + NR  +  +R   D
Sbjct  7    SLRQSFIERSKEKFLSRKGYSELGFSASDGETELNDGVKCGCFGSTCNRAKVGCYRWICD  66

Query  444  RVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
             +   F   ++  +  YEMGR DPR + F+AKMGL LSLVSLL+FF  PL  I   ++WA
Sbjct  67   GILGLFNGFRDFGVNLYEMGRSDPRKVFFSAKMGLCLSLVSLLIFFTGPLKDISQYAIWA  126

Query  624  I  626
            I
Sbjct  127  I  127



>ref|XP_006441921.1| hypothetical protein CICLE_v10023819mg [Citrus clementina]
 gb|ESR55161.1| hypothetical protein CICLE_v10023819mg [Citrus clementina]
Length=502

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (65%), Gaps = 12/102 (12%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR--------DRVSAFFGDV  470
            S R SF   S+E LLSR G S   ++G+ S + + G   G +        D V+ F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNS-TDDDGSEDGIKCRCFRWISDGVTNFWTNL  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLS  596
            +   I+ Y+MGRKDPR  +FAAKMGL+L+LVSL+VFFKEPLS
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLS  104



>ref|XP_006440948.1| hypothetical protein CICLE_v10019485mg [Citrus clementina]
 gb|ESR54188.1| hypothetical protein CICLE_v10019485mg [Citrus clementina]
Length=574

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = +3

Query  333  MGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR--------DRVSAFFGDVKETSIK  488
            +G+ RE LLS  G  S++  G+ +  ++       R        DRV++F   +++  + 
Sbjct  5    IGSLREKLLSTKG-HSDIGLGLKTTVSSESVEQPVRCWPYRFVCDRVTSFLKTLQDGFVG  63

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            A + G+ DPR I+FAAKM LAL+L+SLL F KEP   +G  SVWAI
Sbjct  64   AVQTGKNDPRKIVFAAKMALALTLISLLSFMKEPFPDLGRYSVWAI  109



>ref|XP_009360165.1| PREDICTED: aluminum-activated malate transporter 9-like [Pyrus 
x bretschneideri]
Length=142

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query  345  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSPRCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            DPR I+FA KMGLAL +VSLL+F KEP   +   SVWAI
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAI  114



>ref|XP_006485776.1| PREDICTED: aluminum-activated malate transporter 9-like [Citrus 
sinensis]
Length=574

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = +3

Query  333  MGASREGLLSRGGCSSE---LEWGIPSQSTN---RGFLHGFR-DRVSAFFGDVKETSIKA  491
            +G+ RE LLS  G S     L+  + S+S     R + + F  DRV++F   +++  + A
Sbjct  5    IGSLREKLLSTKGHSDIGPGLKTTVSSESVEQPVRCWPYRFVCDRVTSFLKTLQDGFVGA  64

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             + G+ DPR I+FAAKM LAL+L+SLL F KEP   +G  SVWAI
Sbjct  65   VQTGKNDPRKIVFAAKMALALTLISLLSFMKEPFPDLGRYSVWAI  109



>ref|XP_009356494.1| PREDICTED: aluminum-activated malate transporter 4 isoform X1 
[Pyrus x bretschneideri]
Length=568

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   + G  S     +    G      D  + F  + + T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DLGFNSSEAGDEHVKCGCFRRISDGFNNFCNNFQGT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  IFA KMGL+L+LVSLL+FFK PL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAIFAIKMGLSLALVSLLIFFKVPLKDVSQYSIWAI  112



>ref|XP_009356502.1| PREDICTED: aluminum-activated malate transporter 4 isoform X2 
[Pyrus x bretschneideri]
Length=500

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   + G  S     +    G      D  + F  + + T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DLGFNSSEAGDEHVKCGCFRRISDGFNNFCNNFQGT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  IFA KMGL+L+LVSLL+FFK PL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAIFAIKMGLSLALVSLLIFFKVPLKDVSQYSIWAI  112



>ref|XP_010932631.1| PREDICTED: aluminum-activated malate transporter 9-like [Elaeis 
guineensis]
 ref|XP_010932632.1| PREDICTED: aluminum-activated malate transporter 9-like [Elaeis 
guineensis]
Length=578

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIP---SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKD  512
            S+E LLS   C  E EWG      +   RG L    D ++  +G   E  ++ +  GR D
Sbjct  16   SKERLLS--SCHEEGEWGFALDFDEEEERGCLRRIGDGIAGMWGKAWELVVRLWNFGRSD  73

Query  513  PRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            PR +IF AK+GLAL+L S ++F KEP   +   SVWAI
Sbjct  74   PRKVIFGAKVGLALTLTSFIIFLKEPSIDLTKNSVWAI  111



>gb|KHG02535.1| Aluminum-activated malate transporter 9 -like protein [Gossypium 
arboreum]
Length=581

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            D+V+ F   V++ ++KA++MG  DPR I+F+AK+GLAL L+SLL+F KEP+  +   SVW
Sbjct  46   DKVTGFSKKVQDVALKAWQMGISDPRKIVFSAKVGLALMLISLLIFLKEPIKELSEHSVW  105

Query  621  AI  626
            AI
Sbjct  106  AI  107



>ref|XP_004298293.1| PREDICTED: aluminum-activated malate transporter 4-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIP-SQSTNRGFLH-GFRDRVSA----FFGDVKE  476
            S R SF   S+E LLSR G S   ++GI  SQ +    +  G+  R+S     F  +V +
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGINNSQCSEEEIVKCGWFGRMSEGFVNFCNNVPQ  63

Query  477  TSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             S+K Y+MG  DPR   FA KMGL+L++VSLL+FFKEPL      S+WAI
Sbjct  64   VSVKLYKMGSSDPRKAYFAGKMGLSLAIVSLLIFFKEPLKGASQYSIWAI  113



>ref|XP_010460370.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=566

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    TREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>ref|XP_008361730.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Malus domestica]
Length=568

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 58/109 (53%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   + G  S     +    G      D    F  + + T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DLGFNSSEAGDEXVKCGCFRRISDGFXNFCNNFQGT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  IFA KMGL L+LVSLL+FFK PL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAIFAIKMGLTLALVSLLIFFKVPLKDVSQYSIWAI  112



>ref|XP_010480664.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=454

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    NREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>ref|XP_008361731.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Malus domestica]
Length=500

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 58/109 (53%), Gaps = 8/109 (7%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  479
            S R SF   S+E LLSR G S   + G  S     +    G      D    F  + + T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DLGFNSSEAGDEXVKCGCFRRISDGFXNFCNNFQGT  63

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             IK Y+MG  DPR  IFA KMGL L+LVSLL+FFK PL  +   S+WAI
Sbjct  64   FIKLYQMGHSDPRKAIFAIKMGLTLALVSLLIFFKVPLKDVSQYSIWAI  112



>ref|XP_010499104.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=566

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    NREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>gb|EYU40877.1| hypothetical protein MIMGU_mgv1a0220201mg, partial [Erythranthe 
guttata]
Length=100

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  426  LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIG  605
               FRD+++  + +  + S KA EMG+KDPR II+A K G AL+ VSL +F+K+PL  + 
Sbjct  23   FQSFRDKITQLWSNSCDFSKKALEMGKKDPRKIIYAIKSGFALAFVSLFIFWKKPLPDVS  82

Query  606  SKSVWAI  626
              S+WAI
Sbjct  83   QFSIWAI  89



>ref|XP_002278994.2| PREDICTED: aluminum-activated malate transporter 9 [Vitis vinifera]
 ref|XP_010647826.1| PREDICTED: aluminum-activated malate transporter 9 [Vitis vinifera]
Length=535

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +3

Query  444  RVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
            ++  F+  V++ S KA+EMGR DPR IIFA KMGLALSLVSLL+F+KEP + +G  S+WA
Sbjct  46   KLKNFWNSVQDVSWKAWEMGRSDPRKIIFAMKMGLALSLVSLLIFWKEP-ADVGQYSIWA  104

Query  624  I  626
            I
Sbjct  105  I  105



>gb|ACU18485.1| unknown [Glycine max]
Length=114

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            D   +++   K  + KA EMGR DPR IIF+AK+GLAL+++SLL+F KEP + + S  VW
Sbjct  46   DEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCVW  105

Query  621  AI  626
            AI
Sbjct  106  AI  107



>ref|XP_002529137.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33250.1| conserved hypothetical protein [Ricinus communis]
Length=574

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFL--HGFR---DRVSAFFGDVKET  479
            S R SF   S+E LLSR G  S+ +          G +    FR   D+++     + + 
Sbjct  7    SFRHSFAERSKERLLSRKG-YSDFDLNSSYGGGEGGVIKCRCFRLLCDQINNSRNAIHDA  65

Query  480  SIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             ++ Y MGR DPR + FA KMGL+L+LVSL++F KEPL  +   S+WAI
Sbjct  66   VVELYNMGRTDPRKVFFAVKMGLSLALVSLVIFLKEPLKNVNQYSIWAI  114



>ref|XP_010094774.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB56939.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=608

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 63/120 (53%), Gaps = 18/120 (15%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-------------GFLHGFRDRVSA  455
            S R +F+   RE LLS     SEL   +P++S                GFL  FR     
Sbjct  7    SFRYNFV-EKRERLLSMNKGYSELAGFLPTESDEENQLASSPSRCCGCGFL-SFRSVSDG  64

Query  456  FFG---DVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             F      +E   KA+EMGR DPR I+F+AKMGLAL L+SLL++ +EP   +   SVWAI
Sbjct  65   LFRRYRTAQEVLHKAWEMGRSDPRKIVFSAKMGLALMLISLLIYLREPFKDLSRYSVWAI  124



>ref|XP_008367579.1| PREDICTED: aluminum-activated malate transporter 9-like [Malus 
domestica]
Length=597

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query  345  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSARCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            DPR I+FA KMGLAL +VSLL+F KEP   +   SVWAI
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAI  114



>ref|XP_008374744.1| PREDICTED: aluminum-activated malate transporter 9 [Malus domestica]
Length=602

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = +3

Query  345  REGLLS--RGGCSSEL-------EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYE  497
            RE LLS  +G   SEL       E    S ST         DR+  +   V+  S +A +
Sbjct  16   RERLLSVQKGYSYSELGGFPNIEEQDPSSGSTRCCTFRSVSDRIVGWCRTVQHVSKRAVK  75

Query  498  MGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            MG+ DPR IIFAAKMGLAL ++SLL+F KEP   +   SVWAI
Sbjct  76   MGQSDPRKIIFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAI  118



>ref|XP_006307134.1| hypothetical protein CARUB_v10008724mg [Capsella rubella]
 gb|EOA40032.1| hypothetical protein CARUB_v10008724mg [Capsella rubella]
Length=565

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +REGLL R GCS   ++G    S     R     FR   D ++A +    + + K YEMG
Sbjct  5    TREGLLPRKGCS---DFGFNDSSIIDDRRSKFRCFRFFSDGITASWMAFYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>ref|XP_009360189.1| PREDICTED: aluminum-activated malate transporter 9-like, partial 
[Pyrus x bretschneideri]
Length=364

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +3

Query  345  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSPRCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            DPR I+FA KMGLAL +VSLL+F KEP   +   SVWAI
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAI  114



>emb|CBI15440.3| unnamed protein product [Vitis vinifera]
Length=549

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 12/112 (11%)
 Frame = +3

Query  315  SLRRSFMGA-SREGLLSRGGCSS-------ELEWGIPSQSTNRGFLHGFRDRVSAFFGDV  470
            S R +F     R+ LLS  G S        E E   P   + R   H F +    ++   
Sbjct  7    SFRHTFAEKRERDRLLSCKGYSELGFVHLEENEEATPRWCSFRSIRHKFAN----WWKTT  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            K+ + K +EMG  DPR I+F+AKMGLAL L++LL+F KEP+  +G  SVWAI
Sbjct  63   KDVAAKGWEMGLSDPRKIVFSAKMGLALMLITLLIFLKEPVKDLGRYSVWAI  114



>ref|XP_002893421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69680.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=567

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +RE LLSR GCS   ++G    S     R     FR   D ++A +  + + + K YEMG
Sbjct  5    TREALLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGITASWKALYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + F+ KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>ref|XP_010477920.1| PREDICTED: aluminum-activated malate transporter 4 [Camelina 
sativa]
Length=566

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +RE LLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    TREALLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>ref|XP_008240281.1| PREDICTED: aluminum-activated malate transporter 9 [Prunus mume]
Length=596

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 56/103 (54%), Gaps = 13/103 (13%)
 Frame = +3

Query  345  REGLLSRGGCSSEL---------EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYE  497
            RE LLS     SEL          +G P   T R       DR+ ++   V+  S +A  
Sbjct  16   RERLLSTQKDYSELGFVHIEEQEPYGSPRCCTFRSV----SDRIMSWCRTVQNVSNRAIR  71

Query  498  MGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            MG+ DPR I+FAAKMGLAL ++SLL+F KEP   +   SVWAI
Sbjct  72   MGQSDPRKIVFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAI  114



>ref|XP_008812805.1| PREDICTED: aluminum-activated malate transporter 5-like [Phoenix 
dactylifera]
Length=579

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGI----PSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            S+EGLLS      E EWG+      +   RG L      ++  +G  +E   K ++ GR 
Sbjct  16   SKEGLLS--SFLKEGEWGVGLDFDEEEEKRGCLRRLGAGIAGMWGKARELVEKGWKFGRS  73

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            DPR ++F AKMGLAL+L S ++F KEP   +   SVWAI
Sbjct  74   DPRKVVFGAKMGLALTLTSFIIFLKEPSMDLTKHSVWAI  112



>ref|XP_002275995.1| PREDICTED: aluminum-activated malate transporter 9-like [Vitis 
vinifera]
Length=588

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 12/112 (11%)
 Frame = +3

Query  315  SLRRSFMGA-SREGLLSRGGCSS-------ELEWGIPSQSTNRGFLHGFRDRVSAFFGDV  470
            S R +F     R+ LLS  G S        E E   P   + R   H F +    ++   
Sbjct  7    SFRHTFAEKRERDRLLSCKGYSELGFVHLEENEEATPRWCSFRSIRHKFAN----WWKTT  62

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            K+ + K +EMG  DPR I+F+AKMGLAL L++LL+F KEP+  +G  SVWAI
Sbjct  63   KDVAAKGWEMGLSDPRKIVFSAKMGLALMLITLLIFLKEPVKDLGRYSVWAI  114



>ref|XP_011084604.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X3 [Sesamum indicum]
Length=445

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +3

Query  303  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  467
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            VK T++ A+EMGR DPR +IFAAKMG ALSLVS+L+FF++  SY     +WAI
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAI  112



>ref|XP_011084603.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Sesamum indicum]
Length=451

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +3

Query  303  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  467
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            VK T++ A+EMGR DPR +IFAAKMG ALSLVS+L+FF++  SY     +WAI
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAI  112



>ref|XP_010487770.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Camelina sativa]
Length=599

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
               DR+S  F  VK+ + KA++MG  DPR I+F+AK+GLAL +V+LL+FF+EP   +   
Sbjct  61   NLSDRISGVFDGVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRY  120

Query  612  SVWAI  626
            SVWAI
Sbjct  121  SVWAI  125



>ref|XP_010487771.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Camelina sativa]
Length=583

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
               DR+S  F  VK+ + KA++MG  DPR I+F+AK+GLAL +V+LL+FF+EP   +   
Sbjct  61   NLSDRISGVFDGVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRY  120

Query  612  SVWAI  626
            SVWAI
Sbjct  121  SVWAI  125



>ref|XP_007160366.1| hypothetical protein PHAVU_002G315500g [Phaseolus vulgaris]
 gb|ESW32360.1| hypothetical protein PHAVU_002G315500g [Phaseolus vulgaris]
Length=576

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  459  FGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +  VK+ ++KA++MGR DPR +IF+ KMGLAL+L+S L++ KEP   +   SVWAI
Sbjct  53   WNTVKQVAVKAWDMGRSDPRKVIFSVKMGLALTLISFLIYLKEPFKELIRYSVWAI  108



>ref|XP_011084602.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Sesamum indicum]
Length=569

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +3

Query  303  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  467
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            VK T++ A+EMGR DPR +IFAAKMG ALSLVS+L+FF++  SY     +WAI
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAI  112



>ref|XP_002314876.2| hypothetical protein POPTR_0010s13750g [Populus trichocarpa]
 gb|EEF01047.2| hypothetical protein POPTR_0010s13750g [Populus trichocarpa]
Length=513

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  321  RRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEM  500
            R +++ +S+E     G  S ++E     Q+    +L+   +++S    D +E +++A+EM
Sbjct  5    RHNYVESSKEWQPLLGSLSGDVE-----QAGKCKYLNLLSEKISKSLNDFQEFAVRAWEM  59

Query  501  GRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            GR DP+ +IFA KMGLALS+VSLL+F+K     I   S+WAI
Sbjct  60   GRSDPKKVIFAIKMGLALSIVSLLIFWKGSNEDISQYSIWAI  101



>ref|XP_009410081.1| PREDICTED: aluminum-activated malate transporter 4-like [Musa 
acuminata subsp. malaccensis]
Length=579

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRG-FLHGFRDRVSAFFGDVKETSIKA  491
            S   +F   S+E LLS    S+ L       ST +G       DR++A +  ++  +++ 
Sbjct  7    SFHYNFEQRSKERLLS----STLLPHLYDDPSTRQGGCFRRLADRIAAAWAFIRWLAVEG  62

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +E GR DPR ++FAAKMGLAL+L+SLL+F +EP   +   SVWAI
Sbjct  63   WEFGRSDPRKVVFAAKMGLALTLISLLIFLREPFRDLTKYSVWAI  107



>emb|CDX84992.1| BnaC05g20630D [Brassica napus]
Length=546

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 50/99 (51%), Gaps = 18/99 (18%)
 Frame = +3

Query  330  FMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            F   +RE LLSR GCS                  GF D  S    D + +  + YEMGR 
Sbjct  2    FGDHTRESLLSRKGCSD----------------FGFND--SGIISDDRRSKWRLYEMGRS  43

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  44   DRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAI  82



>ref|XP_006362575.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
tuberosum]
Length=327

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
            R+    +F ++++ + KA EMG+ DPR IIF+ KMG AL  VSLL+F+KEP   I   S+
Sbjct  27   RNGYCIYFNNIQDFAKKAIEMGKNDPRKIIFSLKMGFALFFVSLLIFWKEPFPEIAQFSI  86

Query  618  WAI  626
            WAI
Sbjct  87   WAI  89



>emb|CDY18521.1| BnaA01g26740D [Brassica napus]
Length=665

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 14/113 (12%)
 Frame = +3

Query  327  SFMGASREGLLSRGGCSSELEWG-IPSQSTNRGFLHG------------FRDRVSAFFGD  467
            SF    RE LLS  G S +L +G I S     G  HG               ++S  + D
Sbjct  94   SFRNGKRERLLSNNGFS-DLRFGDIESNDLLEGDSHGRTRLCCCCSCGNISGKISGVYED  152

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             K+ + KA+ MG  DPR I+F+AK+GLAL++V++L+F++EP   +   SVWAI
Sbjct  153  AKDVARKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAI  205



>gb|KJB37235.1| hypothetical protein B456_006G195100 [Gossypium raimondii]
Length=582

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            D+V+ F   V++ + KA +MG  DPR I+F+AK+GLAL L+SLL+F KEP+  +   SVW
Sbjct  47   DKVTGFSKKVQDVARKACQMGISDPRKIVFSAKVGLALMLISLLIFLKEPIKELSEHSVW  106

Query  621  AI  626
            AI
Sbjct  107  AI  108



>ref|XP_004238944.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
lycopersicum]
Length=524

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
            R+    +F ++++ + KA EMG+ DPR IIF+ KMG AL  VSLL+F+KEP   I   S+
Sbjct  28   RNGCCIYFNNIQDFAKKAIEMGKNDPRKIIFSLKMGFALFFVSLLIFWKEPFPEIAQFSI  87

Query  618  WAI  626
            WAI
Sbjct  88   WAI  90



>ref|XP_004138239.1| PREDICTED: aluminum-activated malate transporter 9-like [Cucumis 
sativus]
 gb|KGN63811.1| hypothetical protein Csa_1G022500 [Cucumis sativus]
Length=579

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  491
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFNAIQTIHENPSCCSSVSHRFSYIWNSVQDVLYKA  65

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++MG  DPR I+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAI
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAI  110



>ref|XP_004170574.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
9-like [Cucumis sativus]
Length=579

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  491
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFNAIQTIHENPSCCSSVSHRFSYIWNSVQDVLYKA  65

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++MG  DPR I+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAI
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAI  110



>ref|XP_006406604.1| hypothetical protein EUTSA_v10020343mg [Eutrema salsugineum]
 dbj|BAJ34033.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48057.1| hypothetical protein EUTSA_v10020343mg [Eutrema salsugineum]
Length=597

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 11/105 (10%)
 Frame = +3

Query  345  REGLLSRGGCS----SELEWGIPSQSTNRGFLH-------GFRDRVSAFFGDVKETSIKA  491
            RE LLS  G S    +++E     +S N G             +++S  + D K+   KA
Sbjct  16   REKLLSNNGFSDFRFTDIESNDLLESENYGRTRFCCCSCGNLSEKISGMYQDAKDVGRKA  75

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +EMG  DPR I+F+AK+GLAL++V++L+FF+EP   +   SVWAI
Sbjct  76   WEMGVSDPRKIVFSAKIGLALTIVAVLIFFQEPNPDLSRYSVWAI  120



>ref|XP_002883132.1| hypothetical protein ARALYDRAFT_898211 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59391.1| hypothetical protein ARALYDRAFT_898211 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 64/113 (57%), Gaps = 12/113 (11%)
 Frame = +3

Query  324  RSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLH--------GFRDRVSAFFGD  467
            R  +   RE LLS  G S    +++E     ++ N G              D++S  + D
Sbjct  9    RHVILEKRERLLSNNGFSDFRFTDIESNDLLENENYGRTRLCCCCSCGNLSDKISGVYQD  68

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             K+ + KA++MG  DPR I+F+AK+GLAL++V+LL+F++EP   +   SVWAI
Sbjct  69   AKDVARKAWDMGVSDPRKIVFSAKIGLALTIVALLIFYQEPNPDLSRYSVWAI  121



>emb|CDY42102.1| BnaA09g28580D [Brassica napus]
Length=546

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 50/99 (51%), Gaps = 18/99 (18%)
 Frame = +3

Query  330  FMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            F   +R+ LLSR GCS                  GF D  S    D + +  + YEMGR 
Sbjct  2    FGDQTRDALLSRKGCSD----------------FGFND--SGIISDDRRSKWRLYEMGRS  43

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  44   DRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAI  82



>ref|XP_010265178.1| PREDICTED: aluminum-activated malate transporter 9 [Nelumbo nucifera]
Length=584

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 64/112 (57%), Gaps = 13/112 (12%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGF--LHGFR------DRVSAFFGDV  470
            S +  F   SRE LLS  G  SEL + I     N G     G+R      + +   +  +
Sbjct  7    SFKSVFAEKSRERLLSNKGGYSELGFCI-----NDGVDETKGWRWCCSPIEVIVNSWTTL  61

Query  471  KETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             +++IK +E GR DPR  IFAAK GLAL L++LL+F++EP   +G+ SVWAI
Sbjct  62   SQSAIKLWEFGRSDPRKAIFAAKGGLALVLITLLIFYREPFKDLGTYSVWAI  113



>ref|XP_008453386.1| PREDICTED: aluminum-activated malate transporter 9 [Cucumis melo]
Length=579

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  491
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFSAIQTIHENPSCCSSVFHRFSYIWNSVQDVLYKA  65

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++MG  DPR I+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAI
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAI  110



>ref|XP_006297257.1| hypothetical protein CARUB_v10013270mg [Capsella rubella]
 gb|EOA30155.1| hypothetical protein CARUB_v10013270mg [Capsella rubella]
Length=602

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            +++S  F +VK+ + KA++MG  DPR I+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  64   EKISGVFNEVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  123

Query  621  AI  626
            AI
Sbjct  124  AI  125



>ref|NP_188473.1| aluminum-activated malate transporter 9 [Arabidopsis thaliana]
 sp|Q9LS46.1|ALMT9_ARATH RecName: Full=Aluminum-activated malate transporter 9; Short=AtALMT9 
[Arabidopsis thaliana]
 dbj|BAB01110.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20514.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15577.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76098.1| aluminum-activated malate transporter 9 [Arabidopsis thaliana]
Length=598

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
               +++S  + D K+ + KA+EMG  DPR I+F+AK+GLAL++V+LL+F++EP   +   
Sbjct  58   NLSEKISGVYDDAKDVARKAWEMGVSDPRKIVFSAKIGLALTIVALLIFYQEPNPDLSRY  117

Query  612  SVWAI  626
            SVWAI
Sbjct  118  SVWAI  122



>gb|KHN20718.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=596

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = +3

Query  315  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  461
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  462  GDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
               K    +A+EMGR DPR IIF+AKMGLAL L+SLL+F K+P   I   SVWAI
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAI  126



>ref|XP_009112721.1| PREDICTED: aluminum-activated malate transporter 9 [Brassica 
rapa]
Length=592

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 14/113 (12%)
 Frame = +3

Query  327  SFMGASREGLLSRGGCSSELEWG-IPSQSTNRGFLHG------------FRDRVSAFFGD  467
            SF    RE LLS  G  S+L +G I S     G  HG               ++S  + D
Sbjct  7    SFRNGKRERLLSNNG-FSDLRFGDIESNDLLEGDSHGRTRLCCCCSCGNISGKISGVYED  65

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             K+   KA+ MG  DPR I+F+AK+GLAL++V++L+F++EP   +   SVWAI
Sbjct  66   AKDVGRKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAI  118



>ref|XP_003530009.2| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Glycine max]
Length=596

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = +3

Query  315  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  461
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  462  GDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
               K    +A+EMGR DPR IIF+AKMGLAL L+SLL+F K+P   I   SVWAI
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAI  126



>ref|XP_006583403.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Glycine max]
Length=563

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = +3

Query  315  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  461
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  462  GDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
               K    +A+EMGR DPR IIF+AKMGLAL L+SLL+F K+P   I   SVWAI
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAI  126



>ref|XP_010419692.1| PREDICTED: aluminum-activated malate transporter 9-like [Camelina 
sativa]
Length=590

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
               +R+S  F  VK+ + KA++MG  DPR I+F+AK+GLAL +V+LL+FF+EP   +   
Sbjct  61   NLSERISGVFESVKDVAKKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRY  120

Query  612  SVWAI  626
            SVWAI
Sbjct  121  SVWAI  125



>ref|XP_008812807.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
9-like [Phoenix dactylifera]
Length=422

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGI----PSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  509
            S+EGLLS      E EWG+      +   RG L    D ++  +G  +E   K ++ GR 
Sbjct  16   SKEGLLS--SFLKEGEWGLGLDFDEEEEERGCLRRLGDGIAGLWGKARELVDKGWKFGRS  73

Query  510  DPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            DPR +IFAAKM LAL+L   ++F KE    +   +VWAI
Sbjct  74   DPRKVIFAAKMRLALTLTLFIIFLKEASMDLTKHAVWAI  112



>ref|XP_003525258.2| PREDICTED: aluminum-activated malate transporter 9 [Glycine max]
Length=622

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
             D   +++   K  + KA EMGR DPR IIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  83   EDEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  142

Query  618  WAI  626
            WAI
Sbjct  143  WAI  145



>ref|XP_003555230.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Glycine max]
 ref|XP_006605893.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Glycine max]
 gb|KHN11433.1| Aluminum-activated malate transporter 4 [Glycine soja]
Length=553

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  491
            S R SF+  S+E LLS+      + + G    S  R FL    DRV +F    ++ + K 
Sbjct  7    SFRHSFLEKSKERLLSKKEYQDFVGFNGDHDASPKRSFLDALSDRVVSFHNWSRDFASKL  66

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            YEMGR D R ++FA K GL+L++VSL+++ +E        SVWAI
Sbjct  67   YEMGRSDRRKVLFAVKAGLSLAIVSLVIYIEE--EQFSKYSVWAI  109



>gb|KHN21560.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=584

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
             D   +++   K  + KA EMGR DPR IIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  45   EDEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  104

Query  618  WAI  626
            WAI
Sbjct  105  WAI  107



>ref|XP_011008233.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008242.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008252.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008258.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008266.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
Length=545

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  321  RRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEM  500
            R +++ +S+E     G  S ++E     Q+    +L+   +++S    D ++ +++A+EM
Sbjct  7    RHNYVESSKEWQPLLGSLSGDVE-----QAGKCKYLNLLSEKISKSLNDFQDFAVRAWEM  61

Query  501  GRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            GR DP+ +IFA KMGLALS+VSLL+F+K     I   S+WAI
Sbjct  62   GRSDPKKVIFAIKMGLALSIVSLLIFWKGSNEDISQYSIWAI  103



>ref|XP_009617358.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009617359.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009617360.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
Length=542

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
              DR ++FF ++++ + KA EMGR DPR IIF+ KMG ALS VSLL+F+K+P + I   +
Sbjct  38   LNDRFTSFFNNLQDFAKKAIEMGRNDPRKIIFSLKMGFALSFVSLLIFWKKP-NDIAQFA  96

Query  615  VWAI  626
            +WAI
Sbjct  97   IWAI  100



>gb|KFK44528.1| hypothetical protein AALP_AA1G268500 [Arabis alpina]
Length=568

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 10/105 (10%)
 Frame = +3

Query  333  MGASREGLLSRGGCSSELEWGIPSQST----NRGFLHGFR---DRVSAFFGDVKETSIKA  491
            +  +RE LLSR  CS   ++G    S      R     FR   D + A +  + + + K 
Sbjct  5    LDQTREALLSRKACS---DFGFNDSSIIVDDRRSKFRCFRFCSDGIVATWKALYDIAAKL  61

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            YEMGR D R + F+ KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   YEMGRSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAI  106



>ref|XP_011012696.1| PREDICTED: aluminum-activated malate transporter 9 [Populus euphratica]
Length=587

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 5/106 (5%)
 Frame = +3

Query  324  RSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG-----FRDRVSAFFGDVKETSIK  488
            R  +   RE LLS     SE+ +    +  N    +        D++      V++ + +
Sbjct  9    RHSLAEKRERLLSTTKGYSEIVFPNIQEDLNEPTRNCCSYRLLSDKIVGLCKQVQDVAYR  68

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             Y+MG+ DPR I+F+AKMG AL L+SLL+F KEP+  +    VWAI
Sbjct  69   GYQMGKSDPRKIVFSAKMGFALILISLLIFLKEPIKELSQHFVWAI  114



>emb|CDY26161.1| BnaA06g12560D [Brassica napus]
Length=560

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D+++ F    ++  + A+EMG  DPR IIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVLVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  615  VWAI  626
            +WAI
Sbjct  123  LWAI  126



>ref|XP_009149285.1| PREDICTED: putative aluminum-activated malate transporter 3 [Brassica 
rapa]
Length=581

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D+++ F    ++  + A+EMG  DPR IIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVLVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  615  VWAI  626
            +WAI
Sbjct  123  LWAI  126



>gb|AAW81734.1| Putative expressed protein [Brassica oleracea]
Length=581

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D+++ F    ++  + A+EMG  DPR IIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVFVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  615  VWAI  626
            +WAI
Sbjct  123  LWAI  126



>ref|XP_010102832.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB94192.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=564

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  402  SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvff  581
            S +T+   L+  + +++ F+ D  + + KA+EMGR DPR IIFA KMGLAL+LVSLL+F+
Sbjct  32   STTTSCLCLNSMKKKMNKFWKDSVDFARKAWEMGRSDPRKIIFAFKMGLALALVSLLIFW  91

Query  582  KEPLSYIGSKSVWAI  626
            KE    I    +WAI
Sbjct  92   KESYHDIDQYVIWAI  106



>emb|CDY19211.1| BnaC05g14120D [Brassica napus]
Length=564

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D+++ F    ++  + A+EMG  DPR IIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVFVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  615  VWAI  626
            +WAI
Sbjct  123  LWAI  126



>ref|XP_010097443.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB68331.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=557

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  402  SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvff  581
            S +T+   L+  + +++ F+ D  + + KA+EMGR DPR IIFA KMGLAL+LVSLL+F+
Sbjct  32   STTTSCLCLNSMKKKMNKFWKDSVDFARKAWEMGRSDPRKIIFAFKMGLALALVSLLIFW  91

Query  582  KEPLSYIGSKSVWAI  626
            KE    I    +WAI
Sbjct  92   KESYHDIDQYVIWAI  106



>ref|XP_006584854.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Glycine max]
Length=539

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
            ++   +++   K  + KA EMGR DPR IIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  46   QEEEQSWWNTFKRVAEKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  105

Query  618  WAI  626
            WAI
Sbjct  106  WAI  108



>ref|XP_003532498.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Glycine max]
 gb|KHN16583.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=576

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  438  RDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSV  617
            ++   +++   K  + KA EMGR DPR IIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  46   QEEEQSWWNTFKRVAEKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  105

Query  618  WAI  626
            WAI
Sbjct  106  WAI  108



>gb|EYU40875.1| hypothetical protein MIMGU_mgv1a003508mg [Erythranthe guttata]
Length=580

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  426  LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIG  605
             H  R RV   + D      KA EMGRKDPR II+A K G AL++VSLL+F+K+PLS + 
Sbjct  19   FHSLRVRVVQLWSDYWGFFKKALEMGRKDPRKIIYAVKNGFALAVVSLLIFWKDPLSDVS  78

Query  606  SKSVWAI  626
              ++WAI
Sbjct  79   QFAIWAI  85



>ref|XP_009347009.1| PREDICTED: aluminum-activated malate transporter 9 [Pyrus x bretschneideri]
Length=602

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 56/104 (54%), Gaps = 11/104 (11%)
 Frame = +3

Query  345  REGLLS--RGGCSSELEWGIP--------SQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  494
            RE LLS  +G   SEL  G P        S ST         DR+  +   V+    +A 
Sbjct  16   RERLLSVQKGYSYSELG-GFPNIEEQEPSSGSTRCCTFRSVSDRIVGWCRTVQHVWKRAV  74

Query  495  EMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             MG+ DPR IIFAAKMGLAL ++SLL+F KEP   +   SVWAI
Sbjct  75   RMGQSDPRKIIFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAI  118



>ref|XP_003517985.1| PREDICTED: aluminum-activated malate transporter 4-like [Glycine 
max]
Length=554

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +3

Query  288  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGD  467
            MAA  A S SLR+ F   S+E LLSR   S     G  + S +    H   DRV+ F   
Sbjct  1    MAA--ARSVSLRQIFAERSKERLLSRKDFSDLRLNGTTATSASVATPHALSDRVAQFGEG  58

Query  468  VKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            V     +  EM R DPR ++FAAK GL+L+LVSL ++ KE    +   S+WAI
Sbjct  59   VGRFFRELREMARSDPRKVVFAAKAGLSLALVSLFIYIKE--EQLSKYSIWAI  109



>ref|XP_003630843.1| hypothetical protein MTR_8g104130 [Medicago truncatula]
 gb|AET05319.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=568

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query  486  KAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSY-IGSKSVWAI  626
            KA +MGR DPR IIFAAKMGLAL+++SLL+F KEP +  IG  SVWAI
Sbjct  56   KACQMGRSDPRKIIFAAKMGLALTIISLLIFLKEPFNKDIGRNSVWAI  103



>gb|KFK44001.1| hypothetical protein AALP_AA1G202000 [Arabis alpina]
Length=586

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D+++AF    ++  + A++MG  DPR +IF+AKMGLAL+L+S+L+FFK P S + +  
Sbjct  68   FLDKITAFVEKSQDVLVTAWQMGTSDPRKVIFSAKMGLALTLISILIFFKLPGSELSNHY  127

Query  615  VWAI  626
            +WAI
Sbjct  128  LWAI  131



>ref|XP_009761788.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
 ref|XP_009761789.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
 ref|XP_009761790.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
Length=541

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
              D+ ++FF ++++ + KA EMGR DPR IIF+ KMG ALS VSLL+F+K+P + I   +
Sbjct  38   LNDKFTSFFNNLQDFAKKAIEMGRNDPRKIIFSLKMGFALSFVSLLIFWKKP-NDIAQFA  96

Query  615  VWAI  626
            +WAI
Sbjct  97   IWAI  100



>ref|XP_004298292.1| PREDICTED: aluminum-activated malate transporter 9-like [Fragaria 
vesca subsp. vesca]
Length=521

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSY--IGSKS  614
             +V  F  D+ + ++KA+EMGR DPR +IFA KMGLALS+VS L+F+KE      IG  S
Sbjct  30   QKVMKFREDILDFALKAWEMGRSDPRKVIFAIKMGLALSIVSSLIFWKESFHNIDIGQYS  89

Query  615  VWAI  626
            +WAI
Sbjct  90   IWAI  93



>ref|XP_007142895.1| hypothetical protein PHAVU_007G025900g, partial [Phaseolus vulgaris]
 gb|ESW14889.1| hypothetical protein PHAVU_007G025900g, partial [Phaseolus vulgaris]
Length=641

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 4/104 (4%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  494
            S R SF+  S+E LLS+       + G  +  + R FL    DRV       K+ + K Y
Sbjct  96   SFRHSFLEKSKERLLSKRDLVGFNDEG--NDPSKRSFLDALSDRVVGLHNWSKDIASKLY  153

Query  495  EMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            EMGR D R ++FA K GL+L++VSL+++ +E        S+WAI
Sbjct  154  EMGRNDRRKVVFAIKAGLSLAIVSLVIYIEE--EQFSKYSIWAI  195



>ref|XP_003630841.1| hypothetical protein MTR_8g104110 [Medicago truncatula]
 gb|AET05317.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=578

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query  486  KAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPL-SYIGSKSVWAI  626
            KA+EMGR DPR IIFAAKMGLAL+++SLL+F KEP  + I   SVWAI
Sbjct  61   KAWEMGRSDPRKIIFAAKMGLALTIISLLIFLKEPFKNDISRHSVWAI  108



>ref|XP_010498230.1| PREDICTED: putative aluminum-activated malate transporter 3 [Camelina 
sativa]
Length=587

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 11/121 (9%)
 Frame = +3

Query  297  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  443
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ +       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDSTSVRCCSYRYFSD  71

Query  444  RVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
            +++A     ++  + A++MG  DPR IIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKTSQDVFVTAWKMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  624  I  626
            I
Sbjct  132  I  132



>gb|KFK39175.1| hypothetical protein AALP_AA3G210100 [Arabis alpina]
Length=598

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            +++S  + + K+ + KA+EMG  DPR I+F+AK+GLAL++V++L+FF+EP   +   SVW
Sbjct  57   EKISGLYQESKDVARKAWEMGVSDPRKIVFSAKIGLALTIVAVLIFFQEPNPDLSRYSVW  116

Query  621  AI  626
            AI
Sbjct  117  AI  118



>ref|XP_004300533.1| PREDICTED: aluminum-activated malate transporter 9 [Fragaria 
vesca subsp. vesca]
Length=597

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVW  620
            D+V  +   V+  S +A +MG+ DPR I+F+AKMGLAL L+SLL+F KEP   +   SVW
Sbjct  56   DKVVGWCRTVQGVSRRAIKMGKSDPRKIVFSAKMGLALMLISLLIFLKEPFKQLSRYSVW  115

Query  621  AI  626
            AI
Sbjct  116  AI  117



>ref|XP_006838424.1| hypothetical protein AMTR_s00002p00112740 [Amborella trichopoda]
 gb|ERN00993.1| hypothetical protein AMTR_s00002p00112740 [Amborella trichopoda]
Length=588

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  315  SLRRSFMGASREGLLS-RGGCSSELE-WGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIK  488
            S+R +FM  S + LLS + G  S+ E W         G      DR+   +  + E +I 
Sbjct  7    SIRYNFMERSTQRLLSQKEGYDSDSEGW----DWKRCGCFPRIGDRLRKIWNGIGENAIY  62

Query  489  AYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             ++ G+ DPR +IFAAK+G+ALS+VSLL+F KEP   I   S+WAI
Sbjct  63   GWQFGKSDPRKLIFAAKVGMALSIVSLLIFLKEPFMDISVYSIWAI  108



>ref|XP_002532651.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29724.1| conserved hypothetical protein [Ricinus communis]
Length=584

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  441  DRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLA  551
            D++  F   V++ +++AYEMGR DPR I+F+AKMGLA
Sbjct  52   DKIIGFVRQVQDVAVEAYEMGRNDPRKIVFSAKMGLA  88



>ref|XP_010459458.1| PREDICTED: putative aluminum-activated malate transporter 3 isoform 
X1 [Camelina sativa]
Length=586

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 11/121 (9%)
 Frame = +3

Query  297  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  443
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ +       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDSTSVRCCSYRYFSD  71

Query  444  RVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
            +++A     ++  + A+ MG  DPR IIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKKSQDVFVTAWTMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  624  I  626
            I
Sbjct  132  I  132



>ref|XP_009115329.1| PREDICTED: aluminum-activated malate transporter 4-like [Brassica 
rapa]
 ref|XP_009115330.1| PREDICTED: aluminum-activated malate transporter 4-like [Brassica 
rapa]
Length=573

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 6/104 (6%)
 Frame = +3

Query  330  FMGASREGLLSRGGCSSE--LEWGIPS---QSTNRGFLHGFRDRVSAFFGDVKETSIKAY  494
            F   +R+ LLSR GCS     + GI S   +S  R F   F D + A +  + + +   Y
Sbjct  8    FGDQTRDALLSRKGCSDFGFNDSGIISDDRRSKWRCF-RFFSDGIVASWKALYDFAASLY  66

Query  495  EMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            EMGR D R + FA KMG+AL+L S +++ KEPL      +VWAI
Sbjct  67   EMGRSDRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAI  110



>ref|XP_010465944.1| PREDICTED: aluminum-activated malate transporter 9 [Camelina 
sativa]
Length=596

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
               +R+S     VK+ + KA++MG  DPR I+F+AK+GLAL +V+LL+FF+EP   +   
Sbjct  58   NLSERISGVVDGVKDVAKKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRY  117

Query  612  SVWAI  626
            SVWAI
Sbjct  118  SVWAI  122



>ref|XP_010477020.1| PREDICTED: putative aluminum-activated malate transporter 3 [Camelina 
sativa]
Length=586

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 11/121 (9%)
 Frame = +3

Query  297  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  443
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ T       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDTTSVRCCSYRYFSD  71

Query  444  RVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWA  623
            +++A     ++    A++MG  DPR IIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKKSQDVLDTAWKMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  624  I  626
            I
Sbjct  132  I  132



>ref|XP_009381461.1| PREDICTED: aluminum-activated malate transporter 9-like [Musa 
acuminata subsp. malaccensis]
Length=568

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 6/105 (6%)
 Frame = +3

Query  312  ESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  491
            ES   +F   S E LLS      E     P Q   RG  H   D  +A +  +   +++ 
Sbjct  6    ESFHYNFEQRSNERLLSSTILYHE---PYPRQ---RGCFHRLADGAAATWACLCGLAVEG  59

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            +E GR DPR ++FAAKMGLAL+++SLL+F +     +   SVWAI
Sbjct  60   WEFGRSDPRKVVFAAKMGLALTIISLLIFLRVTFHDLSKHSVWAI  104



>ref|XP_003533369.2| PREDICTED: aluminum-activated malate transporter 9-like [Glycine 
max]
Length=598

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 63/118 (53%), Gaps = 17/118 (14%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSR----GGCSSELEWGIP-------SQSTNRGFLHGFR---DRVS  452
            S R SF    +E LLS     GG  S++  GIP         S  R     +R   D + 
Sbjct  14   SFRHSF-AERKERLLSMKGGIGGGYSQI--GIPLPESDEEDHSPTRRRCCSYRAVSDGIV  70

Query  453  AFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
              +   K  + +A+EMGR DPR IIF+AKMGLAL L+SLL+F K+P   I   SVWAI
Sbjct  71   GAWKSAKRVAARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDIAKHSVWAI  128



>ref|XP_008243202.1| PREDICTED: aluminum-activated malate transporter 9-like [Prunus 
mume]
Length=533

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  456  FFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            ++ D+ + + KA+EMGR DPR +IFA KMGLALS+VSLL+F+K+    IG  S+WAI
Sbjct  23   YWKDLLDFASKAWEMGRSDPRKVIFAIKMGLALSIVSLLIFWKKSYHDIGQYSIWAI  79



>ref|NP_173919.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
 sp|Q9C6L8.1|ALMT4_ARATH RecName: Full=Aluminum-activated malate transporter 4; Short=AtALMT4 
[Arabidopsis thaliana]
 gb|AAG50799.1|AC079281_1 hypothetical protein [Arabidopsis thaliana]
 gb|AEE30631.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
Length=548

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +3

Query  342  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  503
            +RE  LSR  CS   ++G    +     R     FR   D ++A +  + +   K YEMG
Sbjct  5    TREAFLSRKACS---DFGFNDSNIIDDRRSKFRCFRFCSDGITASWKALYDIGAKLYEMG  61

Query  504  RKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            R D R + F+ KMG+AL+L S +++ KEPL      +VWAI
Sbjct  62   RSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAI  102



>emb|CDX95521.1| BnaC01g34130D [Brassica napus]
Length=1295

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 58/116 (50%), Gaps = 12/116 (10%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG------------FRDRVSAF  458
            S R       RE LLS  G S      I S     G  H                ++S  
Sbjct  7    SFRNGNHAEKRERLLSNNGFSDMRFGDIESNDLLEGDGHARTRLCCCCSCGDISGKISGV  66

Query  459  FGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            + D K+ + KA+ MG  DPR I+F+AK+GLAL++V++L+F++EP   +   SVWAI
Sbjct  67   YEDAKDVARKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAI  122



>ref|XP_003524381.1| PREDICTED: aluminum-activated malate transporter 9-like [Glycine 
max]
Length=576

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +3

Query  459  FGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKE-PLSYIGSKSVWAI  626
            +  VK  + KA+EMGR DPR IIF+AKMGLAL+L+S L+F KE P   +   SVWAI
Sbjct  44   WNSVKRVAEKAWEMGRSDPRKIIFSAKMGLALTLISFLIFLKEPPFKDMSRYSVWAI  100



>gb|KHN21559.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=574

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +3

Query  459  FGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKE-PLSYIGSKSVWAI  626
            +  VK  + KA+EMGR DPR IIF+AKMGLAL+L+S L+F KE P   +   SVWAI
Sbjct  42   WNSVKRVAEKAWEMGRSDPRKIIFSAKMGLALTLISFLIFLKEPPFKDMSRYSVWAI  98



>gb|KEH27049.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=599

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  432  GFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSK  611
            GF D +  F+   K  + +A+EMG  DPR  +F+AKMGLAL L+SLL+F K+P   +G  
Sbjct  63   GFSDGIVEFWKKSKRVAGRAWEMGVSDPRKFVFSAKMGLALILISLLIFLKQPFPDVGKY  122

Query  612  SVWAI  626
            SVWAI
Sbjct  123  SVWAI  127



>ref|XP_010677979.1| PREDICTED: aluminum-activated malate transporter 9 [Beta vulgaris 
subsp. vulgaris]
Length=617

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  474  ETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            E + KA +MG+ DPR I+F+AKMGLAL+L+S L+F K+P   +G  SVWAI
Sbjct  123  EFTKKAVDMGKSDPRKIVFSAKMGLALTLLSFLIFLKKPFEDLGRYSVWAI  173



>emb|CDY24400.1| BnaCnng04670D [Brassica napus]
Length=579

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  FRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKS  614
            F D + A +  V + + K YEMGR D R + FA KMG+AL+L S +++ KEPL+     +
Sbjct  49   FSDGIIASWMAVHDVAAKLYEMGRSDRRKVYFAVKMGMALALCSFVIYLKEPLADASKYA  108

Query  615  VWAI  626
            VWAI
Sbjct  109  VWAI  112



>ref|XP_010551282.1| PREDICTED: aluminum-activated malate transporter 4-like [Tarenaya 
hassleriana]
Length=581

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 13/114 (11%)
 Frame = +3

Query  315  SLRRSFMGASREGLLSRGGCSSELEWGIPS-------QSTNRGFLHGFR---DRVSAFFG  464
            + R++F   SRE LL   G S   ++G+             R     FR   D V++ + 
Sbjct  7    AFRQNFPEPSRERLLPHKGFS---DFGLNDAGRVSAGSDGRRSKFRCFRLCSDGVTSSWK  63

Query  465  DVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
             + + ++K YEMGR D R + FA KMG AL+L SL++F KEPL      +VW+I
Sbjct  64   ALHDVAVKLYEMGRSDRRKVFFAVKMGFALALCSLVIFLKEPLQEANQYAVWSI  117



>ref|XP_006415877.1| hypothetical protein EUTSA_v10007220mg [Eutrema salsugineum]
 gb|ESQ34230.1| hypothetical protein EUTSA_v10007220mg [Eutrema salsugineum]
Length=569

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +3

Query  330  FMGASREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKA  491
            F   +REGLL +  CS   ++G    S     R     FR   D + A +  + + +   
Sbjct  3    FEDQTREGLLHQKSCS---DFGFNDSSIVDDRRSKFRCFRFFSDGIIASWKALYDIAANL  59

Query  492  YEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYIGSKSVWAI  626
            YEMGR D R + F+ KMG+AL+L S +++ KEPL      +VWAI
Sbjct  60   YEMGRSDRRKLYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAI  104



>ref|XP_007046270.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
 gb|EOY02102.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
Length=553

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  423  FLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRXIIFAAKMGLAlslvsllvffKEPLSYI  602
            +L   R ++   + D+K+   KA EMGR DPR +IFA KMGLALS+VSLL+F+K     I
Sbjct  36   YLKVTRAKIKNSWDDLKDFGRKALEMGRSDPRKVIFAMKMGLALSIVSLLIFWKGSFEDI  95

Query  603  GSKSVWAI  626
               S+WAI
Sbjct  96   AQYSIWAI  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250