BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041B13

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007048444.1|  S-adenosyl-L-methionine-dependent methyltran...    221   2e-63   
gb|KJB48927.1|  hypothetical protein B456_008G094300                    219   9e-63   Gossypium raimondii
ref|XP_009771172.1|  PREDICTED: probable methyltransferase PMT26        219   1e-62   Nicotiana sylvestris
gb|KHG06416.1|  hypothetical protein F383_32222                         217   9e-62   Gossypium arboreum [tree cotton]
ref|XP_002516311.1|  ATP binding protein, putative                      215   2e-61   Ricinus communis
ref|XP_009590749.1|  PREDICTED: probable methyltransferase PMT26        215   2e-61   Nicotiana tomentosiformis
ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26        214   1e-60   Prunus mume [ume]
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg             213   1e-60   Prunus persica
ref|XP_008343307.1|  PREDICTED: probable methyltransferase PMT24        197   3e-60   
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg                212   4e-60   Erythranthe guttata [common monkey flower]
gb|KDP39437.1|  hypothetical protein JCGZ_03719                         212   5e-60   Jatropha curcas
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26        211   1e-59   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN60873.1|  hypothetical protein VITISV_030591                     197   1e-59   Vitis vinifera
gb|AGE09593.1|  DehydRP-like protein                                    197   2e-59   Eucalyptus cladocalyx
ref|XP_011099715.1|  PREDICTED: probable methyltransferase PMT26        210   2e-59   Sesamum indicum [beniseed]
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...    210   2e-59   
gb|KDO51659.1|  hypothetical protein CISIN_1g003776mg                   210   2e-59   Citrus sinensis [apfelsine]
ref|XP_006432154.1|  hypothetical protein CICLE_v10000328mg             210   2e-59   Citrus clementina [clementine]
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...    210   2e-59   
gb|KJB40479.1|  hypothetical protein B456_007G066000                    210   2e-59   Gossypium raimondii
gb|KHG04009.1|  hypothetical protein F383_29196                         209   2e-59   Gossypium arboreum [tree cotton]
ref|XP_004288094.1|  PREDICTED: probable methyltransferase PMT26        209   3e-59   Fragaria vesca subsp. vesca
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26        209   5e-59   Populus euphratica
ref|XP_010090820.1|  putative methyltransferase PMT26                   207   2e-58   Morus notabilis
ref|XP_002306259.2|  dehydration-responsive family protein              207   2e-58   
ref|XP_002309924.1|  dehydration-responsive family protein              207   2e-58   
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26        207   2e-58   Pyrus x bretschneideri [bai li]
emb|CDP04655.1|  unnamed protein product                                206   5e-58   Coffea canephora [robusta coffee]
ref|XP_003602637.1|  Ankyrin-like protein                               206   6e-58   Medicago truncatula
ref|XP_006345748.1|  PREDICTED: probable methyltransferase PMT26-...    206   7e-58   Solanum tuberosum [potatoes]
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...    206   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...    206   8e-58   Nelumbo nucifera [Indian lotus]
emb|CBI37509.3|  unnamed protein product                                205   8e-58   Vitis vinifera
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26        205   1e-57   Vitis vinifera
ref|XP_004239625.1|  PREDICTED: probable methyltransferase PMT26        205   1e-57   Solanum lycopersicum
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...    204   2e-57   Cicer arietinum [garbanzo]
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26        204   4e-57   Elaeis guineensis
ref|XP_003564784.1|  PREDICTED: probable methyltransferase PMT26        203   5e-57   Brachypodium distachyon [annual false brome]
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g             203   6e-57   Phaseolus vulgaris [French bean]
ref|XP_010027631.1|  PREDICTED: probable methyltransferase PMT26        203   7e-57   Eucalyptus grandis [rose gum]
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...    203   8e-57   Populus euphratica
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...    203   8e-57   Populus euphratica
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...    203   8e-57   Populus euphratica
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...    203   8e-57   Populus euphratica
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...    203   8e-57   Populus euphratica
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26        202   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_008805853.1|  PREDICTED: probable methyltransferase PMT26        202   1e-56   Phoenix dactylifera
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26        202   1e-56   Sesamum indicum [beniseed]
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26        202   2e-56   
ref|XP_010530224.1|  PREDICTED: probable methyltransferase PMT24        187   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26        202   2e-56   Phoenix dactylifera
gb|KHG15143.1|  hypothetical protein F383_09666                         201   3e-56   Gossypium arboreum [tree cotton]
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...    201   3e-56   Cicer arietinum [garbanzo]
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26        201   4e-56   Phoenix dactylifera
gb|KJB71369.1|  hypothetical protein B456_011G118900                    202   4e-56   Gossypium raimondii
gb|KHN34092.1|  Putative methyltransferase PMT26                        201   5e-56   Glycine soja [wild soybean]
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...    200   5e-56   Glycine max [soybeans]
emb|CDY31339.1|  BnaA02g34020D                                          200   6e-56   Brassica napus [oilseed rape]
gb|EMS53293.1|  putative methyltransferase PMT26                        201   6e-56   Triticum urartu
gb|EMT17461.1|  hypothetical protein F775_31288                         200   7e-56   
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg             200   7e-56   Eutrema salsugineum [saltwater cress]
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26        200   7e-56   Cucumis melo [Oriental melon]
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26        199   1e-55   Elaeis guineensis
gb|EAY76734.1|  hypothetical protein OsI_04689                          199   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26        199   2e-55   Brassica rapa
emb|CDY39830.1|  BnaC02g42880D                                          199   2e-55   Brassica napus [oilseed rape]
ref|NP_001045015.1|  Os01g0883900                                       199   2e-55   
dbj|BAD82580.1|  ankyrin-like protein                                   199   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26-...    199   2e-55   Cucumis sativus [cucumbers]
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...    198   2e-55   Oryza brachyantha
ref|XP_004166405.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    199   2e-55   
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg             198   3e-55   Capsella rubella
ref|NP_001176817.1|  Os12g0178300                                       186   3e-55   
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26        198   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26        198   3e-55   
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24        198   3e-55   Nelumbo nucifera [Indian lotus]
emb|CDM85080.1|  unnamed protein product                                197   5e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26        197   6e-55   Elaeis guineensis
gb|KHN16949.1|  Putative methyltransferase PMT26                        197   8e-55   Glycine soja [wild soybean]
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...    197   8e-55   Glycine max [soybeans]
ref|XP_010530222.1|  PREDICTED: probable methyltransferase PMT25        187   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_009410679.1|  PREDICTED: probable methyltransferase PMT26        197   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...    196   1e-54   Glycine max [soybeans]
gb|KHN09623.1|  Putative methyltransferase PMT26                        196   1e-54   Glycine soja [wild soybean]
dbj|BAB10271.1|  ankyrin-like protein                                   196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444329.1|  PREDICTED: probable methyltransferase PMT26        196   1e-54   Camelina sativa [gold-of-pleasure]
ref|NP_201208.2|  putative methyltransferase PMT26                      196   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520274.1|  ATP binding protein, putative                      196   2e-54   Ricinus communis
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597             196   3e-54   
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...    195   3e-54   Setaria italica
gb|KDO36646.1|  hypothetical protein CISIN_1g027471mg                   184   3e-54   Citrus sinensis [apfelsine]
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26        195   4e-54   
gb|KDP32896.1|  hypothetical protein JCGZ_12188                         194   6e-54   Jatropha curcas
emb|CDX84478.1|  BnaC03g50220D                                          194   7e-54   
ref|XP_011027424.1|  PREDICTED: probable methyltransferase PMT24        194   7e-54   Populus euphratica
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26        194   7e-54   Tarenaya hassleriana [spider flower]
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g             194   1e-53   Phaseolus vulgaris [French bean]
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g             194   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004959929.1|  PREDICTED: probable methyltransferase PMT26-...    193   2e-53   Setaria italica
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...    193   2e-53   Populus euphratica
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g             193   2e-53   
gb|EAY82457.1|  hypothetical protein OsI_37674                          194   2e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...    193   2e-53   Populus euphratica
emb|CDY43336.1|  BnaC03g59080D                                          181   2e-53   Brassica napus [oilseed rape]
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...    192   3e-53   Glycine max [soybeans]
gb|ABA96619.1|  dehydration-responsive protein, putative                194   3e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19833.1|  hypothetical protein OsJ_35417                          194   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006472883.1|  PREDICTED: probable methyltransferase PMT25-...    192   3e-53   Citrus sinensis [apfelsine]
ref|XP_006434317.1|  hypothetical protein CICLE_v10000311mg             192   4e-53   
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24        192   5e-53   Vitis vinifera
ref|XP_004978303.1|  PREDICTED: probable methyltransferase PMT26-...    194   5e-53   
emb|CDY43782.1|  BnaA06g23180D                                          192   5e-53   Brassica napus [oilseed rape]
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26        192   8e-53   Brassica rapa
ref|XP_008371274.1|  PREDICTED: probable methyltransferase PMT24        182   9e-53   
ref|XP_003630288.1|  Ankyrin-like protein                               191   1e-52   Medicago truncatula
gb|ACN28572.1|  unknown                                                 191   1e-52   Zea mays [maize]
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24        191   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910          191   1e-52   Sorghum bicolor [broomcorn]
ref|XP_006303155.1|  hypothetical protein CARUB_v10008372mg             191   1e-52   
gb|EMT26912.1|  hypothetical protein F775_10259                         190   2e-52   
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24        190   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006847154.1|  hypothetical protein AMTR_s00017p00240980          190   2e-52   
dbj|BAJ85194.1|  predicted protein                                      189   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009411900.1|  PREDICTED: probable methyltransferase PMT26        189   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002447385.1|  hypothetical protein SORBIDRAFT_06g034130          188   8e-52   Sorghum bicolor [broomcorn]
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...    188   8e-52   Camelina sativa [gold-of-pleasure]
gb|EPS72708.1|  hypothetical protein M569_02045                         186   1e-51   Genlisea aurea
ref|XP_010547883.1|  PREDICTED: probable methyltransferase PMT26        187   1e-51   Tarenaya hassleriana [spider flower]
gb|KHG22120.1|  hypothetical protein F383_28461                         188   1e-51   Gossypium arboreum [tree cotton]
gb|KHN44285.1|  Putative methyltransferase PMT25                        187   2e-51   Glycine soja [wild soybean]
ref|XP_008338454.1|  PREDICTED: probable methyltransferase PMT24        182   3e-51   
emb|CBI18946.3|  unnamed protein product                                185   3e-51   Vitis vinifera
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...    187   3e-51   Glycine max [soybeans]
ref|NP_001151565.1|  ankyrin-like protein                               186   4e-51   Zea mays [maize]
gb|KHN46967.1|  Putative methyltransferase PMT25                        186   4e-51   Glycine soja [wild soybean]
ref|XP_009414876.1|  PREDICTED: probable methyltransferase PMT26        186   4e-51   
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...    186   5e-51   
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24        186   6e-51   Camelina sativa [gold-of-pleasure]
gb|EMS56319.1|  putative methyltransferase PMT26                        187   6e-51   Triticum urartu
ref|XP_007199628.1|  hypothetical protein PRUPE_ppa001750mg             186   7e-51   
ref|XP_008244575.1|  PREDICTED: probable methyltransferase PMT24        186   9e-51   Prunus mume [ume]
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...    186   9e-51   Glycine max [soybeans]
ref|XP_010112029.1|  putative methyltransferase PMT24                   185   1e-50   Morus notabilis
gb|ACF86376.1|  unknown                                                 180   1e-50   Zea mays [maize]
ref|XP_006578951.1|  PREDICTED: probable methyltransferase PMT26-...    184   1e-50   Glycine max [soybeans]
ref|XP_004289881.1|  PREDICTED: probable methyltransferase PMT24        185   1e-50   Fragaria vesca subsp. vesca
gb|KDO36645.1|  hypothetical protein CISIN_1g027471mg                   175   1e-50   Citrus sinensis [apfelsine]
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24        185   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010679252.1|  PREDICTED: probable methyltransferase PMT26        185   1e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59346.1|  hypothetical protein B456_009G250600                    185   1e-50   Gossypium raimondii
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24        184   2e-50   
emb|CDX90190.1|  BnaA08g17940D                                          184   2e-50   
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159             184   2e-50   
ref|NP_174240.2|  putative methyltransferase PMT24                      184   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674424.1|  PREDICTED: probable methyltransferase PMT26        186   2e-50   Zea mays [maize]
dbj|BAE99079.1|  hypothetical protein                                   184   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...    185   2e-50   Eucalyptus grandis [rose gum]
tpg|DAA55524.1|  TPA: hypothetical protein ZEAMMB73_749730              186   2e-50   
gb|AAG51752.1|AC068667_31  unknown protein; 55790-52851                 184   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137499.1|  hypothetical protein PHAVU_009G132000g             184   2e-50   Phaseolus vulgaris [French bean]
ref|XP_002442915.1|  hypothetical protein SORBIDRAFT_08g004870          186   3e-50   
ref|XP_009779710.1|  PREDICTED: probable methyltransferase PMT26        184   3e-50   Nicotiana sylvestris
ref|XP_009602526.1|  PREDICTED: probable methyltransferase PMT24        184   3e-50   Nicotiana tomentosiformis
ref|XP_010533385.1|  PREDICTED: probable methyltransferase PMT24        184   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_009366818.1|  PREDICTED: probable methyltransferase PMT24        184   5e-50   Pyrus x bretschneideri [bai li]
emb|CDY48339.1|  BnaA09g26820D                                          183   5e-50   Brassica napus [oilseed rape]
emb|CDX99828.1|  BnaC05g22500D                                          183   6e-50   
ref|XP_003576215.1|  PREDICTED: probable methyltransferase PMT24        184   6e-50   Brachypodium distachyon [annual false brome]
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...    182   8e-50   Brassica rapa
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...    182   9e-50   Brassica rapa
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24        182   1e-49   Brassica rapa
emb|CDY44314.1|  BnaA07g07980D                                          182   1e-49   Brassica napus [oilseed rape]
emb|CDX94669.1|  BnaC07g09890D                                          181   2e-49   
ref|XP_010679237.1|  PREDICTED: probable methyltransferase PMT26 ...    181   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679222.1|  PREDICTED: probable methyltransferase PMT25 ...    181   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006653085.1|  PREDICTED: probable methyltransferase PMT26-...    181   3e-49   Oryza brachyantha
gb|AAX96340.1|  Putative methyltransferase                              170   4e-49   Oryza sativa Japonica Group [Japonica rice]
gb|KEH35375.1|  methyltransferase PMT26-like protein, putative          181   4e-49   Medicago truncatula
ref|XP_004502550.1|  PREDICTED: probable methyltransferase PMT26-...    180   6e-49   Cicer arietinum [garbanzo]
ref|XP_010906388.1|  PREDICTED: probable methyltransferase PMT24        181   9e-49   Elaeis guineensis
dbj|BAK08087.1|  predicted protein                                      181   9e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg             179   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg             179   1e-48   Capsella rubella
ref|XP_006828886.1|  hypothetical protein AMTR_s00001p00185010          180   2e-48   
dbj|BAE99717.1|  hypothetical protein                                   179   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180977.1|  putative methyltransferase PMT25                      179   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010063908.1|  PREDICTED: probable methyltransferase PMT25        179   2e-48   Eucalyptus grandis [rose gum]
ref|XP_002449126.1|  hypothetical protein SORBIDRAFT_05g005510          180   2e-48   Sorghum bicolor [broomcorn]
gb|EEE61974.1|  hypothetical protein OsJ_16751                          178   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669787.1|  PREDICTED: probable methyltransferase PMT26        180   2e-48   Zea mays [maize]
gb|EEC78319.1|  hypothetical protein OsI_18053                          178   2e-48   Oryza sativa Indica Group [Indian rice]
tpg|DAA38926.1|  TPA: hypothetical protein ZEAMMB73_582749              180   3e-48   
ref|XP_004237701.1|  PREDICTED: probable methyltransferase PMT24        178   3e-48   Solanum lycopersicum
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25        178   3e-48   Camelina sativa [gold-of-pleasure]
gb|EMT24893.1|  hypothetical protein F775_19481                         179   5e-48   
ref|XP_004978888.1|  PREDICTED: probable methyltransferase PMT26-...    178   5e-48   
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26        177   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_006365916.1|  PREDICTED: probable methyltransferase PMT24-...    177   5e-48   Solanum tuberosum [potatoes]
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25        177   1e-47   Camelina sativa [gold-of-pleasure]
gb|EEE51778.1|  hypothetical protein OsJ_33227                          177   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065922.2|  Os11g0186300                                       177   1e-47   
gb|AAP72961.1|  putative ankyrin-like protein                           176   1e-47   Lactuca sativa [cultivated lettuce]
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27        177   1e-47   Brassica rapa
gb|EMS61672.1|  putative methyltransferase PMT26                        178   1e-47   Triticum urartu
ref|XP_006662791.1|  PREDICTED: probable methyltransferase PMT26-...    177   1e-47   Oryza brachyantha
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372             176   2e-47   
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27        177   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010679267.1|  PREDICTED: probable methyltransferase PMT26        175   3e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25        176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27        177   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27        177   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg             176   4e-47   Eutrema salsugineum [saltwater cress]
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg             177   4e-47   Capsella rubella
ref|NP_001054368.1|  Os04g0692400                                       174   4e-47   
ref|NP_190676.1|  putative methyltransferase PMT27                      176   6e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29128.1|  hypothetical protein B456_005G086100                    175   6e-47   Gossypium raimondii
gb|KJB29130.1|  hypothetical protein B456_005G086100                    175   9e-47   Gossypium raimondii
gb|KHG21530.1|  hypothetical protein F383_05601                         174   1e-46   Gossypium arboreum [tree cotton]
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27        175   2e-46   Brassica rapa
ref|XP_010271514.1|  PREDICTED: probable methyltransferase PMT27        175   2e-46   
ref|XP_006383147.1|  dehydration-responsive family protein              174   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011028617.1|  PREDICTED: probable methyltransferase PMT27        173   5e-46   Populus euphratica
ref|XP_006410572.1|  hypothetical protein EUTSA_v10016285mg             172   6e-46   Eutrema salsugineum [saltwater cress]
gb|KDP32665.1|  hypothetical protein JCGZ_13663                         172   7e-46   Jatropha curcas
gb|KHG06183.1|  hypothetical protein F383_31802                         174   7e-46   Gossypium arboreum [tree cotton]
ref|XP_004171289.1|  PREDICTED: probable methyltransferase PMT27-...    165   8e-46   
ref|XP_010679826.1|  PREDICTED: probable methyltransferase PMT27        173   8e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009398710.1|  PREDICTED: probable methyltransferase PMT27        173   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008337883.1|  PREDICTED: probable methyltransferase PMT27        172   1e-45   
emb|CDY17234.1|  BnaA05g09540D                                          171   1e-45   Brassica napus [oilseed rape]
ref|XP_009143789.1|  PREDICTED: probable methyltransferase PMT25        171   1e-45   Brassica rapa
ref|XP_010239480.1|  PREDICTED: probable methyltransferase PMT25        171   2e-45   
ref|XP_008811930.1|  PREDICTED: probable methyltransferase PMT24        172   2e-45   Phoenix dactylifera
ref|XP_006340936.1|  PREDICTED: probable methyltransferase PMT27-...    172   2e-45   Solanum tuberosum [potatoes]
ref|XP_007046783.1|  S-adenosyl-L-methionine-dependent methyltran...    172   2e-45   
gb|KJB40187.1|  hypothetical protein B456_007G049800                    172   2e-45   Gossypium raimondii
ref|XP_006856007.1|  hypothetical protein AMTR_s00059p00036620          161   3e-45   
ref|XP_009346291.1|  PREDICTED: probable methyltransferase PMT27        171   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_008338020.1|  PREDICTED: probable methyltransferase PMT27        171   3e-45   
ref|XP_007203224.1|  hypothetical protein PRUPE_ppa000863mg             171   4e-45   Prunus persica
ref|XP_002310282.2|  hypothetical protein POPTR_0007s13620g             170   4e-45   
emb|CBI17424.3|  unnamed protein product                                170   6e-45   Vitis vinifera
emb|CDX84330.1|  BnaC04g10920D                                          169   6e-45   
gb|KGN48886.1|  hypothetical protein Csa_6G504660                       170   6e-45   Cucumis sativus [cucumbers]
ref|XP_002267515.2|  PREDICTED: probable methyltransferase PMT27        170   6e-45   Vitis vinifera
ref|XP_008440784.1|  PREDICTED: probable methyltransferase PMT27        170   7e-45   Cucumis melo [Oriental melon]
ref|XP_010254848.1|  PREDICTED: probable methyltransferase PMT28        168   8e-45   
ref|XP_004149997.1|  PREDICTED: probable methyltransferase PMT27-...    170   8e-45   
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27        170   9e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011025891.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    170   9e-45   Populus euphratica
ref|XP_009590098.1|  PREDICTED: probable methyltransferase PMT27        169   1e-44   Nicotiana tomentosiformis
ref|XP_011470976.1|  PREDICTED: probable methyltransferase PMT27        169   1e-44   Fragaria vesca subsp. vesca
ref|XP_008241902.1|  PREDICTED: probable methyltransferase PMT27        170   1e-44   Prunus mume [ume]
ref|XP_009403511.1|  PREDICTED: probable methyltransferase PMT28        167   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233730.2|  PREDICTED: probable methyltransferase PMT27        169   1e-44   
ref|XP_003563554.1|  PREDICTED: probable methyltransferase PMT25        169   1e-44   
gb|EMT26126.1|  hypothetical protein F775_52504                         167   1e-44   
dbj|BAK05773.1|  predicted protein                                      169   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002533655.1|  ATP binding protein, putative                      169   2e-44   Ricinus communis
ref|XP_009798747.1|  PREDICTED: probable methyltransferase PMT27        169   2e-44   Nicotiana sylvestris
ref|XP_006425567.1|  hypothetical protein CICLE_v10024982mg             167   2e-44   
ref|XP_006467154.1|  PREDICTED: probable methyltransferase PMT27-...    168   2e-44   Citrus sinensis [apfelsine]
gb|AFW75800.1|  hypothetical protein ZEAMMB73_544570                    169   2e-44   
ref|XP_008648870.1|  PREDICTED: probable methyltransferase PMT24        169   3e-44   
emb|CDP01948.1|  unnamed protein product                                167   3e-44   Coffea canephora [robusta coffee]
gb|EPS59022.1|  hypothetical protein M569_15788                         160   4e-44   Genlisea aurea
ref|XP_010557710.1|  PREDICTED: probable methyltransferase PMT27        168   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010030876.1|  PREDICTED: probable methyltransferase PMT27        168   5e-44   Eucalyptus grandis [rose gum]
ref|XP_003544411.1|  PREDICTED: probable methyltransferase PMT28-...    166   5e-44   Glycine max [soybeans]
gb|EMT06244.1|  hypothetical protein F775_19651                         166   7e-44   
ref|XP_011083685.1|  PREDICTED: probable methyltransferase PMT28 ...    166   8e-44   Sesamum indicum [beniseed]
ref|XP_006657337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    167   1e-43   
gb|KDO71070.1|  hypothetical protein CISIN_1g002884mg                   166   1e-43   Citrus sinensis [apfelsine]
ref|XP_010664689.1|  PREDICTED: probable methyltransferase PMT28        167   2e-43   
ref|XP_002437585.1|  hypothetical protein SORBIDRAFT_10g029820          166   2e-43   
ref|XP_010060949.1|  PREDICTED: probable methyltransferase PMT28        164   5e-43   Eucalyptus grandis [rose gum]
ref|XP_003549433.1|  PREDICTED: probable methyltransferase PMT28-...    163   5e-43   
ref|XP_009365956.1|  PREDICTED: probable methyltransferase PMT28        166   5e-43   
ref|XP_009365659.1|  PREDICTED: probable methyltransferase PMT28        166   6e-43   
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g             164   8e-43   
gb|EMS51988.1|  putative methyltransferase PMT27                        162   1e-42   
ref|XP_008466568.1|  PREDICTED: probable methyltransferase PMT28 ...    162   1e-42   
gb|KDO84547.1|  hypothetical protein CISIN_1g044932mg                   161   2e-42   
ref|XP_006473495.1|  PREDICTED: probable methyltransferase PMT28-...    162   2e-42   
gb|KHN41938.1|  Putative methyltransferase PMT27                        162   2e-42   
gb|KHN20981.1|  Putative methyltransferase PMT28                        163   3e-42   
ref|XP_003538865.1|  PREDICTED: probable methyltransferase PMT27-...    161   4e-42   
ref|XP_004147784.1|  PREDICTED: probable methyltransferase PMT28-...    161   4e-42   
ref|XP_004165240.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    160   5e-42   
ref|XP_010684322.1|  PREDICTED: probable methyltransferase PMT28        160   5e-42   
emb|CBI19694.3|  unnamed protein product                                160   6e-42   
ref|XP_011100953.1|  PREDICTED: probable methyltransferase PMT27        162   6e-42   
gb|KDP38501.1|  hypothetical protein JCGZ_04426                         160   6e-42   
gb|EAZ02339.1|  hypothetical protein OsI_24442                          162   7e-42   
ref|XP_011024428.1|  PREDICTED: probable methyltransferase PMT28        160   8e-42   
ref|XP_008388168.1|  PREDICTED: probable methyltransferase PMT28        162   1e-41   
gb|EEE66346.1|  hypothetical protein OsJ_22638                          161   1e-41   
gb|KFK44078.1|  hypothetical protein AALP_AA1G213200                    159   1e-41   
gb|KHN36073.1|  Putative methyltransferase PMT27                        160   1e-41   
ref|XP_010533254.1|  PREDICTED: probable methyltransferase PMT28        159   2e-41   
ref|XP_003516560.1|  PREDICTED: probable methyltransferase PMT27-...    160   2e-41   
ref|XP_006416505.1|  hypothetical protein EUTSA_v10006932mg             159   2e-41   
ref|XP_010942964.1|  PREDICTED: probable methyltransferase PMT28 ...    159   2e-41   
ref|XP_009336328.1|  PREDICTED: probable methyltransferase PMT28        159   2e-41   
emb|CDP07517.1|  unnamed protein product                                159   2e-41   
ref|XP_004499154.1|  PREDICTED: probable methyltransferase PMT28-...    159   2e-41   
gb|AES95041.2|  methyltransferase PMT16, putative                       160   3e-41   
ref|XP_010942955.1|  PREDICTED: probable methyltransferase PMT28 ...    158   3e-41   
ref|XP_010942015.1|  PREDICTED: probable methyltransferase PMT28 ...    157   4e-41   
ref|XP_010942014.1|  PREDICTED: probable methyltransferase PMT28 ...    158   4e-41   
ref|XP_002510383.1|  ATP binding protein, putative                      158   4e-41   
ref|XP_010942013.1|  PREDICTED: probable methyltransferase PMT28 ...    158   5e-41   
gb|EAY80220.1|  hypothetical protein OsI_35397                          150   6e-41   
ref|XP_010477162.1|  PREDICTED: probable methyltransferase PMT28        157   6e-41   
ref|XP_009594157.1|  PREDICTED: uncharacterized protein LOC104090695    160   7e-41   
ref|XP_010498361.1|  PREDICTED: probable methyltransferase PMT28        157   7e-41   
ref|XP_007017535.1|  S-adenosyl-L-methionine-dependent methyltran...    159   7e-41   
ref|XP_006306888.1|  hypothetical protein CARUB_v10008443mg             157   8e-41   
ref|XP_009801649.1|  PREDICTED: probable methyltransferase PMT28        158   8e-41   
ref|XP_008787263.1|  PREDICTED: probable methyltransferase PMT28 ...    157   8e-41   
ref|XP_002893051.1|  hypothetical protein ARALYDRAFT_889384             157   9e-41   
ref|XP_010459613.1|  PREDICTED: probable methyltransferase PMT28        157   9e-41   
ref|XP_007156094.1|  hypothetical protein PHAVU_003G258000g             158   1e-40   
ref|XP_008220897.1|  PREDICTED: probable methyltransferase PMT28        159   1e-40   
gb|KEH40140.1|  methyltransferase PMT16, putative                       156   2e-40   
ref|XP_008377397.1|  PREDICTED: probable methyltransferase PMT28        153   2e-40   
emb|CDY26666.1|  BnaA06g13560D                                          155   3e-40   
emb|CDY67390.1|  BnaA06g38510D                                          155   3e-40   
tpg|DAA51680.1|  TPA: hypothetical protein ZEAMMB73_099003              155   3e-40   
ref|XP_009149431.1|  PREDICTED: probable methyltransferase PMT28        155   3e-40   
ref|NP_564084.1|  putative methyltransferase PMT28                      155   3e-40   
ref|XP_006341939.1|  PREDICTED: probable methyltransferase PMT28-...    156   3e-40   
gb|EYU45155.1|  hypothetical protein MIMGU_mgv1a0020252mg               155   4e-40   
ref|XP_008783495.1|  PREDICTED: probable methyltransferase PMT28 ...    155   5e-40   
ref|XP_004291877.2|  PREDICTED: probable methyltransferase PMT28        157   6e-40   
gb|KHN00508.1|  Putative methyltransferase PMT27                        155   8e-40   
ref|XP_004238259.2|  PREDICTED: probable methyltransferase PMT28        157   8e-40   
ref|XP_003519883.1|  PREDICTED: probable methyltransferase PMT27-...    155   9e-40   
gb|KEH20400.1|  methyltransferase PMT16, putative                       155   1e-39   
ref|XP_004981591.1|  PREDICTED: probable methyltransferase PMT28-...    154   1e-39   
ref|XP_003612083.1|  Ankyrin-like protein                               155   2e-39   
ref|XP_002466374.1|  hypothetical protein SORBIDRAFT_01g006600          153   2e-39   
gb|KHG00805.1|  hypothetical protein F383_23598                         153   3e-39   
gb|KJB58269.1|  hypothetical protein B456_009G202000                    151   1e-38   
ref|XP_002965218.1|  hypothetical protein SELMODRAFT_142980             149   4e-38   
ref|XP_001768084.1|  predicted protein                                  149   4e-38   
ref|XP_002962298.1|  hypothetical protein SELMODRAFT_140935             149   4e-38   
gb|EPS70327.1|  hypothetical protein M569_04431                         149   7e-38   
ref|XP_006651862.1|  PREDICTED: probable methyltransferase PMT28-...    148   7e-38   
ref|XP_003558618.2|  PREDICTED: uncharacterized protein LOC100846034    151   9e-38   
gb|EAY92017.1|  hypothetical protein OsI_13710                          149   9e-38   
ref|NP_001051428.1|  Os03g0775200                                       149   1e-37   
ref|XP_004967286.1|  PREDICTED: probable methyltransferase PMT27-...    149   1e-37   
ref|XP_004509323.1|  PREDICTED: probable methyltransferase PMT27-...    149   2e-37   
gb|EYU24085.1|  hypothetical protein MIMGU_mgv1a001214mg                146   1e-36   
ref|XP_002301867.2|  hypothetical protein POPTR_0002s26220g             147   2e-36   
ref|XP_001780682.1|  predicted protein                                  143   3e-36   
ref|XP_001754440.1|  predicted protein                                  143   3e-36   
emb|CAN75692.1|  hypothetical protein VITISV_038533                     147   3e-36   
ref|XP_006434984.1|  hypothetical protein CICLE_v10003946mg             146   4e-36   
ref|XP_007225452.1|  hypothetical protein PRUPE_ppa000321mg             144   1e-35   
ref|XP_002981388.1|  hypothetical protein SELMODRAFT_114169             140   3e-35   
ref|XP_008667905.1|  PREDICTED: uncharacterized protein LOC100273...    143   5e-35   
ref|XP_002969911.1|  hypothetical protein SELMODRAFT_170913             140   6e-35   
ref|XP_007160755.1|  hypothetical protein PHAVU_001G014500g             140   3e-34   
ref|XP_001753452.1|  predicted protein                                  138   9e-34   
ref|XP_002969525.1|  hypothetical protein SELMODRAFT_170677             135   4e-33   
ref|XP_010501645.1|  PREDICTED: probable methyltransferase PMT24        135   7e-33   
gb|EMT09317.1|  tRNA wybutosine-synthesizing 1-like protein             135   3e-32   
ref|XP_011084874.1|  PREDICTED: probable methyltransferase PMT23        132   2e-31   
ref|XP_002986762.1|  hypothetical protein SELMODRAFT_20660              129   2e-31   
emb|CDP12320.1|  unnamed protein product                                128   6e-30   
emb|CDY66535.1|  BnaA09g54660D                                          125   2e-29   
emb|CDY26534.1|  BnaC01g23650D                                          124   7e-29   
gb|AES71217.2|  methyltransferase PMT16, putative                       123   1e-28   
ref|XP_003600966.1|  hypothetical protein MTR_3g071530                  123   1e-28   
ref|XP_007141740.1|  hypothetical protein PHAVU_008G221500g             122   2e-28   
ref|XP_009613322.1|  PREDICTED: probable methyltransferase PMT23        122   3e-28   
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         121   3e-28   
ref|XP_009758520.1|  PREDICTED: probable methyltransferase PMT23        121   4e-28   
gb|KJB67515.1|  hypothetical protein B456_010G195400                    121   5e-28   
ref|XP_009769140.1|  PREDICTED: probable methyltransferase PMT23        121   5e-28   
emb|CDY33299.1|  BnaA01g19660D                                          120   5e-28   
ref|XP_007163573.1|  hypothetical protein PHAVU_001G245500g             120   7e-28   
ref|XP_010264561.1|  PREDICTED: probable methyltransferase PMT23 ...    120   7e-28   
ref|NP_001170010.1|  uncharacterized protein LOC100383917               117   7e-28   
emb|CDY50730.1|  BnaC05g50930D                                          119   8e-28   
dbj|BAH19504.1|  AT1G26850                                              120   1e-27   
ref|NP_564265.1|  putative methyltransferase PMT2                       120   1e-27   
ref|XP_010257058.1|  PREDICTED: probable methyltransferase PMT23 ...    118   1e-27   
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         120   1e-27   
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         120   1e-27   
ref|XP_009631455.1|  PREDICTED: probable methyltransferase PMT23        119   1e-27   
gb|KHN48584.1|  Putative methyltransferase PMT23                        119   2e-27   
gb|EPS67794.1|  hypothetical protein M569_06980                         115   2e-27   
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         119   2e-27   
gb|AES99641.2|  methyltransferase PMT16, putative                       119   2e-27   
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                  117   2e-27   
ref|XP_002893375.1|  dehydration-responsive family protein              119   2e-27   
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             119   2e-27   
emb|CDY46435.1|  BnaA08g19950D                                          119   2e-27   
ref|XP_008656388.1|  PREDICTED: probable methyltransferase PMT23 ...    117   2e-27   
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         119   2e-27   
emb|CDY16198.1|  BnaA09g29320D                                          119   2e-27   
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         119   2e-27   
ref|XP_003616683.1|  hypothetical protein MTR_5g083150                  119   2e-27   
gb|ACF86888.1|  unknown                                                 114   2e-27   
emb|CDY45006.1|  BnaCnng12360D                                          119   2e-27   
emb|CDY40268.1|  BnaA07g09320D                                          119   2e-27   
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         119   2e-27   
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         119   3e-27   
ref|XP_004241111.1|  PREDICTED: probable methyltransferase PMT22        119   3e-27   
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         119   3e-27   
ref|XP_010554685.1|  PREDICTED: probable methyltransferase PMT22        119   3e-27   
ref|XP_010257056.1|  PREDICTED: probable methyltransferase PMT23 ...    119   3e-27   
gb|KHG22665.1|  hypothetical protein F383_10369                         119   3e-27   
ref|XP_002441250.1|  hypothetical protein SORBIDRAFT_09g023140          119   4e-27   
ref|XP_008369289.1|  PREDICTED: probable methyltransferase PMT23        118   4e-27   
ref|XP_008656387.1|  PREDICTED: probable methyltransferase PMT23 ...    117   4e-27   
gb|AAT93959.1|  unknown protein                                         119   4e-27   
ref|XP_003545223.1|  PREDICTED: probable methyltransferase PMT23-...    118   4e-27   
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    118   4e-27   
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             118   4e-27   
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          120   5e-27   
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             118   5e-27   
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             118   5e-27   
gb|KHN01216.1|  Putative methyltransferase PMT2                         117   6e-27   
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    118   6e-27   
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  117   6e-27   
ref|XP_006847414.1|  hypothetical protein AMTR_s00153p00060550          118   6e-27   
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    118   7e-27   
ref|XP_007008884.1|  S-adenosyl-L-methionine-dependent methyltran...    117   7e-27   
gb|KDP31241.1|  hypothetical protein JCGZ_11617                         117   8e-27   
gb|KHN21029.1|  Putative methyltransferase PMT14                        117   8e-27   
ref|XP_008777700.1|  PREDICTED: probable methyltransferase PMT23        116   9e-27   
ref|XP_009369208.1|  PREDICTED: probable methyltransferase PMT23        117   9e-27   
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    117   9e-27   
emb|CDP00327.1|  unnamed protein product                                117   1e-26   
emb|CDY35169.1|  BnaA09g18060D                                          118   1e-26   
gb|KJB60757.1|  hypothetical protein B456_009G324300                    117   1e-26   
gb|KHG10506.1|  hypothetical protein F383_11349                         117   1e-26   
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    117   1e-26   
ref|XP_004500572.1|  PREDICTED: probable methyltransferase PMT23-...    117   1e-26   
gb|KHN38532.1|  Putative methyltransferase PMT23                        117   1e-26   
ref|XP_008660000.1|  PREDICTED: probable methyltransferase PMT2 i...    115   1e-26   
ref|XP_003519422.1|  PREDICTED: probable methyltransferase PMT23-...    117   1e-26   
gb|EMS63414.1|  putative methyltransferase PMT2                         116   1e-26   
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             117   1e-26   
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    117   1e-26   
ref|XP_006353441.1|  PREDICTED: probable methyltransferase PMT22-...    117   1e-26   
gb|KHN06856.1|  Putative methyltransferase PMT2                         112   1e-26   
ref|NP_001050233.1|  Os03g0379100                                       117   1e-26   
ref|XP_010504492.1|  PREDICTED: probable methyltransferase PMT22        109   1e-26   
ref|XP_010089758.1|  putative methyltransferase PMT2                    117   2e-26   
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         117   2e-26   
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             117   2e-26   
ref|XP_010552854.1|  PREDICTED: probable methyltransferase PMT12        117   2e-26   
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         116   2e-26   
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             116   2e-26   
ref|XP_006578576.1|  PREDICTED: probable methyltransferase PMT2-l...    114   2e-26   
gb|KGN50684.1|  hypothetical protein Csa_5G211570                       116   2e-26   
emb|CDP12957.1|  unnamed protein product                                116   2e-26   
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    116   2e-26   
dbj|BAK03905.1|  predicted protein                                      117   2e-26   
gb|ACN26954.1|  unknown                                                 114   2e-26   
ref|XP_004491015.1|  PREDICTED: probable methyltransferase PMT23-...    116   2e-26   
gb|AAL86466.1|AC077693_5  hypothetical protein                          117   2e-26   
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         116   2e-26   
ref|NP_001148962.1|  ankyrin protein kinase-like                        116   2e-26   
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         116   3e-26   
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             116   3e-26   
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    116   3e-26   
gb|EMT05545.1|  hypothetical protein F775_20122                         116   3e-26   
ref|XP_004148176.1|  PREDICTED: probable methyltransferase PMT23-...    115   3e-26   
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        113   3e-26   
ref|XP_002315142.2|  hypothetical protein POPTR_0010s19240g             116   3e-26   
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          115   4e-26   
ref|XP_011035889.1|  PREDICTED: probable methyltransferase PMT23        115   4e-26   
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        115   4e-26   
emb|CDY70936.1|  BnaAnng35600D                                          110   4e-26   
ref|XP_002511570.1|  ATP binding protein, putative                      115   5e-26   
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    115   5e-26   
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    115   5e-26   
emb|CDY24913.1|  BnaC03g22590D                                          115   5e-26   
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             115   5e-26   
gb|KHG23981.1|  hypothetical protein F383_09020                         115   5e-26   
ref|XP_009345335.1|  PREDICTED: probable methyltransferase PMT23        115   5e-26   
gb|KJB80180.1|  hypothetical protein B456_013G084900                    115   5e-26   
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like    111   6e-26   
ref|XP_003628359.1|  hypothetical protein MTR_8g055840                  113   6e-26   
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         115   6e-26   
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         115   6e-26   
ref|NP_001055814.1|  Os05g0472200                                       114   6e-26   
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2         115   7e-26   
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    115   7e-26   
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        115   7e-26   
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        115   7e-26   
gb|EEC67295.1|  hypothetical protein OsI_34283                          115   7e-26   
emb|CDX94256.1|  BnaC02g29160D                                          115   8e-26   
ref|NP_001065036.1|  Os10g0510400                                       115   8e-26   



>ref|XP_007048444.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=815

 Score =   221 bits (564),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+ ++ EVDR+LRPE
Sbjct  698  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKKRCNLLAVIAEVDRVLRPE  757

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+TELEN+L+SM +++RMTY+   EGLLCVQK+MWRPKEV+T+ YAIA
Sbjct  758  GKLIVRDNVETITELENMLRSMQWEVRMTYTKDTEGLLCVQKSMWRPKEVETITYAIA  815



>gb|KJB48927.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48929.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
 gb|KJB48930.1| hypothetical protein B456_008G094300 [Gossypium raimondii]
Length=813

 Score =   219 bits (559),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 94/118 (80%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+ ++CNL+ +V EVDRILRPE
Sbjct  696  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLNKRCNLVAIVAEVDRILRPE  755

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ ELEN+LKSM +++RMTYS   EGLLCVQK+MWRPKEV+T+ YAIA
Sbjct  756  GKLIVRDNVETINELENMLKSMQWEVRMTYSKDKEGLLCVQKSMWRPKEVETIKYAIA  813



>ref|XP_009771172.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
 ref|XP_009771173.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=807

 Score =   219 bits (557),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KC L  +V EVDRILRPE
Sbjct  690  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCGLPAIVAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E +TELE++ KSMHY+IRMTYS   EGLLCVQKTMWRPKEV+TL YA+A
Sbjct  750  GKLIVRDKVEAVTELESMFKSMHYEIRMTYSKDKEGLLCVQKTMWRPKEVETLTYALA  807



>gb|KHG06416.1| hypothetical protein F383_32222 [Gossypium arboreum]
Length=820

 Score =   217 bits (552),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+ ++CNL+ +V EVDRILRPE
Sbjct  703  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLNKRCNLVAIVAEVDRILRPE  762

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ ELEN+LKSM +++RMTYS   EGLLCVQK+MWRP EV+T+ YAIA
Sbjct  763  GKLIVRDNVETINELENMLKSMQWEVRMTYSKDKEGLLCVQKSMWRPTEVETIKYAIA  820



>ref|XP_002516311.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46058.1| ATP binding protein, putative [Ricinus communis]
Length=814

 Score =   215 bits (548),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFSKIK++CNL+ ++VEVDRILRPE
Sbjct  697  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSKIKKRCNLVAVIVEVDRILRPE  756

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+TELENIL+SMH+++RMTYS   EGLL V+K+MWRPKE +T+ YAIA
Sbjct  757  GKLIVRDNVETVTELENILRSMHWEVRMTYSKEKEGLLYVEKSMWRPKESETITYAIA  814



>ref|XP_009590749.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
 ref|XP_009590750.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
Length=807

 Score =   215 bits (548),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 96/118 (81%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KC L  +V EVDRILRPE
Sbjct  690  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCGLPVIVAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E +TELE++ KSMHY+IRMTYS   EGLLCVQKTMWRP EV+TL YA+A
Sbjct  750  GKLIVRDKVEAVTELESMFKSMHYEIRMTYSKDKEGLLCVQKTMWRPTEVETLTYALA  807



>ref|XP_008227415.1| PREDICTED: probable methyltransferase PMT26 [Prunus mume]
Length=819

 Score =   214 bits (544),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  702  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  761

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELEN++KSM +++RMTYS   EGLLCVQK++WRPKE +TL YAIA
Sbjct  762  GKLIVRDDVETINELENMVKSMQWEVRMTYSKDKEGLLCVQKSLWRPKESETLKYAIA  819



>ref|XP_007214544.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
 gb|EMJ15743.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
Length=819

 Score =   213 bits (543),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +V EVDRILRPE
Sbjct  702  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLAAVVAEVDRILRPE  761

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELEN++KSM +++RMTYS   EGLLCVQK++WRPKE +TL YAIA
Sbjct  762  GKLIVRDDVETINELENMVKSMQWEVRMTYSKDKEGLLCVQKSLWRPKESETLKYAIA  819



>ref|XP_008343307.1| PREDICTED: probable methyltransferase PMT24 [Malus domestica]
Length=128

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL+GMYHDWCESFSTYPRSYDL+H+DHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  11   TLPIIYERGLYGMYHDWCESFSTYPRSYDLIHSDHLFSKLKKRCNLVAVVAEVDRILRPE  70

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD   T+ ELEN+++SM +++RMTYS   EGLLCV+K++WRPKE +TL YAIA
Sbjct  71   GTLIVRDEVGTINELENMVRSMQWEVRMTYSKDKEGLLCVKKSIWRPKESETLQYAIA  128



>gb|EYU23728.1| hypothetical protein MIMGU_mgv1a001484mg [Erythranthe guttata]
Length=810

 Score =   212 bits (539),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK KCN+M LV EVDRILRPE
Sbjct  693  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKTKCNIMALVAEVDRILRPE  752

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GK+I+RD  E + E+E++ +SMH+DIRMTYS   EGLLC QK+MWRP EV+T+ YAI 
Sbjct  753  GKIIIRDTVEIINEMESVFRSMHWDIRMTYSKDKEGLLCAQKSMWRPTEVETVTYAIG  810



>gb|KDP39437.1| hypothetical protein JCGZ_03719 [Jatropha curcas]
Length=850

 Score =   212 bits (539),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 91/118 (77%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSKIK++CNL+ +VVEVDRILRPE
Sbjct  732  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKIKKRCNLVAVVVEVDRILRPE  791

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET++ELE+IL+SMH+++RMTYS   EGLL V+K++WRPKE +T+ YAIA
Sbjct  792  GKLIVRDNVETISELESILRSMHWEVRMTYSKDKEGLLYVEKSIWRPKEFETITYAIA  849



>ref|XP_010674444.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=811

 Score =   211 bits (536),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSKIK+KCN+  LVVEVDRILRPE
Sbjct  694  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKIKKKCNMPALVVEVDRILRPE  753

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GK+I+RD+ E + ELE + +SMH++IRMTYS   EGLLC QKT WRP EV+TLAYA+
Sbjct  754  GKIIIRDNVEIINELETMFRSMHWEIRMTYSKDKEGLLCAQKTFWRPNEVETLAYAL  810



>emb|CAN60873.1| hypothetical protein VITISV_030591 [Vitis vinifera]
Length=201

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+ ++ E DRILRPE
Sbjct  84   TLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLVAVIAEADRILRPE  143

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRPKE++ +  AIA
Sbjct  144  GKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRPKEMEIIKSAIA  201



>gb|AGE09593.1| DehydRP-like protein, partial [Eucalyptus cladocalyx]
Length=217

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLH+DHLFSKIK++CNL+ LV EVDRILRP 
Sbjct  100  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHSDHLFSKIKKRCNLVALVAEVDRILRPG  159

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E+++++M +++R+TYS  +EGLLCVQK+MWRP + +T++YAIA
Sbjct  160  GKLIVRDDVETINEVESMVRAMQWEVRLTYSKDNEGLLCVQKSMWRPSKSETVSYAIA  217



>ref|XP_011099715.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=818

 Score =   210 bits (535),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKIK+KCN M LV EVDRILRPE
Sbjct  701  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIKKKCNFMALVAEVDRILRPE  760

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GK+IVRD  E ++ELENI KSM +++RMTYS   EGLL VQKTMWRP E + + YAIA
Sbjct  761  GKIIVRDKVEIISELENIFKSMQWEVRMTYSKDKEGLLYVQKTMWRPTEQEKITYAIA  818



>ref|XP_008394175.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Malus 
domestica]
Length=807

 Score =   210 bits (534),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  690  TLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRPKE +TL YAIA
Sbjct  750  GKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRPKESETLKYAIA  807



>gb|KDO51659.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
 gb|KDO51660.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=796

 Score =   210 bits (534),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++CNL+ +V EVDRILRPE
Sbjct  679  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCNLVAVVAEVDRILRPE  738

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELE+++K M +++RMTYS   EGLLCV+K+MWRPKE++T+ YAIA
Sbjct  739  GKLIVRDDVETINELESMVKGMQWEVRMTYSKDKEGLLCVEKSMWRPKELETIKYAIA  796



>ref|XP_006432154.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
 ref|XP_006465082.1| PREDICTED: probable methyltransferase PMT26-like [Citrus sinensis]
 gb|ESR45394.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
Length=796

 Score =   210 bits (534),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++CNL+ +V EVDRILRPE
Sbjct  679  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCNLVAVVAEVDRILRPE  738

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELE+++K M +++RMTYS   EGLLCV+K+MWRPKE++T+ YAIA
Sbjct  739  GKLIVRDDVETINELESMVKGMQWEVRMTYSKDKEGLLCVEKSMWRPKELETIKYAIA  796



>ref|XP_008394173.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
 ref|XP_008394174.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
Length=820

 Score =   210 bits (534),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  703  TLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  762

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRPKE +TL YAIA
Sbjct  763  GKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRPKESETLKYAIA  820



>gb|KJB40479.1| hypothetical protein B456_007G066000 [Gossypium raimondii]
Length=899

 Score =   210 bits (535),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADH+FS++K++CN + +V EVDRILRP 
Sbjct  782  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHIFSRVKKRCNFVAVVAEVDRILRPG  841

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI RD  ET+TELEN+++SMH+++R++YS   EGLLCVQK+MWRP EV+TL YAIA
Sbjct  842  GKLIARDDVETITELENMVRSMHWEVRLSYSKDKEGLLCVQKSMWRPTEVETLTYAIA  899



>gb|KHG04009.1| hypothetical protein F383_29196 [Gossypium arboreum]
Length=770

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADH+FS++K++CN + +V EVDRILRP 
Sbjct  653  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHIFSRVKKRCNFVAVVAEVDRILRPG  712

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI RD  ET+TELEN+++SMH+++R++YS   EGLLCVQK+MWRP EV+TL YAIA
Sbjct  713  GKLIARDDVETITELENMVRSMHWEVRLSYSKDKEGLLCVQKSMWRPTEVETLTYAIA  770



>ref|XP_004288094.1| PREDICTED: probable methyltransferase PMT26 [Fragaria vesca subsp. 
vesca]
Length=800

 Score =   209 bits (533),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFS +K++C L+ +V EVDRILRPE
Sbjct  683  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSLLKKRCKLVAVVAEVDRILRPE  742

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELE++LKSM +++RMTYS   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  743  GKLIVRDTVETINELESMLKSMQWEVRMTYSKDKEGLLCVQKSMWRPKETETVKYAIA  800



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score =   209 bits (532),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C+++ +  EVDRILRPE
Sbjct  723  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKVKKRCSMVAVFAEVDRILRPE  782

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ ELEN+ +SM +++RMTYS   EGLLCVQK+MWRP E +TL YAIA
Sbjct  783  GKLIVRDNVETINELENMARSMQWEVRMTYSKDKEGLLCVQKSMWRPSESETLTYAIA  840



>ref|XP_010090820.1| putative methyltransferase PMT26 [Morus notabilis]
 gb|EXB40945.1| putative methyltransferase PMT26 [Morus notabilis]
Length=816

 Score =   207 bits (528),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCES+STYPR+YDLLHADHLFSK+K +CNL+ +V EVDR+LRPE
Sbjct  698  TLPIIYERGLFGMYHDWCESYSTYPRTYDLLHADHLFSKLKTRCNLVAVVAEVDRLLRPE  757

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  E + ELEN++KSM +++RMTYS  +EGLLCVQK+MWRP E +TL YAI
Sbjct  758  GKLIVRDSVEIINELENMVKSMQWEVRMTYSKENEGLLCVQKSMWRPNESETLKYAI  814



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score =   207 bits (527),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  679  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  738

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++RMTYS   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  739  GKLIVRDKVEIINELENMARSMQWEVRMTYSKDKEGLLCVQKSMWRPKESETINYAIA  796



>ref|XP_002309924.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE90374.1| dehydration-responsive family protein [Populus trichocarpa]
Length=824

 Score =   207 bits (527),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C+++ +  EVDRILRPE
Sbjct  707  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKVKKRCSMVAVFAEVDRILRPE  766

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ ELEN+ +SM +++RMTYS   EGLLCVQK+ WRP+E +TL YAIA
Sbjct  767  GKLIVRDNVETMNELENMARSMQWEVRMTYSKDKEGLLCVQKSKWRPRESETLTYAIA  824



>ref|XP_009355841.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
 ref|XP_009355842.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
Length=820

 Score =   207 bits (527),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  703  TLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  762

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELEN+ +SM +++ +TYS   EGLLCVQK+MWRP+E ++L YAIA
Sbjct  763  GKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEGLLCVQKSMWRPEESESLKYAIA  820



>emb|CDP04655.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   206 bits (523),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K KCN    V EVDR LRPE
Sbjct  649  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKNKCNFNAFVAEVDRTLRPE  708

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GK+IVRD  E + ELE+I KS+H++IRMTYS   EGLLC QKT+WRPKE + ++YA+A
Sbjct  709  GKIIVRDKVEMINELESIFKSLHWEIRMTYSKDKEGLLCAQKTVWRPKESEIVSYALA  766



>ref|XP_003602637.1| Ankyrin-like protein [Medicago truncatula]
 gb|AES72888.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=789

 Score =   206 bits (523),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK++++CNL  LV EVDRILRPE
Sbjct  672  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKVQKRCNLASLVAEVDRILRPE  731

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  E + ELE+++KSM +++RMTYS   EGLLCVQK+ WRPKE +TL YAI
Sbjct  732  GKLIVRDTVEVINELESMVKSMQWEVRMTYSKDKEGLLCVQKSTWRPKETETLKYAI  788



>ref|XP_006345748.1| PREDICTED: probable methyltransferase PMT26-like [Solanum tuberosum]
Length=813

 Score =   206 bits (523),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSKIK KC L+ +V EVDRILRP 
Sbjct  696  TLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKIKTKCGLLAIVAEVDRILRPG  755

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET++ELE++LKSM Y+I MTYS   EGLL  QKTMWRPK+V+TL YAIA
Sbjct  756  GKLIVRDKEETISELESMLKSMQYEINMTYSKDKEGLLYCQKTMWRPKDVETLTYAIA  813



>ref|XP_010270332.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Nelumbo 
nucifera]
Length=807

 Score =   206 bits (523),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  690  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ EL N+ +S+ ++IRMTYS  +EGLLC+QKT+WRP E +T++YAIA
Sbjct  750  GKLIVRDNVETIGELSNMARSLQWEIRMTYSQDNEGLLCLQKTVWRPTEQETISYAIA  807



>ref|XP_010270331.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score =   206 bits (523),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  691  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCNLVAVVAEVDRILRPE  750

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ EL N+ +S+ ++IRMTYS  +EGLLC+QKT+WRP E +T++YAIA
Sbjct  751  GKLIVRDNVETIGELSNMARSLQWEIRMTYSQDNEGLLCLQKTVWRPTEQETISYAIA  808



>emb|CBI37509.3| unnamed protein product [Vitis vinifera]
Length=761

 Score =   205 bits (522),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+ ++ E DRILRPE
Sbjct  644  TLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLVAVIAEADRILRPE  703

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRPKE++ +  AIA
Sbjct  704  GKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRPKEMEIIKSAIA  761



>ref|XP_002266357.1| PREDICTED: probable methyltransferase PMT26 [Vitis vinifera]
Length=825

 Score =   205 bits (522),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YH+WCESF+TYPRSYDLLHADH+FSK K+KCNL+ ++ E DRILRPE
Sbjct  708  TLPIIYERGLFGIYHNWCESFNTYPRSYDLLHADHIFSKTKKKCNLVAVIAEADRILRPE  767

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ETL ++EN+L+SMH++IRMTYS   EGLLC QKTMWRPKE++ +  AIA
Sbjct  768  GKLIVRDDVETLGQVENMLRSMHWEIRMTYSKEKEGLLCAQKTMWRPKEMEIIKSAIA  825



>ref|XP_004239625.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
 ref|XP_010321299.1| PREDICTED: probable methyltransferase PMT26 [Solanum lycopersicum]
Length=813

 Score =   205 bits (521),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSKIK KC L  +V EVDRILRP 
Sbjct  696  TLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKIKTKCGLPAIVAEVDRILRPG  755

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+TELE++LKSM Y+I MTYS   EGLL  QKTMWRPK+V+TL YAIA
Sbjct  756  GKLIVRDKEETITELESMLKSMQYEINMTYSKDKEGLLYCQKTMWRPKDVETLTYAIA  813



>ref|XP_004502956.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=803

 Score =   204 bits (520),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFSKIK++C +  LV EVDRILRPE
Sbjct  686  TLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKIKKRCTVAALVAEVDRILRPE  745

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  E + ELEN+++SM +++RMTYS   EGLLCVQK+ WRPKEV+TL YAI
Sbjct  746  GKLIVRDTVEIIDELENLVRSMQWEVRMTYSKDKEGLLCVQKSKWRPKEVETLQYAI  802



>ref|XP_010930722.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=887

 Score =   204 bits (518),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPR+YDLLHADHLFS++K++C L+ ++VEVDRILRPE
Sbjct  770  TLPVIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLLPVIVEVDRILRPE  829

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKL+VRD+ E + E+E+I KS+H++IRMTYS  DEGLLCVQKT+WRPKEV +    I+
Sbjct  830  GKLLVRDNAEIINEVESIAKSLHWEIRMTYSKNDEGLLCVQKTIWRPKEVASSTTPIS  887



>ref|XP_003564784.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
 ref|XP_010232657.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=812

 Score =   203 bits (517),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+  EVDRILRPE
Sbjct  699  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGVFAEVDRILRPE  758

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ ELE + KS+H+++ MTY+ G+EGLLCVQKTMWRPKE++
Sbjct  759  GKLIVRDSAETIIELEGMAKSLHWEVTMTYAKGNEGLLCVQKTMWRPKEIE  809



>ref|XP_007159858.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
 gb|ESW31852.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
Length=832

 Score =   203 bits (516),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD LFS IK +CNL  +V EVDRILRPE
Sbjct  711  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADRLFSNIKNRCNLRAVVAEVDRILRPE  770

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  + + E+E I+KSMH+D+RMTYS    G LCVQK+MWRPKE +TL Y+I 
Sbjct  771  GKLIVRDTVDIINEIEAIVKSMHWDVRMTYSKDKVGFLCVQKSMWRPKEFETLEYSIG  828



>ref|XP_010027631.1| PREDICTED: probable methyltransferase PMT26 [Eucalyptus grandis]
 gb|KCW54199.1| hypothetical protein EUGRSUZ_I00186 [Eucalyptus grandis]
Length=814

 Score =   203 bits (516),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLH+DHLFSKIK++CNL+ LV EVDRILRP 
Sbjct  697  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHSDHLFSKIKKRCNLVALVAEVDRILRPG  756

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI+RD  ET+ E+E+++++M +++R+TYS  +EGLLCVQK+MWRP + +T++YAIA
Sbjct  757  GKLIIRDDVETINEVESMVRAMQWEVRLTYSKDNEGLLCVQKSMWRPSKSETVSYAIA  814



>ref|XP_011031161.1| PREDICTED: probable methyltransferase PMT26 isoform X6 [Populus 
euphratica]
Length=828

 Score =   203 bits (516),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  711  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  770

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  771  GKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRPKESETINYAIA  828



>ref|XP_011031160.1| PREDICTED: probable methyltransferase PMT26 isoform X5 [Populus 
euphratica]
Length=828

 Score =   203 bits (516),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  711  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  770

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  771  GKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRPKESETINYAIA  828



>ref|XP_011031158.1| PREDICTED: probable methyltransferase PMT26 isoform X3 [Populus 
euphratica]
 ref|XP_011031159.1| PREDICTED: probable methyltransferase PMT26 isoform X4 [Populus 
euphratica]
Length=830

 Score =   203 bits (516),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  713  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  772

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  773  GKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRPKESETINYAIA  830



>ref|XP_011031157.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Populus 
euphratica]
Length=836

 Score =   203 bits (516),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  719  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  778

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  779  GKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRPKESETINYAIA  836



>ref|XP_011031156.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Populus 
euphratica]
Length=846

 Score =   203 bits (516),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K++CNL  +  EVDRILRPE
Sbjct  729  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKKRCNLAAVFAEVDRILRPE  788

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELEN+ +SM +++ MT+S   EGLLCVQK+MWRPKE +T+ YAIA
Sbjct  789  GKLIVRDKVEIINELENMARSMKWEVSMTFSKDKEGLLCVQKSMWRPKESETINYAIA  846



>ref|XP_010521110.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
 ref|XP_010521118.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=861

 Score =   202 bits (515),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +VVEVDR+LRPE
Sbjct  744  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVVVEVDRMLRPE  803

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI+RD  ET+ ++E + KSM +++RMTYS   EG+LC+QK+MWRP EV+TLAYAIA
Sbjct  804  GKLILRDDAETIQQVEMMAKSMKWEVRMTYSKEKEGILCLQKSMWRPAEVETLAYAIA  861



>ref|XP_008805853.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
 ref|XP_008805854.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=806

 Score =   202 bits (514),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRILRPE
Sbjct  689  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCELPPVIAEVDRILRPE  748

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ E+EN+ KS+H++IRMTYS   EGLLCVQKT+WRPKE +  A +++
Sbjct  749  GKLIVRDNAETINEIENMAKSLHWEIRMTYSKDHEGLLCVQKTIWRPKEQEARASSMS  806



>ref|XP_011078779.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=817

 Score =   202 bits (514),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK K KCN   +V EVDRILRPE
Sbjct  700  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKTKNKCNFKAVVSEVDRILRPE  759

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GK+IVRD  ET++ELEN+ KS+ ++IRMTYS  +EGLL  QKTMWRPKE + + YAIA
Sbjct  760  GKIIVRDTVETISELENLFKSLQWEIRMTYSKDNEGLLYAQKTMWRPKEEEIVTYAIA  817



>ref|XP_008360714.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=840

 Score =   202 bits (513),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL+GMYHDWCESFSTYPRSYDL+H+DHLFSK+K++CNL+ +V EVDRILRPE
Sbjct  723  TLPIIYERGLYGMYHDWCESFSTYPRSYDLIHSDHLFSKLKKRCNLVAVVAEVDRILRPE  782

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD   T+ ELEN+++SM +++RMTYS   EGLLC +K++WRPKE +TL YAIA
Sbjct  783  GTLIVRDEVGTINELENMVRSMQWEVRMTYSKDKEGLLCXKKSIWRPKESETLQYAIA  840



>ref|XP_010530224.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=128

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  11   TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSALKKRCNLISVMAEVDRILRPQ  70

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E + KSM +++RMTYS  +EGLL VQKT WRPKE +T+  AIA
Sbjct  71   GTFIVRDDVETVGEVERMAKSMKWEVRMTYSKDNEGLLSVQKTFWRPKEAETIKSAIA  128



>ref|XP_008781596.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=886

 Score =   202 bits (513),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERG FGMYHDWCESFSTYPR+YDLLHADHLFS++K++C L+ ++VEVDRILRPE
Sbjct  769  TLPVIYERGFFGMYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLLPVIVEVDRILRPE  828

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKL+VRD+ E + E+E+I KS+H++IRMTYS  +EGLLCVQKTMWRPKEV +    I+
Sbjct  829  GKLLVRDNAEIINEVESIAKSLHWEIRMTYSKNNEGLLCVQKTMWRPKEVASSTTPIS  886



>gb|KHG15143.1| hypothetical protein F383_09666 [Gossypium arboreum]
Length=891

 Score =   201 bits (512),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ +V EVDRILRP 
Sbjct  774  TLPIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKVKKRCKLVSVVAEVDRILRPG  833

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ ELE+++ SM +++  TYS   EGLLCVQK+MWRPKEVQT+ +AI+
Sbjct  834  GKLIVRDNVETINELEDMVMSMEWEVLKTYSKNKEGLLCVQKSMWRPKEVQTVTFAIS  891



>ref|XP_004503920.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503921.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Cicer 
arietinum]
Length=819

 Score =   201 bits (511),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C    +V EVDRILRPE
Sbjct  702  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKFEAVVAEVDRILRPE  761

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD +E + ELE++ KSM +++RMTYS   EG LCVQK+MWRPKE +T+ YAI 
Sbjct  762  GKLIVRDTSEIINELESLAKSMQWEVRMTYSKDTEGFLCVQKSMWRPKESETVDYAIG  819



>ref|XP_008783335.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=807

 Score =   201 bits (510),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 84/110 (76%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ ++ EVDRILRPE
Sbjct  690  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVIAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  317
            G LIVRD+ E + E+EN+ KS+H++IRMTYS  +EGLLCVQKTMWRPKE+
Sbjct  750  GNLIVRDNVEIINEIENMAKSLHWEIRMTYSKNNEGLLCVQKTMWRPKEL  799



>gb|KJB71369.1| hypothetical protein B456_011G118900 [Gossypium raimondii]
Length=1015

 Score =   202 bits (514),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ +V EVDRILRP 
Sbjct  898   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKVKKRCKLVSVVAEVDRILRPG  957

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
             GKLIVRD+ +T+ ELE+++ SM +++  TYS   EGLLCVQK+MWRPKEVQT+ +AI+
Sbjct  958   GKLIVRDNVDTINELEDMVMSMEWEVLKTYSKNKEGLLCVQKSMWRPKEVQTVTFAIS  1015



>gb|KHN34092.1| Putative methyltransferase PMT26 [Glycine soja]
Length=849

 Score =   201 bits (510),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +CNL  +V E+DRILRPE
Sbjct  732  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCNLKAVVAEIDRILRPE  791

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E ++E+E+++KSM +++RMTYS    G LCVQK+MWRPKE++TL YAI 
Sbjct  792  GKLIVRDTVEIISEIESMVKSMKWEVRMTYSKDKVGFLCVQKSMWRPKELETLEYAIG  849



>ref|XP_006580338.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006580339.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=831

 Score =   200 bits (509),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +CNL  +V E+DRILRPE
Sbjct  714  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCNLKAVVAEIDRILRPE  773

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E ++E+E+++KSM +++RMTYS    G LCVQK+MWRPKE++TL YAI 
Sbjct  774  GKLIVRDTVEIISEIESMVKSMKWEVRMTYSKDKVGFLCVQKSMWRPKELETLEYAIG  831



>emb|CDY31339.1| BnaA02g34020D [Brassica napus]
Length=764

 Score =   200 bits (508),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +V EVDR+LRPE
Sbjct  646  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVVAEVDRVLRPE  705

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E I+K+M +++RMTYS   EGLL VQK++WRP+EV+TL YAIA
Sbjct  706  GKLIVRDDAETIQEVEAIVKAMKWEVRMTYSKEKEGLLSVQKSIWRPEEVETLTYAIA  763



>gb|EMS53293.1| putative methyltransferase PMT26 [Triticum urartu]
Length=946

 Score =   201 bits (511),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 83/111 (75%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+  EVDRILRPE
Sbjct  833  TLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGVFAEVDRILRPE  892

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET++ELE++ KS+ +++RMTY+ G EGLLCVQKT WRPKE++
Sbjct  893  GKLIVRDDAETISELESMAKSLQWEVRMTYARGKEGLLCVQKTTWRPKEIE  943



>gb|EMT17461.1| hypothetical protein F775_31288 [Aegilops tauschii]
Length=795

 Score =   200 bits (508),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 83/111 (75%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+  EVDRILRPE
Sbjct  682  TLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGVFAEVDRILRPE  741

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET++ELE++ KS+ +++RMTY+ G EGLLCVQKT WRPKE++
Sbjct  742  GKLIVRDDAETISELESMAKSLQWEVRMTYAKGKEGLLCVQKTTWRPKEIE  792



>ref|XP_006394213.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
 gb|ESQ31499.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
Length=831

 Score =   200 bits (509),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +V EVDR+LRPE
Sbjct  714  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVVAEVDRVLRPE  773

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL V+K++WRPKEV+TL YAIA
Sbjct  774  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKDKEGLLSVKKSIWRPKEVETLTYAIA  831



>ref|XP_008462649.1| PREDICTED: probable methyltransferase PMT26 [Cucumis melo]
Length=822

 Score =   200 bits (508),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+  LV E DRILRPE
Sbjct  705  TLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIAALVAETDRILRPE  764

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP E +TL YAIA
Sbjct  765  GKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRPNESETLQYAIA  822



>ref|XP_010908928.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=800

 Score =   199 bits (507),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ ++ EVDRILRPE
Sbjct  691  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVIAEVDRILRPE  750

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD+ ET+ E+EN+ KS+H++IRMTYS   EGLLCVQKTMWRP
Sbjct  751  GKLIVRDNVETINEVENMAKSLHWEIRMTYSKDREGLLCVQKTMWRP  797



>gb|EAY76734.1| hypothetical protein OsI_04689 [Oryza sativa Indica Group]
Length=798

 Score =   199 bits (506),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +  EVDRILRPE
Sbjct  685  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVFAEVDRILRPE  744

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE++
Sbjct  745  GKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKEIE  795



>ref|XP_009130433.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
 ref|XP_009130434.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=764

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +V EVDR+LRPE
Sbjct  646  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVVAEVDRVLRPE  705

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK++WRP+EV+TL YAIA
Sbjct  706  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLSVQKSIWRPEEVETLTYAIA  763



>emb|CDY39830.1| BnaC02g42880D [Brassica napus]
Length=772

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  +V EVDR+LRPE
Sbjct  654  TLAIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVVAEVDRVLRPE  713

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK++WRP+EV+TL YAIA
Sbjct  714  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLSVQKSIWRPEEVETLTYAIA  771



>ref|NP_001045015.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAF06929.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAG94735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=806

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +  EVDRILRPE
Sbjct  693  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVFAEVDRILRPE  752

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE++
Sbjct  753  GKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKEIE  803



>dbj|BAD82580.1| ankyrin-like protein [Oryza sativa Japonica Group]
 gb|EAZ14397.1| hypothetical protein OsJ_04316 [Oryza sativa Japonica Group]
Length=798

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +  EVDRILRPE
Sbjct  685  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVFAEVDRILRPE  744

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE++
Sbjct  745  GKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKEIE  795



>ref|XP_004143348.1| PREDICTED: probable methyltransferase PMT26-like [Cucumis sativus]
 gb|KGN48314.1| hypothetical protein Csa_6G476050 [Cucumis sativus]
Length=830

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+  LV E DRILRP+
Sbjct  713  TLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIAALVAETDRILRPD  772

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP E +TL YAIA
Sbjct  773  GKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRPSESETLQYAIA  830



>ref|XP_006645134.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=798

 Score =   198 bits (504),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 81/111 (73%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ +  EVDRILRPE
Sbjct  685  TLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLPVFAEVDRILRPE  744

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD+ ET+ EL+ ++KS+ +++RMTY+ G+EGLLCVQK+MWRPKE++
Sbjct  745  GKLIVRDNAETINELQGMVKSLQWEVRMTYTKGNEGLLCVQKSMWRPKEIE  795



>ref|XP_004166405.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT26-like 
[Cucumis sativus]
Length=829

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESF+TYPRSYDLLHADHLFSK+K +CN+  LV E DRILRP+
Sbjct  712  TLPIIFERGLFGIYHDWCESFNTYPRSYDLLHADHLFSKVKTRCNIAALVAETDRILRPD  771

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD++ET+ ELE++ KSM +++R TY   +E LLCVQK+MWRP E +TL YAIA
Sbjct  772  GKLIVRDNSETVNELESMFKSMKWEVRFTYFKDNEALLCVQKSMWRPSESETLQYAIA  829



>ref|XP_006281931.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
 gb|EOA14829.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
Length=817

 Score =   198 bits (504),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  700  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  759

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ++E+++K+M +++RMTYS   EGLL VQK+ WRP EV+TL YAIA
Sbjct  760  GKLIVRDDAETIQQVESMVKAMKWEVRMTYSKDKEGLLSVQKSFWRPNEVETLTYAIA  817



>ref|NP_001176817.1| Os12g0178300 [Oryza sativa Japonica Group]
 dbj|BAH95545.1| Os12g0178300 [Oryza sativa Japonica Group]
Length=199

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ ++VEVDRILRPE
Sbjct  82   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLLPVMVEVDRILRPE  141

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRPKEV+  A
Sbjct  142  GKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRPKEVEKAA  195



>ref|XP_010484172.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
 ref|XP_010484174.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=821

 Score =   198 bits (504),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  704  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  763

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP EV+TL YAIA
Sbjct  764  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLAVQKSFWRPNEVETLTYAIA  821



>ref|XP_010461320.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=819

 Score =   198 bits (504),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  702  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  761

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP EV+TL YAIA
Sbjct  762  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSKEKEGLLAVQKSFWRPNEVETLTYAIA  819



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score =   198 bits (504),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDL+HADHLFSK K++C L+ +V EVDRILRPE
Sbjct  749  TLPIIYERGLFGMYHDWCESFSTYPRSYDLVHADHLFSKAKKRCTLVAVVAEVDRILRPE  808

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ ET+ ELEN+ +S+ +DIR+ YS   EGLLCVQKT+WRP + + + YAI
Sbjct  809  GKLIVRDNIETIVELENMARSLQWDIRLKYSQDKEGLLCVQKTLWRPTQQEMITYAI  865



>emb|CDM85080.1| unnamed protein product [Triticum aestivum]
Length=803

 Score =   197 bits (502),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPI+YERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+G+  EVDRILRPE
Sbjct  690  TLPIVYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLLGVFAEVDRILRPE  749

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD+ ET++ELE + KS+ +++RMTY+   EGLLCVQKT WRPKE++
Sbjct  750  GKLIVRDNAETISELEGMAKSLQWEVRMTYAKDKEGLLCVQKTTWRPKEIE  800



>ref|XP_010911089.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
 ref|XP_010911096.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=799

 Score =   197 bits (501),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRILRPE
Sbjct  691  TLPVIYERGLFGTYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQPVIAEVDRILRPE  750

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  320
            G LIVRD+ E + E+ENI KS+H++IRMTYS  +EGLLCVQKTMWRPKE
Sbjct  751  GNLIVRDNVEIINEIENIAKSLHWEIRMTYSKDNEGLLCVQKTMWRPKE  799



>gb|KHN16949.1| Putative methyltransferase PMT26 [Glycine soja]
Length=832

 Score =   197 bits (501),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +C+L  +V E+DRILRPE
Sbjct  715  TLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCSLKAVVAEIDRILRPE  774

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + E+E+++KSM +++RMTYS    G LCVQK+MWRPKE++TL YAI 
Sbjct  775  GKLIVRDTVEIINEMESMVKSMQWEVRMTYSKDKVGFLCVQKSMWRPKELETLEYAIG  832



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score =   197 bits (501),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPRSYDLLHAD+LFS IK +C+L  +V E+DRILRPE
Sbjct  725  TLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADNLFSNIKNRCSLKAVVAEIDRILRPE  784

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + E+E+++KSM +++RMTYS    G LCVQK+MWRPKE++TL YAI 
Sbjct  785  GKLIVRDTVEIINEMESMVKSMQWEVRMTYSKDKVGFLCVQKSMWRPKELETLEYAIG  842



>ref|XP_010530222.1| PREDICTED: probable methyltransferase PMT25 [Tarenaya hassleriana]
 ref|XP_010530223.1| PREDICTED: probable methyltransferase PMT25 [Tarenaya hassleriana]
Length=288

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  171  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSALKKRCNLISVMAEVDRILRPQ  230

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E + KSM +++RMTYS  +EGLL VQKT WRPKE +T+  AIA
Sbjct  231  GTFIVRDDVETVGEVERMAKSMKWEVRMTYSKDNEGLLSVQKTFWRPKEAETIKSAIA  288



>ref|XP_009410679.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=797

 Score =   197 bits (500),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C L+ ++ EVDR+LRPE
Sbjct  680  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCRLLPVIAEVDRVLRPE  739

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  + ++E+EN+ KS+H++I +TYSN +EGLLCVQKTMWRP++ +
Sbjct  740  GKLIVRDDADVISEIENMAKSLHWEITLTYSNDNEGLLCVQKTMWRPQDTE  790



>ref|XP_003526869.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006581774.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=806

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL  +V E DRILRPE
Sbjct  689  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLAAVVAEADRILRPE  748

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRPKE + L YAIA
Sbjct  749  GKLIVRDTVEIIEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRPKEQEKLEYAIA  806



>gb|KHN09623.1| Putative methyltransferase PMT26 [Glycine soja]
Length=806

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL  +V E DRILRPE
Sbjct  689  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLAAVVAEADRILRPE  748

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRPKE + L YAIA
Sbjct  749  GKLIVRDTVEIIEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRPKEQEKLEYAIA  806



>dbj|BAB10271.1| ankyrin-like protein [Arabidopsis thaliana]
Length=786

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  669  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  728

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ++E ++K+M +++RMTYS   EGLL VQK++WRP EV+TL YAI 
Sbjct  729  GKLIVRDDAETIQQVEGMVKAMKWEVRMTYSKEKEGLLSVQKSIWRPSEVETLTYAIG  786



>ref|XP_010444329.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=822

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  705  TLAIIYERGLFGVYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  764

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTY    EGLL VQK++WRP EV+TL YAIA
Sbjct  765  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYLKEKEGLLAVQKSLWRPNEVETLTYAIA  822



>ref|NP_201208.2| putative methyltransferase PMT26 [Arabidopsis thaliana]
 sp|Q8L7V3.1|PMTQ_ARATH RecName: Full=Probable methyltransferase PMT26 [Arabidopsis thaliana]
 gb|AAM78114.1| AT5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AAO23578.1| At5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AED97831.1| putative methyltransferase PMT26 [Arabidopsis thaliana]
Length=829

 Score =   196 bits (499),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CNL  ++ EVDR+LRPE
Sbjct  712  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNLTAVIAEVDRVLRPE  771

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ++E ++K+M +++RMTYS   EGLL VQK++WRP EV+TL YAI 
Sbjct  772  GKLIVRDDAETIQQVEGMVKAMKWEVRMTYSKEKEGLLSVQKSIWRPSEVETLTYAIG  829



>ref|XP_002520274.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42060.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score =   196 bits (497),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+ +V EVDRILRPE
Sbjct  685  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLKKRCNLVAVVAEVDRILRPE  744

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ + + E+E++ KS+ ++IRM Y+  DEGLLCV+KTMWRP E +T+  AI
Sbjct  745  GKLIVRDNVDIIGEIESMAKSLKWEIRMIYTKDDEGLLCVRKTMWRPTEAETIKSAI  801



>ref|XP_002864883.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41142.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score =   196 bits (497),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS++K++CNL  ++ EVDR+LRPE
Sbjct  704  TLAIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRLKQRCNLTAVIAEVDRVLRPE  763

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ E+E ++K+M +++RMTYS   EGLL VQK+ WRP EV+TL YAI 
Sbjct  764  GKLIVRDDAETIQEVEAMVKAMKWEVRMTYSREKEGLLSVQKSFWRPNEVETLTYAIG  821



>ref|XP_004970814.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=797

 Score =   195 bits (496),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C LM +  EVDR+LRP+
Sbjct  684  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLMAVFAEVDRVLRPQ  743

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G+EGLLCV+K+MWRPKE++
Sbjct  744  GKLIVRDTADTINELESMAKSLKWEVRMTYTKGNEGLLCVEKSMWRPKELE  794



>gb|KDO36646.1| hypothetical protein CISIN_1g027471mg [Citrus sinensis]
Length=223

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L  +V EVDRILRP+
Sbjct  106  TLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLKAVVAEVDRILRPD  165

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRPKE +T+  A+
Sbjct  166  GNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRPKETETILSAM  222



>ref|XP_009383568.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=883

 Score =   195 bits (496),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIK++C L  ++ EVDRILRPE
Sbjct  766  TLPLIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKKRCKLRAVIAEVDRILRPE  825

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD++ET+ E+E++ KS+ +++RMTYS  +EGLL VQKTMWRPKEV+
Sbjct  826  GKLIVRDNSETIEEVESMAKSLKWEVRMTYSKENEGLLFVQKTMWRPKEVE  876



>gb|KDP32896.1| hypothetical protein JCGZ_12188 [Jatropha curcas]
Length=813

 Score =   194 bits (494),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS IK++CN++ ++ EVDRILRPE
Sbjct  696  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSIKKRCNIVAVMAEVDRILRPE  755

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRDH E + E+E + KSM ++IRM YS  +EGLL V+KTMWRP E +T+  AI
Sbjct  756  GKLIVRDHVEVIGEIEGMAKSMKWEIRMIYSKDNEGLLFVRKTMWRPTETETIQSAI  812



>emb|CDX84478.1| BnaC03g50220D [Brassica napus]
Length=840

 Score =   194 bits (494),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL  ++ EVDR+LRPE
Sbjct  722  TLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLTAVIAEVDRVLRPE  781

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP++VQTL YAIA
Sbjct  782  GKLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRPEDVQTLTYAIA  839



>ref|XP_011027424.1| PREDICTED: probable methyltransferase PMT24 [Populus euphratica]
Length=690

 Score =   194 bits (492),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++C+L+ ++ EVDRILRPE
Sbjct  571  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSGLKKRCDLVAVIAEVDRILRPE  630

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ E + E+E + KS+ ++IRM YS  +EGLLCVQKTMWRP E +T+  AI
Sbjct  631  GKLIVRDNVEIIGEIERLAKSLKWEIRMIYSKDNEGLLCVQKTMWRPTESETITSAI  687



>ref|XP_010546331.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=838

 Score =   194 bits (494),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++CN+  +V EVDR+LRPE
Sbjct  721  TLSIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKQRCNVTAVVAEVDRMLRPE  780

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELE+++KSM +++RMT+S   EGLL V K+ WRP +V+TL YAIA
Sbjct  781  GKLIVRDDAETIQELESMVKSMKWEVRMTFSKDKEGLLSVHKSTWRPTQVETLTYAIA  838



>ref|XP_007137790.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
 gb|ESW09784.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
Length=818

 Score =   194 bits (492),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS+++++CNL  ++ E DRILRPE
Sbjct  701  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLQKRCNLAAVLAEADRILRPE  760

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  E + E+E++++S+ + +RMTYS   EGLLCVQK+MWRPKE + L YAI
Sbjct  761  GKLIVRDTVEIIEEVESMVRSLQWKVRMTYSKDKEGLLCVQKSMWRPKEQEKLEYAI  817



>ref|XP_002300957.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
 gb|ABK94843.1| unknown [Populus trichocarpa]
 gb|EEE80230.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
Length=817

 Score =   194 bits (492),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRPE
Sbjct  698  TLPMIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLKKRCNLVAVIAEVDRILRPE  757

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ E + E+E++ KS+ ++IRM YS  +EGLLCVQKT WRP E +T+  AI
Sbjct  758  GKLIVRDNVEIIGEIESLAKSLKWEIRMIYSKDNEGLLCVQKTTWRPTESETITSAI  814



>ref|XP_004959929.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=737

 Score =   193 bits (490),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/111 (73%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSK+K++C L+ +VVEVDR+LRPE
Sbjct  624  TLPIIYERGLFGLYHDWCESFSTYPRTYDLLHANHLFSKVKKRCELLPVVVEVDRVLRPE  683

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            G+LIVRD+ ET++E+ENI+KS+H+++RM+YS   EGLL VQKT WRP EV+
Sbjct  684  GRLIVRDNIETISEVENIVKSLHWEVRMSYSQDKEGLLFVQKTSWRPNEVE  734



>ref|XP_011006303.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Populus 
euphratica]
Length=812

 Score =   193 bits (491),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+ ++ EVDRILRPE
Sbjct  695  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLVAVIAEVDRILRPE  754

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP E +T+  AI
Sbjct  755  GNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRPTEPETITSAI  811



>ref|XP_002307464.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
 gb|EEE94460.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
Length=826

 Score =   193 bits (491),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+ ++ EVDRILRPE
Sbjct  709  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLVAVIAEVDRILRPE  768

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP E +T+  AI
Sbjct  769  GNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRPTEPETITSAI  825



>gb|EAY82457.1| hypothetical protein OsI_37674 [Oryza sativa Indica Group]
Length=932

 Score =   194 bits (492),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ ++VEVDRILRPE
Sbjct  815  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLLPVMVEVDRILRPE  874

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRPKEV+  A
Sbjct  875  GKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRPKEVEKAA  928



>ref|XP_011006302.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Populus 
euphratica]
Length=826

 Score =   193 bits (490),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS + ++CNL+ ++ EVDRILRPE
Sbjct  709  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSSLTKRCNLVAVIAEVDRILRPE  768

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LIVRD+ E + E+E++ KS+++DIRM YS  +EGLLCV KTMWRP E +T+  AI
Sbjct  769  GNLIVRDNVEIIGEIESLAKSLNWDIRMIYSKDNEGLLCVHKTMWRPTEPETITSAI  825



>emb|CDY43336.1| BnaC03g59080D, partial [Brassica napus]
Length=192

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+ ++ EVDRILRP+
Sbjct  75   TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSPLKKRCSLVSVMAEVDRILRPQ  134

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP EV+T+  AIA
Sbjct  135  GTFIVRDDSETIGEIEKMVKSMKWNMTMTHSKGGEGLLSVQKSWWRPTEVETITSAIA  192



>ref|XP_003523221.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578784.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 gb|KHN31166.1| Putative methyltransferase PMT26 [Glycine soja]
Length=810

 Score =   192 bits (489),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++CNL  +V E DRILRPE
Sbjct  693  TLPIIFERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCNLAAVVAEADRILRPE  752

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  E + ELE++ +SM + +RMTYS   EGLLCV+K+ WRPKE + L YAI
Sbjct  753  GKLIVRDTVEIVEELESMARSMQWKVRMTYSKDKEGLLCVEKSKWRPKEQEKLEYAI  809



>gb|ABA96619.1| dehydration-responsive protein, putative [Oryza sativa Japonica 
Group]
Length=990

 Score =   194 bits (492),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ ++VEVDRILRPE
Sbjct  873  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLLPVMVEVDRILRPE  932

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRPKEV+  A
Sbjct  933  GKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRPKEVEKAA  986



>gb|EAZ19833.1| hypothetical protein OsJ_35417 [Oryza sativa Japonica Group]
Length=990

 Score =   194 bits (492),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK+K++C L+ ++VEVDRILRPE
Sbjct  873  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLLPVMVEVDRILRPE  932

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD  +T  E+E+IL+S+H+++RMT S   E +LC +KTMWRPKEV+  A
Sbjct  933  GKLIVRDGRDTAAEVESILRSLHWEVRMTVSKQGEVMLCAEKTMWRPKEVEKAA  986



>ref|XP_006472883.1| PREDICTED: probable methyltransferase PMT25-like [Citrus sinensis]
Length=808

 Score =   192 bits (489),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L  +V EVDRILRP+
Sbjct  691  TLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLKAVVAEVDRILRPD  750

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRPKE +T+  A+
Sbjct  751  GNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRPKETETILSAM  807



>ref|XP_006434317.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434318.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47557.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47558.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=808

 Score =   192 bits (488),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK++C+L  +V EVDRILRP+
Sbjct  691  TLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKKRCSLKAVVAEVDRILRPD  750

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRPKE +T+  A+
Sbjct  751  GNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRPKETETILSAM  807



>ref|XP_002285889.2| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
 ref|XP_010664148.1| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
Length=844

 Score =   192 bits (488),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESFSTYPRSYDL+HADHLFS +K++C L  ++ EVDRILRPE
Sbjct  727  TLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHLFSDLKKRCQLTAVIAEVDRILRPE  786

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD+ ET++E+E++ KS+ +++R+TYS   EGLLCV+KT WRP E QT+  AIA
Sbjct  787  GMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEGLLCVKKTFWRPTETQTIKSAIA  844



>ref|XP_004978303.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=1032

 Score =   194 bits (492),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFGMYHDWCESFSTYPRSYDL+HADHLFSK+K +C L+ ++VEVDRILRPE
Sbjct  919   TLPIIYERGLFGMYHDWCESFSTYPRSYDLVHADHLFSKLKSRCELLPVIVEVDRILRPE  978

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
             GKLIVRD   T+ E+E+I +S+H+++RMT S   EGLLCV KTMWRP EV+ L+
Sbjct  979   GKLIVRDDRATVEEVESIARSLHWEVRMTVSEQGEGLLCVGKTMWRPTEVEALS  1032



>emb|CDY43782.1| BnaA06g23180D [Brassica napus]
Length=799

 Score =   192 bits (487),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL  +V EVDR+LRPE
Sbjct  681  TLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLTAVVAEVDRVLRPE  740

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP++VQTL YAIA
Sbjct  741  GTLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRPEDVQTLTYAIA  798



>ref|XP_009150474.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=975

 Score =   192 bits (489),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDL+HADHL SK+K++CNL  +V EVDR+LRPE
Sbjct  857  TLAIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLLSKLKQRCNLTAVVAEVDRVLRPE  916

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  +T+ E+E ++K+M +++ MTYS G EGLL VQK++WRP++VQTL YAIA
Sbjct  917  GTLIVRDDAKTVQEVEAMVKAMKWEVHMTYSKGKEGLLSVQKSIWRPEDVQTLTYAIA  974



>ref|XP_008371274.1| PREDICTED: probable methyltransferase PMT24 [Malus domestica]
Length=288

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+ ++ EVDRILRPE
Sbjct  171  TLPIIYERGLIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLVAVIAEVDRILRPE  230

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIV D+ ETL E+E++ KS+ +DIR TYS  +EGLL +QKT WRP E +T+  AIA
Sbjct  231  GKLIVWDNAETLNEIESMAKSLQWDIRFTYSKXNEGLLYIQKTFWRPAEKETILSAIA  288



>ref|XP_003630288.1| Ankyrin-like protein [Medicago truncatula]
 gb|AET04764.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=826

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HADHLFSK+K++C    +V EVDRILRPE
Sbjct  702  TLPIIYERGLFGIYHDWCESFSTYPRSYDLVHADHLFSKLKKRCKFEAVVAEVDRILRPE  761

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD  ET+ ELE+++ +M +++RMTY+   +G+L VQK+MWRP E++T+ YAI 
Sbjct  762  GKLIVRDTAETINELESLVTAMQWEVRMTYTKDLQGILSVQKSMWRPTELETVEYAIG  819



>gb|ACN28572.1| unknown [Zea mays]
 gb|AFW84363.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=792

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 78/110 (71%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK++++C L  +  EVDR+LRP+
Sbjct  679  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLRKRCKLAAVFAEVDRVLRPQ  738

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  317
            GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G EGLLCV+K+MWRPKE+
Sbjct  739  GKLIVRDTADTINELESMAKSVQWEVRMTYTKGSEGLLCVEKSMWRPKEL  788



>ref|XP_010527657.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=790

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  673  TLPIIYERGLFGMYHDWCESFNTYPRTYDLLHADHLFSALKKRCNLISVMAEVDRILRPQ  732

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E + KSM +++RMTYS  +EGLL VQKT WRPKE +T+  AIA
Sbjct  733  GTFIVRDDVETVGEVERMAKSMKWEVRMTYSKDNEGLLSVQKTFWRPKEAETIKSAIA  790



>ref|XP_002458871.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
 gb|EES03991.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
Length=791

 Score =   191 bits (484),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 78/110 (71%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCES STYPR+YDLLHADHLFSK+ ++C LM +  EVDR+LRP+
Sbjct  678  TLPIIYERGLFGMYHDWCESLSTYPRTYDLLHADHLFSKLTKRCKLMAVFAEVDRVLRPQ  737

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  317
            GKLIVRD  +T+ ELE++ KS+ +++RMTY+ G+EGLLCV+K+MWRPKE+
Sbjct  738  GKLIVRDTADTINELESMAKSLQWEVRMTYTKGNEGLLCVEKSMWRPKEL  787



>ref|XP_006303155.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 ref|XP_006303156.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36053.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36054.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
Length=767

 Score =   191 bits (484),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRPE
Sbjct  650  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPE  709

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP+EV+T+  AIA
Sbjct  710  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPEEVETIQSAIA  767



>gb|EMT26912.1| hypothetical protein F775_10259 [Aegilops tauschii]
Length=706

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HLFSKIK++C L+G++VEVDRI+RPE
Sbjct  595  TLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLFSKIKKRCQLLGVIVEVDRIVRPE  654

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            G+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  655  GRLIVRDDMETIREVESIVKSLHWEVRLSYSQENEGLLFVQKTMWRP  701



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score =   190 bits (483),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSKIK++C L  ++VEVDRI RP 
Sbjct  703  TLPVIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKIKKRCQLRPVIVEVDRITRPG  762

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD   T++E+E  +KS+ ++IR+TYS  +EGLLC +KTMWRPK+V+T
Sbjct  763  GKLIVRDDVNTISEIETTVKSLQWEIRLTYSKDNEGLLCAEKTMWRPKQVET  814



>ref|XP_006847154.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
 gb|ERN08735.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
Length=850

 Score =   190 bits (483),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K +CNL G++VE DRILRPE
Sbjct  724  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKTRCNLEGVLVEADRILRPE  783

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKE  320
            GK+IVRD  +T+ E+E ILKSMH+D+R+TY+   E LL V+K+MWRPKE
Sbjct  784  GKMIVRDAGDTVAEVEKILKSMHWDVRLTYTKDKEALLVVKKSMWRPKE  832



>dbj|BAJ85194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HL SKIK++C L+G++VEVDRI+RPE
Sbjct  578  TLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLLSKIKKRCELLGVIVEVDRIVRPE  637

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            G+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  638  GRLIVRDDMETIREVESIVKSLHWEVRLSYSQDNEGLLFVQKTMWRP  684



>ref|XP_009411900.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411901.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score =   189 bits (479),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 80/112 (71%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPR+YDLLHADHLFSK+K++C LM ++VEVDRILRP 
Sbjct  636  TLPIIYERGLFGMYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLMPVIVEVDRILRPG  695

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            G  IVRD+  T++E+EN+ KS+H++IR+TYS  +EGLL  QK+MWRP +V+T
Sbjct  696  GNFIVRDNVGTISEIENLAKSLHWEIRLTYSKDNEGLLYAQKSMWRPTDVET  747



>ref|XP_002447385.1| hypothetical protein SORBIDRAFT_06g034130 [Sorghum bicolor]
 gb|EES11713.1| hypothetical protein SORBIDRAFT_06g034130 [Sorghum bicolor]
Length=706

 Score =   188 bits (477),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 78/111 (70%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSK+K++C L+ ++VEVDR+LRPE
Sbjct  593  TLPIIYERGLFGLYHDWCESFSTYPRTYDLLHANHLFSKVKKRCELLPVIVEVDRVLRPE  652

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            G+LIVRD+ ET++E+ENI+KS+H+++ M+YS   EGLL VQKT WRP E +
Sbjct  653  GRLIVRDNIETISEVENIVKSLHWEVHMSYSQDKEGLLFVQKTTWRPNETE  703



>ref|XP_010478312.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Camelina 
sativa]
 ref|XP_010478313.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Camelina 
sativa]
 ref|XP_010478314.1| PREDICTED: probable methyltransferase PMT24 isoform X3 [Camelina 
sativa]
Length=769

 Score =   188 bits (478),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRPE
Sbjct  652  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPE  711

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  712  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQAAIA  769



>gb|EPS72708.1| hypothetical protein M569_02045, partial [Genlisea aurea]
Length=585

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKI-KRKCNLMGLVVEVDRILRP  470
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSKI ++KCN M LV EVDRILRP
Sbjct  470  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKIIRQKCNFMALVAEVDRILRP  529

Query  469  EGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAY  302
            +G +IVRD  ET+ +LE++ KSM + IRMTYS   EGL+C QKT WRP+E +T+ Y
Sbjct  530  DGTIIVRDTAETINQLESVFKSMQWIIRMTYSKNKEGLICAQKTTWRPEETETVTY  585



>ref|XP_010547883.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=706

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDL+HADH+FS IK +CN + ++ EVDR+LRP+
Sbjct  589  TLPIIYERGLFGIYHDWCESFSTYPRTYDLVHADHIFSAIKNRCNFVAVLAEVDRMLRPD  648

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYA  299
            G LIVRD+ ET+ ELE +++SM++++RMTYS  +EGLLCVQKT WRP +   L YA
Sbjct  649  GNLIVRDNVETINELEALVRSMNWEVRMTYSMDEEGLLCVQKTFWRPTDSVQLPYA  704



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score =   188 bits (478),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YD++HADHLFS IK++C L+ ++VEVDRILRPE
Sbjct  717  TLPIIYERGLFGMYHDWCESFNTYPRTYDVVHADHLFSSIKKRCKLVAVIVEVDRILRPE  776

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV+KT WRP E + +   I
Sbjct  777  GKLIVRDNLETISEVESMAKSLQWEIRMIYSKDNEGLLCVRKTFWRPTEEEPIKSGI  833



>gb|KHN44285.1| Putative methyltransferase PMT25 [Glycine soja]
Length=797

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN++ ++ EVDRILRPE
Sbjct  680  TLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCNILAVIAEVDRILRPE  739

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L++RD+ ET+ E+E++ KS+H+DIR+TYS   EG LC+QKT WRP +V+T+A AIA
Sbjct  740  GYLVIRDNVETIGEIESMAKSLHWDIRLTYSKNGEGFLCIQKTFWRPTKVETVASAIA  797



>ref|XP_008338454.1| PREDICTED: probable methyltransferase PMT24 [Malus domestica]
Length=432

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+  + EVDRILRPE
Sbjct  315  TLPIIYERGLIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLVAAIAEVDRILRPE  374

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIV D+ ETL E+E++ KS+ ++IR TYS  +EGLLC+QKT WRP E + +  AIA
Sbjct  375  GKLIVWDNAETLNEIESLAKSLQWNIRFTYSKDNEGLLCIQKTFWRPAEKEKILSAIA  432



>emb|CBI18946.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGLFG+YHDWCESFSTYPRSYDL+HADHLFS +K++C L  ++ EVDRILRPE
Sbjct  437  TLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHLFSDLKKRCQLTAVIAEVDRILRPE  496

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD+ ET++E+E++ KS+ +++R+TYS   EGLLCV+KT WRP E QT+  AIA
Sbjct  497  GMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEGLLCVKKTFWRPTETQTIKSAIA  554



>ref|XP_003527960.1| PREDICTED: probable methyltransferase PMT26-like [Glycine max]
Length=835

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD +FS +K KCN + ++ EVDRILRPE
Sbjct  718  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSIFSTLKEKCNKVAVIAEVDRILRPE  777

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L++RD+ ET+ E+E++ KS+ +DIR+TYS   EGLLC+QKT WRP +V+T+A AIA
Sbjct  778  GYLVIRDNVETIGEIESLAKSLQWDIRLTYSKNGEGLLCIQKTFWRPTKVETVASAIA  835



>ref|NP_001151565.1| ankyrin-like protein [Zea mays]
 gb|ACG43365.1| ankyrin-like protein [Zea mays]
 tpg|DAA36810.1| TPA: ankyrin-like protein [Zea mays]
Length=671

 Score =   186 bits (472),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDL+HA+HLFSK+K++C L+ ++VEVDR+LRP+
Sbjct  558  TLPIIYERGLFGLYHDWCESFSTYPRTYDLVHANHLFSKVKKRCELLPVIVEVDRVLRPQ  617

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            G+LIVRD+ ET +E+ENILKS+H+++RM+Y    EGLL VQKT WRP E +
Sbjct  618  GRLIVRDNIETTSEVENILKSLHWEVRMSYFQEKEGLLLVQKTTWRPNETE  668



>gb|KHN46967.1| Putative methyltransferase PMT25 [Glycine soja]
Length=689

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD +FS +K KCN + ++ EVDRILRPE
Sbjct  572  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSIFSTLKEKCNKVAVIAEVDRILRPE  631

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L++RD+ ET+ E+E++ KS+ +DIR+TYS   EGLLC+QKT WRP +V+T+A AIA
Sbjct  632  GYLVIRDNVETIGEIESLAKSLQWDIRLTYSKNGEGLLCIQKTFWRPTKVETVASAIA  689



>ref|XP_009414876.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=637

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK K++C L+ ++ EVDRILRP+
Sbjct  520  TLPVIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKTKKRCKLLPVIAEVDRILRPQ  579

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ETL E+E++ KS+++++RM YS    GLLCVQKT+WRP+EV+    +++
Sbjct  580  GKLIVRDNAETLEEVESMAKSLNWEVRMGYSKEKGGLLCVQKTLWRPEEVEATVSSLS  637



>ref|XP_007019267.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY16492.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=837

 Score =   186 bits (473),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YD+LHADHLFS  K++C L+ ++ EVDRILRPE
Sbjct  720  TLPIIYERGLFGIYHDWCESFNTYPRTYDVLHADHLFSTTKKRCKLVTVIAEVDRILRPE  779

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV+KT WRP E +T+  +I
Sbjct  780  GKLIVRDNGETISEVESLAKSLQWEIRMIYSKDNEGLLCVRKTFWRPTEEETIKSSI  836



>ref|XP_010460728.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
 ref|XP_010460729.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
Length=764

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRPE
Sbjct  647  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPE  706

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  707  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQAAIA  764



>gb|EMS56319.1| putative methyltransferase PMT26 [Triticum urartu]
Length=953

 Score =   187 bits (475),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDL+HA+HLFSKIK++C ++G++VEVDRI+RPE
Sbjct  842  TLPIIYERGLFGLYHDWCESFSTYPRSYDLVHANHLFSKIKKRCEVLGVIVEVDRIVRPE  901

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            G+LIVRD  ET+ E+E+I+KS+H+++R++YS  +EGLL VQKTMWRP
Sbjct  902  GRLIVRDDMETIREVESIVKSLHWEVRLSYSQDNEGLLFVQKTMWRP  948



>ref|XP_007199628.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
 gb|EMJ00827.1| hypothetical protein PRUPE_ppa001750mg [Prunus persica]
Length=771

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGL G+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRPE
Sbjct  654  TLPIIFERGLTGIYHDWCESFSTYPRTYDLLHADHLFSVLKKRCNLVAVIAEVDRILRPE  713

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI+ D+ ETL E+E++ KS+ +DIR TYS  +EGLLC+QKT WRP E +T+  AIA
Sbjct  714  GKLIIWDNAETLNEVESMAKSLQWDIRFTYSKDNEGLLCIQKTFWRPAEKETILSAIA  771



>ref|XP_008244575.1| PREDICTED: probable methyltransferase PMT24 [Prunus mume]
Length=815

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPII+ERGL G+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRPE
Sbjct  698  TLPIIFERGLTGIYHDWCESFSTYPRTYDLLHADHLFSVLKKRCNLVAVIAEVDRILRPE  757

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLI+ D+ ETL E+E++ KS+ +DIR TYS  +EGLLC+QKT WRP E +T+  AIA
Sbjct  758  GKLIIWDNAETLNEVESMAKSLQWDIRFTYSKDNEGLLCIQKTFWRPAERETILSAIA  815



>ref|XP_006578949.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578950.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=834

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN++ ++ EVDRILRPE
Sbjct  717  TLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCNILAVIAEVDRILRPE  776

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L++RD+ ET+ E+E++ KS+H+DI++TYS   EG LC+QKT WRP +V+T+A AIA
Sbjct  777  GYLVIRDNVETIGEIESMAKSLHWDIQLTYSKNGEGFLCIQKTFWRPTKVETVASAIA  834



>ref|XP_010112029.1| putative methyltransferase PMT24 [Morus notabilis]
 gb|EXC32448.1| putative methyltransferase PMT24 [Morus notabilis]
Length=739

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++C L G++ EVDRILRP+
Sbjct  622  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSLLKKRCELRGVIAEVDRILRPD  681

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  +T+ E+EN+ KS+ +++R+ +SN  E LLCVQKT+WRPK+ +T+  AIA
Sbjct  682  GTLIVRDGVKTVNEVENMAKSLKWNVRLVFSNNKEALLCVQKTIWRPKQTETIFSAIA  739



>gb|ACF86376.1| unknown [Zea mays]
Length=378

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDL+HA+HLFSK+K++C L+ ++VEVDR+LRP+
Sbjct  265  TLPIIYERGLFGLYHDWCESFSTYPRTYDLVHANHLFSKVKKRCELLPVIVEVDRVLRPQ  324

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            G+LIVRD+ ET +E+ENILKS+H+++RM+Y    EGLL VQKT WRP E + 
Sbjct  325  GRLIVRDNIETTSEVENILKSLHWEVRMSYFQEKEGLLLVQKTTWRPNETEA  376



>ref|XP_006578951.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=689

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCES +TYPRSYDLLHAD +FS +K KCN++ ++ EVDRILRPE
Sbjct  572  TLPIIYERGLFGIYHDWCESLNTYPRSYDLLHADSIFSTLKEKCNILAVIAEVDRILRPE  631

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L++RD+ ET+ E+E++ KS+H+DI++TYS   EG LC+QKT WRP +V+T+A AIA
Sbjct  632  GYLVIRDNVETIGEIESMAKSLHWDIQLTYSKNGEGFLCIQKTFWRPTKVETVASAIA  689



>ref|XP_004289881.1| PREDICTED: probable methyltransferase PMT24 [Fragaria vesca subsp. 
vesca]
Length=797

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL II+ERGL GMYHDWCESFSTYPR+YD++HADHLFS +K++CNL+ ++ EVDRILRPE
Sbjct  680  TLAIIFERGLIGMYHDWCESFSTYPRTYDVVHADHLFSVLKKRCNLVVVIAEVDRILRPE  739

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIV D  ETL E+E++ KS+H+DIR TYS  + GLLC+QKT WRP E +T+  AIA
Sbjct  740  GKLIVWDDAETLNEIESMAKSLHWDIRFTYSKDNMGLLCIQKTFWRPTEQETILSAIA  797



>gb|KDO36645.1| hypothetical protein CISIN_1g027471mg [Citrus sinensis]
Length=221

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS IK+  +L  +V EVDRILRP+
Sbjct  106  TLPIIYERGLFGLYHDWCESFNTYPRTYDLLHADHLFSTIKK--SLKAVVAEVDRILRPD  163

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G LI+RD  ET+ E+E+++KS+H+D+RM Y+N ++G+LCV KT WRPKE +T+  A+
Sbjct  164  GNLILRDDAETIVEVEDLVKSLHWDVRMIYTNDNQGMLCVHKTYWRPKETETILSAM  220



>ref|XP_009360657.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL G+YHDWCESFSTYPRSYDLL+ADHLFS +K++C+L+ ++ EVDRILRPE
Sbjct  688  TLPIIYERGLIGIYHDWCESFSTYPRSYDLLNADHLFSVLKKRCSLVAVIAEVDRILRPE  747

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIV D+ ETL E+E++ KS+ +DIR TYS  +EGLL VQKT WRP E +T+  AIA
Sbjct  748  GKLIVWDNAETLNEIESMAKSLQWDIRFTYSKDNEGLLYVQKTFWRPAEKETILSAIA  805



>ref|XP_010679252.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=788

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YH+WCESF+TYPR+YDLLHADHLFS +K++CN + ++ E DRILRP+
Sbjct  671  TLPIIYERGLFGIYHNWCESFNTYPRTYDLLHADHLFSDLKKRCNFVAVMAEADRILRPQ  730

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD+ ET+ E+E++ KS+ + IR ++S  +EGLLCVQKT WRP +V+T+  AIA
Sbjct  731  GSLIVRDNAETVAEVESMAKSLQWKIRFSFSKDNEGLLCVQKTRWRPSDVETITSAIA  788



>gb|KJB59346.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
 gb|KJB59347.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
Length=833

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESF+TYPR+YD++HADHLFS IK++C L+ ++ EVDRILRPE
Sbjct  717  TLPIIYERGLFGMYHDWCESFNTYPRTYDVVHADHLFSSIKKRCKLVAVIAEVDRILRPE  776

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLI+RD+ ET++E+E++ KS+ ++IRM YS  +EGLLCV KT WRP E + + +AI
Sbjct  777  GKLILRDNLETISEVESMAKSLQWEIRMIYSKDNEGLLCVHKTFWRPTE-EPIKFAI  832



>ref|XP_009109665.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
 ref|XP_009109666.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=682

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  565  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCNLVSVMAEVDRILRPQ  624

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP EV+T+  AIA
Sbjct  625  GTFIVRDDSETVGEIEKMVKSMKWNVTMTHSKGGEGLLSVQKSWWRPTEVETITSAIA  682



>emb|CDX90190.1| BnaA08g17940D [Brassica napus]
Length=687

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  570  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCNLVSVMAEVDRILRPQ  629

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KSM +++ MT+S G EGLL VQK+ WRP EV+T+  AIA
Sbjct  630  GTFIVRDDSETVGEIEKMVKSMKWNVTMTHSKGGEGLLSVQKSWWRPTEVETITSAIA  687



>ref|XP_002893569.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69828.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRP+
Sbjct  654  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPQ  713

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  714  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQSAIA  771



>ref|NP_174240.2| putative methyltransferase PMT24 [Arabidopsis thaliana]
 ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana]
 gb|AEE31093.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AEE31094.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
Length=770

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRP+
Sbjct  653  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPQ  712

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  713  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQSAIA  770



>ref|XP_008674424.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008674425.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008674426.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
Length=1040

 Score =   186 bits (473),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 76/114 (67%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLP+IYERGLFGMYHDWCESFSTYPRSYDL+HA+HLFSK+K +C L+ ++ EVDR+LRPE
Sbjct  927   TLPVIYERGLFGMYHDWCESFSTYPRSYDLVHANHLFSKLKSRCKLLPVIAEVDRVLRPE  986

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
             GKLIVRD   T+ E+++I +S+H+++RMT S   +GLLCV+KTMWRP +V+ L+
Sbjct  987   GKLIVRDDMATVKEVQSIARSLHWEVRMTVSKQGQGLLCVRKTMWRPTQVEALS  1040



>dbj|BAE99079.1| hypothetical protein [Arabidopsis thaliana]
Length=770

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRP+
Sbjct  653  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPQ  712

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  713  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQSAIA  770



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGM+HDWCESF+TYPRSYDLLHAD+LFS +K++CNLM +  EVDRILRPE
Sbjct  708  TLPIIYERGLFGMHHDWCESFNTYPRSYDLLHADNLFSSLKKRCNLMPVFAEVDRILRPE  767

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD+  T+ E+E+I KS+ +D+R T S  +EGLL VQKT WRP +V+T+  AIA
Sbjct  768  GILIVRDNAATIAEIESIAKSLQWDVRFTDSKDNEGLLSVQKTFWRPLDVETITSAIA  825



>tpg|DAA55524.1| TPA: hypothetical protein ZEAMMB73_749730 [Zea mays]
Length=1062

 Score =   186 bits (473),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 76/114 (67%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLP+IYERGLFGMYHDWCESFSTYPRSYDL+HA+HLFSK+K +C L+ ++ EVDR+LRPE
Sbjct  949   TLPVIYERGLFGMYHDWCESFSTYPRSYDLVHANHLFSKLKSRCKLLPVIAEVDRVLRPE  1008

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
             GKLIVRD   T+ E+++I +S+H+++RMT S   +GLLCV+KTMWRP +V+ L+
Sbjct  1009  GKLIVRDDMATVKEVQSIARSLHWEVRMTVSKQGQGLLCVRKTMWRPTQVEALS  1062



>gb|AAG51752.1|AC068667_31 unknown protein; 55790-52851 [Arabidopsis thaliana]
Length=768

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+G++ EVDRILRP+
Sbjct  651  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPQ  710

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  711  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQSAIA  768



>ref|XP_007137499.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
 gb|ESW09493.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
Length=833

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPRSYDLLHAD + S +++KCN+M ++ EVDRILRPE
Sbjct  716  TLPIIYERGLFGIYHDWCESFNTYPRSYDLLHADSILSTLRKKCNIMAVIAEVDRILRPE  775

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G L+VRD+ ET+ E+E++ KS+H++IR+TY    EGL+C+QKT WRP +V+T+A AIA
Sbjct  776  GYLVVRDNAETVGEIESMAKSLHWEIRLTYIKSGEGLICIQKTFWRPTKVETVASAIA  833



>ref|XP_002442915.1| hypothetical protein SORBIDRAFT_08g004870 [Sorghum bicolor]
 gb|EES16753.1| hypothetical protein SORBIDRAFT_08g004870 [Sorghum bicolor]
Length=1067

 Score =   186 bits (472),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 76/111 (68%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFGMYHDWCESFSTYPR+YDL+HADHLFSK+K +C L+ ++ EVDR+LRPE
Sbjct  956   TLPIIYERGLFGMYHDWCESFSTYPRTYDLVHADHLFSKLKSRCKLLPVIAEVDRMLRPE  1015

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
             GKLIVRD   T+ E++++++S+H+++RMT S   +GLLCV+KTMWRP EV+
Sbjct  1016  GKLIVRDDKATVEEVQSMVRSLHWEVRMTVSKQGQGLLCVRKTMWRPTEVE  1066



>ref|XP_009779710.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=766

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERG FG+YHDWCESFSTYPRSYDLLHADHLFS IK++C ++ +  EVDRILRPE
Sbjct  649  TLPIIYERGFFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCKIVPVFAEVDRILRPE  708

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ E+EN+ +S  + ++M+YS   EGLL VQK+ WRPK+ Q +  AIA
Sbjct  709  GKLIVRDNAETILEIENMARSAKWKVKMSYSKDGEGLLFVQKSFWRPKQEQIIKSAIA  766



>ref|XP_009602526.1| PREDICTED: probable methyltransferase PMT24 [Nicotiana tomentosiformis]
 ref|XP_009602527.1| PREDICTED: probable methyltransferase PMT24 [Nicotiana tomentosiformis]
Length=767

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERG FG+YHDWCESFSTYPRSYDLLHADHLFS IK++C ++ +  EVDRILRPE
Sbjct  650  TLPIIYERGFFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCKIVPVFAEVDRILRPE  709

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ E+EN+ +S  + ++M+YS   EGLL VQK+ WRPK+ Q +  AIA
Sbjct  710  GKLIVRDNAETILEIENMARSAKWKVKMSYSKDGEGLLFVQKSFWRPKQEQIIKSAIA  767



>ref|XP_010533385.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=783

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHAD LFS +K++CNL+ ++ EVDRILRP+
Sbjct  666  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADRLFSALKKRCNLIPVMAEVDRILRPQ  725

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            G  IVRD  ET+ E+E I+KSM +++RM YS  DEGL+ VQK+ WRPKE +T+  AI
Sbjct  726  GTFIVRDDVETINEIERIVKSMKWEVRMMYSKDDEGLISVQKSFWRPKEAETIDSAI  782



>ref|XP_009366818.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
 ref|XP_009366819.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score =   184 bits (466),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERG  G+YHDWCESFSTYPRSYDLLHADHLFS +K++C+L+  + EVDRILRPE
Sbjct  688  TLPIIYERGFIGIYHDWCESFSTYPRSYDLLHADHLFSVLKKRCSLVAAIAEVDRILRPE  747

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIV D+ ETL E+E++ KS+ ++IR TYS  +EGLLC+QKT WRP + + +  AIA
Sbjct  748  GKLIVWDNAETLNEIESLAKSLQWNIRFTYSKDNEGLLCIQKTFWRPADKEKILSAIA  805



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  634  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSVMAEVDRILRPQ  693

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP EV+T+  AIA
Sbjct  694  GTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTEVETITSAIA  751



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL  ++ EVDRILRP+
Sbjct  628  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLASVMAEVDRILRPQ  687

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP EV+T+  AIA
Sbjct  688  GTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTEVETITSAIA  745



>ref|XP_003576215.1| PREDICTED: probable methyltransferase PMT24 [Brachypodium distachyon]
Length=870

 Score =   184 bits (466),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+I+ERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VE DRILRP 
Sbjct  757  TLPVIFERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKTRCKVLPVIVEADRILRPN  816

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ E+  +++SMH+++RMT SN  E +LC +KTMWRP EV+
Sbjct  817  GKLIVRDDKETVNEIVELVRSMHWEVRMTVSNRKEAMLCARKTMWRPTEVE  867



>ref|XP_009115236.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Brassica 
rapa]
Length=753

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  634  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSVMAEVDRILRPQ  693

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP EV+T+  AIA
Sbjct  694  GTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTEVETITSAIA  751



>ref|XP_009115237.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Brassica 
rapa]
Length=725

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++CNL+ ++ EVDRILRP+
Sbjct  606  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVSVMAEVDRILRPQ  665

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD +ET+ E+E ++KS+ +D+RMT S   EG+L VQK+ WRP EV+T+  AIA
Sbjct  666  GTFIVRDDSETIGEIEKMVKSLKWDVRMTQSKDGEGVLAVQKSWWRPTEVETITSAIA  723



>ref|XP_009102852.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=750

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+  + EVDRILRP+
Sbjct  633  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLVSAMAEVDRILRPQ  692

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP EV+T+ +AIA
Sbjct  693  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRPSEVETVTWAIA  750



>emb|CDY44314.1| BnaA07g07980D [Brassica napus]
Length=744

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+  + EVDRILRP+
Sbjct  627  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLVSAMAEVDRILRPQ  686

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP EV+T+ +AIA
Sbjct  687  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRPSEVETVTWAIA  744



>emb|CDX94669.1| BnaC07g09890D [Brassica napus]
Length=749

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+  + EVDRILRP+
Sbjct  632  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLVSAMTEVDRILRPQ  691

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EG+L VQK++WRP EV+T+ +AIA
Sbjct  692  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGVLSVQKSLWRPTEVETVTWAIA  749



>ref|XP_010679237.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=791

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++CN + ++ EVDRILRPE
Sbjct  674  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSDLKKRCNFVAVMAEVDRILRPE  733

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  ET+ ++E++  S+ + I+ ++S  +EGLLCVQK+ WRP +++T++ AIA
Sbjct  734  GSLIVRDDAETIAKVESMTNSLQWKIKFSFSKNNEGLLCVQKSRWRPSDIETISSAIA  791



>ref|XP_010679222.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010679229.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=802

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS +K++CN + ++ EVDRILRPE
Sbjct  685  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSDLKKRCNFVAVMAEVDRILRPE  744

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  ET+ ++E++  S+ + I+ ++S  +EGLLCVQK+ WRP +++T++ AIA
Sbjct  745  GSLIVRDDAETIAKVESMTNSLQWKIKFSFSKNNEGLLCVQKSRWRPSDIETISSAIA  802



>ref|XP_006653085.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=666

 Score =   181 bits (458),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/113 (69%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCNLMGLVVEVDRILR  473
            TLPIIYERGLFG+YHDWCESFSTYPR+YD LHA+HLFSKIK+  +C L+ ++VEVDRI+R
Sbjct  551  TLPIIYERGLFGVYHDWCESFSTYPRTYDFLHANHLFSKIKKSDRCKLVAVMVEVDRIVR  610

Query  472  PEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            PEG LIVRD  ET+ E+E+++KS+H+++R++YS  +EGLL VQKTMWRP EV+
Sbjct  611  PEGMLIVRDSLETIREVESMVKSLHWEVRVSYSQDNEGLLLVQKTMWRPNEVE  663



>gb|AAX96340.1| Putative methyltransferase [Oryza sativa Japonica Group]
 gb|AAY23281.1| Putative methyltransferase [Oryza sativa Japonica Group]
Length=197

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  85   TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVLPVIVEVDRILRPN  144

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP E + 
Sbjct  145  GKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRPTEAEA  196



>gb|KEH35375.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=755

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS +K +CN++ ++ EVDR+LRPE
Sbjct  638  TLPLIYERGLFGIYHDWCESFSTYPRSYDLLHADFLFSALKERCNIVAVIAEVDRMLRPE  697

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LI+RD+ E + E+EN+ KS+H+DIR +Y+   EGLLC+QKT WRP +V+T+  A A
Sbjct  698  GYLIIRDNEEIIGEIENMAKSLHWDIRSSYAKNGEGLLCLQKTFWRPTKVETVVSAFA  755



>ref|XP_004502550.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=782

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL +IYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS +K +CN++ ++ EVDR+LRPE
Sbjct  665  TLAVIYERGLFGIYHDWCESFSTYPRSYDLLHADSLFSTLKERCNIVAVIAEVDRMLRPE  724

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LI+RD+ ET+ E+EN+ KS+H+D+R  Y+   EGLLC+QKT+WRP +V+T+  AIA
Sbjct  725  GYLIIRDNVETIDEIENMAKSLHWDVRFRYAKLGEGLLCLQKTLWRPTKVETVVSAIA  782



>ref|XP_010906388.1| PREDICTED: probable methyltransferase PMT24 [Elaeis guineensis]
Length=955

 Score =   181 bits (460),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 74/110 (67%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS+IK++C +M ++ EVDRILRP 
Sbjct  842  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRIKKRCKIMTVIAEVDRILRPG  901

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  317
            GKLIVRD +  ++E+EN+LKS+H+++R+T+S   EG+LC +K+ WRP+ +
Sbjct  902  GKLIVRDESSVVSEVENLLKSLHWEVRLTFSKNKEGILCSEKSDWRPENL  951



>dbj|BAK08087.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=892

 Score =   181 bits (458),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 76/111 (68%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  776  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCKVLPVLVEVDRILRPN  835

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ E+   +KSMH+++RMT S   E +LC +KTMWRP E++
Sbjct  836  GKLIVRDDKETVDEIVEGVKSMHWEVRMTVSKRKEAMLCARKTMWRPTEME  886



>ref|XP_006415572.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
 gb|ESQ33925.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
Length=761

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS +K++C+L+ ++ EVDRILRP+
Sbjct  644  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSALKKRCSLVSVMAEVDRILRPQ  703

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  IVRD  ET+ E+E ++KSM +++RMT+S   EGLL VQK+ WRP E +T+  AIA
Sbjct  704  GTFIVRDDMETIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIKSAIA  761



>ref|XP_006295874.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
 gb|EOA28772.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
Length=777

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ ++ E+DRILRP+
Sbjct  660  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSVMAEIDRILRPQ  719

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM ++++MT S  +EGLL +QK+ WRP E +T+  AIA
Sbjct  720  GTFIIRDDMETIGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRPAETETIKSAIA  777



>ref|XP_006828886.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
 gb|ERM96302.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
Length=918

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++ ++CNL+G++ EVDRILRP 
Sbjct  805  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLDKRCNLVGVMTEVDRILRPG  864

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  323
            G +IVRD + T++E+EN+ KS+H+++ +T+S   EG+LC +KTMWRP+
Sbjct  865  GTIIVRDESATVSEVENLAKSLHWEVSLTFSKDKEGMLCAKKTMWRPE  912



>dbj|BAE99717.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20160.1| AT2G34300 [Arabidopsis thaliana]
Length=770

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ ++ E+DRILRP+
Sbjct  653  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSVMAEIDRILRPQ  712

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL ++K+ WRP+E +T+  AIA
Sbjct  713  GTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIEKSWWRPEETETIKSAIA  770



>ref|NP_180977.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 ref|NP_001031477.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 sp|Q0WT31.2|PMTP_ARATH RecName: Full=Probable methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AAC27406.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08950.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AEC08951.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
Length=770

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ ++ E+DRILRP+
Sbjct  653  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSVMAEIDRILRPQ  712

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL ++K+ WRP+E +T+  AIA
Sbjct  713  GTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIEKSWWRPEETETIKSAIA  770



>ref|XP_010063908.1| PREDICTED: probable methyltransferase PMT25 [Eucalyptus grandis]
 ref|XP_010063909.1| PREDICTED: probable methyltransferase PMT25 [Eucalyptus grandis]
 gb|KCW71195.1| hypothetical protein EUGRSUZ_F04286 [Eucalyptus grandis]
 gb|KCW71196.1| hypothetical protein EUGRSUZ_F04286 [Eucalyptus grandis]
Length=810

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL G+YHDWCESF+TYPRSYDLLHAD+LF+ +K++C L+ ++ EVDRILRPE
Sbjct  693  TLPIIYERGLIGIYHDWCESFNTYPRSYDLLHADNLFATLKKRCKLVPVLAEVDRILRPE  752

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G LIVRD  E ++E+E++ KS+ +++R T+S  + GLLCVQKT WRP  V+T+A AIA
Sbjct  753  GILIVRDDMEIISEIESMAKSLQWEVRFTHSEDNTGLLCVQKTFWRPVNVETIASAIA  810



>ref|XP_002449126.1| hypothetical protein SORBIDRAFT_05g005510 [Sorghum bicolor]
 gb|EES08114.1| hypothetical protein SORBIDRAFT_05g005510 [Sorghum bicolor]
Length=894

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  782  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVLPVIVEVDRILRPN  841

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP E+++
Sbjct  842  GKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKEAMLCARKTTWRPTEIES  893



>gb|EEE61974.1| hypothetical protein OsJ_16751 [Oryza sativa Japonica Group]
Length=677

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/113 (69%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCNLMGLVVEVDRILR  473
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C L+ ++VEVDRILR
Sbjct  562  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCKLVAVMVEVDRILR  621

Query  472  PEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            P G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMWRP EV+
Sbjct  622  PGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMWRPNEVE  674



>ref|XP_008669787.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
 ref|XP_008669788.1| PREDICTED: probable methyltransferase PMT26 [Zea mays]
Length=906

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  794  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVLPVIVEVDRILRPN  853

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD  ET+ E++ +++S+ +++RMT S   + +LC +KT WRP E++T
Sbjct  854  GKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKQAMLCARKTTWRPTEIET  905



>gb|EEC78319.1| hypothetical protein OsI_18053 [Oryza sativa Indica Group]
Length=672

 Score =   178 bits (451),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/113 (69%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCNLMGLVVEVDRILR  473
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C L+ ++VEVDRILR
Sbjct  557  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCKLVAVMVEVDRILR  616

Query  472  PEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            P G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMWRP EV+
Sbjct  617  PGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMWRPNEVE  669



>tpg|DAA38926.1| TPA: hypothetical protein ZEAMMB73_582749 [Zea mays]
Length=939

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  827  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVLPVIVEVDRILRPN  886

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD  ET+ E++ +++S+ +++RMT S   + +LC +KT WRP E++T
Sbjct  887  GKLIVRDDKETVDEIQGVVRSLQWEVRMTVSKNKQAMLCARKTTWRPTEIET  938



>ref|XP_004237701.1| PREDICTED: probable methyltransferase PMT24 [Solanum lycopersicum]
Length=768

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIY+RGLFG+YHDWCESFSTYPRSYDLLHADHLFS IK++C +  +  EVDRILRPE
Sbjct  651  TLPIIYDRGLFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCTIESVFAEVDRILRPE  710

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ E+EN+ +S+ + ++M+YS   EGLL VQK+ WRP + Q +  AIA
Sbjct  711  GKLIVRDNAETILEIENMARSVKWKVKMSYSKNGEGLLFVQKSFWRPNQEQIVKSAIA  768



>ref|XP_010509773.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=771

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL+ ++ EVDRILRP+
Sbjct  654  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSVMAEVDRILRPQ  713

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM +++++T S  +EGLL +QK+ WRP E +T+  AIA
Sbjct  714  GTFIIRDDMETIGEVEKMVKSMKWNVKVTQSKDNEGLLSIQKSWWRPAETETIKSAIA  771



>gb|EMT24893.1| hypothetical protein F775_19481 [Aegilops tauschii]
Length=1022

 Score =   179 bits (455),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGL GMYHDWCES STYPRSYDL+HADHLFSK+K +C +  ++ EVDRILRPE
Sbjct  909   TLPIIYERGLLGMYHDWCESLSTYPRSYDLVHADHLFSKLKYRCKVRLVMAEVDRILRPE  968

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
             GK+IVRD  ET  E+E I KS+H+++RM  SN  E LLC  KTMWRP +VQ L 
Sbjct  969   GKMIVRDDRETAEEVERIAKSLHWEVRMAVSNQGERLLCFHKTMWRPTQVQPLG  1022



>ref|XP_004978888.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=839

 Score =   178 bits (452),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 73/112 (65%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ +VVEVDRILRP 
Sbjct  727  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKPRCKVLPVVVEVDRILRPN  786

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GK IVRD  ET+ E+++ ++S+ +++RMT S   E +LC +KT WRP EV++
Sbjct  787  GKFIVRDDKETVDEIQSAVRSLQWEVRMTVSKNKEAMLCARKTTWRPTEVES  838



>ref|XP_003580900.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=716

 Score =   177 bits (449),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TL IIYERGLFG+YHDWCESFSTYPRSYDL+HADH+FSK+K++C L+ ++VEVDR+ RPE
Sbjct  606  TLAIIYERGLFGLYHDWCESFSTYPRSYDLVHADHIFSKVKKRCGLLSVIVEVDRMARPE  665

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            G+LIVRD  ET+ E+ +I +S+H+++R++YS   EGLL VQKTMWRP
Sbjct  666  GRLIVRDDMETINEVRSIAESLHWEVRLSYSQEKEGLLFVQKTMWRP  712



>ref|XP_006365916.1| PREDICTED: probable methyltransferase PMT24-like [Solanum tuberosum]
Length=768

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIY+RGLFG+YHDWCESFSTYPRSYDLLHADHLFS IK++C +  +  EVDRILRPE
Sbjct  651  TLPIIYDRGLFGIYHDWCESFSTYPRSYDLLHADHLFSDIKKRCTIESVFAEVDRILRPE  710

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            GKLIVRD+ ET+ E+EN+ +S+ + ++M+YS   EGLL VQK+ WRP + Q +  AIA
Sbjct  711  GKLIVRDNAETILEIENMARSVKWKVKMSYSKDGEGLLFVQKSFWRPNQEQIVKSAIA  768



>ref|XP_010469377.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C+L+ ++ E+DRILRP+
Sbjct  662  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCSLVSVMAEIDRILRPQ  721

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ETL E+E ++KSM + ++MT S  +EGLL +QK+ WRP E +T+  AIA
Sbjct  722  GTFIIRDDMETLGEVEKMVKSMKWKVKMTQSKDNEGLLSIQKSWWRPAETETIKSAIA  779



>gb|EEE51778.1| hypothetical protein OsJ_33227 [Oryza sativa Japonica Group]
Length=867

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  755  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVLPVIVEVDRILRPN  814

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP E +
Sbjct  815  GKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRPTEAE  865



>ref|NP_001065922.2| Os11g0186300 [Oryza sativa Japonica Group]
 gb|ABG22395.1| dehydration-responsive protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27767.2| Os11g0186300 [Oryza sativa Japonica Group]
Length=867

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  755  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCEVLPVIVEVDRILRPN  814

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP E +
Sbjct  815  GKLIVRDDKETVDEIKGVVRSLQWEVRMTVSKNREAMLCARKTTWRPTEAE  865



>gb|AAP72961.1| putative ankyrin-like protein [Lactuca sativa]
Length=721

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 72/104 (69%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YH+WCESFSTYPRSYDLLHADHLFS +K++C L  ++ EVDRILRPE
Sbjct  614  TLPIIYERGLFGIYHNWCESFSTYPRSYDLLHADHLFSDLKKRCKLASVIAEVDRILRPE  673

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTM  335
            GKLIVRD+ ET+ E+EN+ KS+H+++R++Y+  +EGLLCV+K +
Sbjct  674  GKLIVRDNVETIAEVENMAKSLHWNVRLSYNKDNEGLLCVEKNI  717



>ref|XP_009115787.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=898

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+ ++ EVDRI+RP 
Sbjct  785  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLVPVMAEVDRIVRPG  844

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GKLIVRD    + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   QT
Sbjct  845  GKLIVRDEANVIREIENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPDTSQT  896



>gb|EMS61672.1| putative methyltransferase PMT26 [Triticum urartu]
Length=965

 Score =   178 bits (451),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGL GMYHDWCES STYPRSYDL+HADHLFSK+K +C +  ++ EVDRILRPE
Sbjct  852  TLPIIYERGLLGMYHDWCESLSTYPRSYDLVHADHLFSKLKYRCKVRLVMAEVDRILRPE  911

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTL  308
            GK+IVRD  +T  E+E I KS+H+++RM  SN  E LLC  KTMWRP +VQ L
Sbjct  912  GKMIVRDDRDTAEEVERIAKSLHWEVRMAVSNQGERLLCFHKTMWRPTQVQPL  964



>ref|XP_006662791.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=871

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 72/111 (65%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +C ++ ++VEVDRILRP 
Sbjct  759  TLPVIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKSRCKVLPVIVEVDRILRPN  818

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD  ET+ E++ +++S+ +++RMT S   E +LC +KT WRP +V+
Sbjct  819  GKLIVRDDKETVDEVQGVVRSLQWEVRMTVSKNREAMLCARKTTWRPTDVE  869



>ref|XP_002881329.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57588.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TY R+YDLLHADHLFS ++++CNL+ ++ E+DRILRP+
Sbjct  656  TLPIIYERGLFGIYHDWCESFNTYLRTYDLLHADHLFSTLRKRCNLVSVMAEIDRILRPQ  715

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ETL E+E ++KSM ++++MT S  +EGLL +QK+ WRP E +T+  AIA
Sbjct  716  GTFIIRDDMETLGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRPAETETIKSAIA  773



>ref|XP_010426649.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=914

 Score =   177 bits (448),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+ ++ EVDRI+RP 
Sbjct  804  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLVPVMAEVDRIVRPG  863

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   Q
Sbjct  864  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPNTSQ  914



>ref|XP_010679267.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679271.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679275.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=669

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLF  +K++CN + ++ EVDRILRP 
Sbjct  554  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFFDLKKRCNFVSVMAEVDRILRPG  613

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G+LIVRD  ET++E+ +I KS+H+ I  T++N  EGLLC+ KT+WRP E++T+  AIA
Sbjct  614  GRLIVRDDAETISEIGSIAKSLHWKI--THNNDKEGLLCIMKTLWRPSEIETIVGAIA  669



>ref|XP_010413759.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C+L+ ++ E+DRILRP+
Sbjct  662  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCSLVSVMAEIDRILRPQ  721

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM ++++MT S  +EGLL +QK+ WRP E +T+  AI 
Sbjct  722  GTFIIRDDMETIGEVEKMVKSMKWNVKMTQSKDNEGLLSIQKSWWRPAETETIKSAIG  779



>ref|XP_010515490.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=912

 Score =   177 bits (448),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+ ++ EVDRI+RP 
Sbjct  802  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLVPVMAEVDRIVRPG  861

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   Q
Sbjct  862  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPNTSQ  912



>ref|XP_010503787.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=913

 Score =   177 bits (448),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL+ ++ EVDRI+RP 
Sbjct  803  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLVPVMAEVDRIVRPG  862

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   Q
Sbjct  863  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPNTSQ  913



>ref|XP_006403957.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
 gb|ESQ45410.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
Length=914

 Score =   176 bits (447),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K +CNL  ++ EVDRI+RP 
Sbjct  804  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKARCNLAPVMAEVDRIVRPG  863

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   Q
Sbjct  864  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPDTSQ  914



>ref|XP_006290554.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
 gb|EOA23452.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
Length=967

 Score =   177 bits (448),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++++CNL+ ++ EVDRI+RP 
Sbjct  857  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRKRCNLVPVMAEVDRIVRPG  916

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP   Q
Sbjct  917  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPDTSQ  967



>ref|NP_001054368.1| Os04g0692400 [Oryza sativa Japonica Group]
 dbj|BAF16282.1| Os04g0692400 [Oryza sativa Japonica Group]
Length=677

 Score =   174 bits (442),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKR--KCNLMGLVVEVDRILR  473
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHA+HLFSKIK+  +C L+ ++VEVDRILR
Sbjct  562  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHANHLFSKIKKSDRCKLVAVMVEVDRILR  621

Query  472  PEGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
              G+LIVRD  ET+ E+E++ KS+H+++R +YS  +EGLL V+KTMWRP EV+
Sbjct  622  KGGRLIVRDSMETMHEVESMAKSLHWEVRKSYSQDNEGLLFVEKTMWRPNEVE  674



>ref|NP_190676.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
 sp|Q9SD39.1|PMTR_ARATH RecName: Full=Probable methyltransferase PMT27 [Arabidopsis thaliana]
 emb|CAB62629.1| putative protein [Arabidopsis thaliana]
 gb|AEE78746.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
Length=895

 Score =   176 bits (446),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++ +CNL+ ++ EVDRI+RP 
Sbjct  785  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRTRCNLVPVMAEVDRIVRPG  844

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD +  + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP+  Q
Sbjct  845  GKLIVRDESNVIREVENMLKSLHWDVHLTFSKHQEGILSAQKGFWRPETSQ  895



>gb|KJB29128.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
 gb|KJB29132.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=821

 Score =   175 bits (443),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+ ++ EVDRILRPE
Sbjct  704  TLPVIYERGLFGIHHDWCESFNTYPRTYDVLHADHLFSSIQNRCKLVAVIAEVDRILRPE  763

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP   + +  AI
Sbjct  764  GKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRPTVEEPIKSAI  820



>gb|KJB29130.1| hypothetical protein B456_005G086100 [Gossypium raimondii]
Length=858

 Score =   175 bits (443),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+ ++ EVDRILRPE
Sbjct  741  TLPVIYERGLFGIHHDWCESFNTYPRTYDVLHADHLFSSIQNRCKLVAVIAEVDRILRPE  800

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP   + +  AI
Sbjct  801  GKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRPTVEEPIKSAI  857



>gb|KHG21530.1| hypothetical protein F383_05601 [Gossypium arboreum]
Length=810

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG++HDWCESF+TYPR+YD+LHADHLFS I+ +C L+ ++ EVDRILRPE
Sbjct  693  TLPVIYERGLFGIHHDWCESFNTYPRAYDVLHADHLFSSIQNRCKLVTVIAEVDRILRPE  752

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAI  296
            GKLIVRD  ET++ +E++ KS+ ++IRM YS   EGLLCV+K  WRP   + +  AI
Sbjct  753  GKLIVRDKAETISAVESMAKSLQWEIRMIYSKDGEGLLCVRKKFWRPTVEEPIKAAI  809



>ref|XP_009149307.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=902

 Score =   175 bits (443),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK++ +CNL+ ++ EVDRI+RP 
Sbjct  792  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLRPRCNLVPVMAEVDRIVRPG  851

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD    + E+EN+LKS+H+D+ +T+S   EG+L  QK  WRP
Sbjct  852  GKLIVRDEANVIREIENMLKSLHWDVHLTFSKHQEGILSAQKGFWRP  898



>ref|XP_010271514.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=983

 Score =   175 bits (443),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L  ++ E+DRI++P 
Sbjct  870  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLAPVIAEIDRIVKPG  929

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLI+RD + T+ E+ENILKS+H++I +T+S   EG+L  QK+ WRP
Sbjct  930  GKLIIRDDSTTMREIENILKSLHWEIHLTFSKNKEGILSAQKSDWRP  976



>ref|XP_006383147.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|ERP60944.1| dehydration-responsive family protein [Populus trichocarpa]
Length=949

 Score =   174 bits (440),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 73/114 (64%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFS+YPR+YDLLHADHLFSK+K++C L  L+ EVDRI+RP 
Sbjct  836  TLPIIYERGLFGIYHDWCESFSSYPRTYDLLHADHLFSKLKKRCQLAPLLAEVDRIVRPG  895

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD +  + E+EN+LKS+H+++ +T+S   EGLL  QK  WRP+    L+
Sbjct  896  GKLIVRDESSAIGEVENLLKSLHWEVHLTFSKDQEGLLSAQKGDWRPQTYAALS  949



>ref|XP_011028617.1| PREDICTED: probable methyltransferase PMT27 [Populus euphratica]
Length=948

 Score =   173 bits (439),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 73/114 (64%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFS+YPR+YDLLHADHLFSK+K++C L  L+ EVDRI+RP 
Sbjct  835  TLPIIYERGLFGIYHDWCESFSSYPRTYDLLHADHLFSKLKKRCQLAPLLAEVDRIVRPG  894

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLA  305
            GKLIVRD +  + E+EN+LKS+H+++ +T+S   EGLL  QK  WRP+    L+
Sbjct  895  GKLIVRDESSAIGEVENLLKSLHWEVHLTFSKDQEGLLSAQKGDWRPQTYAALS  948



>ref|XP_006410572.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 ref|XP_006410573.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52025.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52026.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
Length=771

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++CNL  ++ E+DRILRPE
Sbjct  654  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLESVMAEIDRILRPE  713

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  E++ E+E ++KSM + ++ T S  +EGLL +QK+ WRP E +T+  AIA
Sbjct  714  GTFIIRDDMESIGEVEKMVKSMKWKVKFTLSKDNEGLLSIQKSWWRPTETETIKSAIA  771



>gb|KDP32665.1| hypothetical protein JCGZ_13663 [Jatropha curcas]
Length=855

 Score =   172 bits (437),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  741  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLASVMAEVDRIVRPG  800

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  323
            GKLIVRD +  + E+EN+LKS+ +++ +TYS   EGLL  QK  WRP+
Sbjct  801  GKLIVRDESSAIGEVENLLKSLKWEVYLTYSKDQEGLLSAQKGEWRPQ  848



>gb|KHG06183.1| hypothetical protein F383_31802 [Gossypium arboreum]
Length=1220

 Score =   174 bits (441),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 73/111 (66%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK++++C L  ++ EVDRI+RP 
Sbjct  1107  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLEKRCKLQPVLAEVDRIVRPG  1166

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
             GKLIVRD ++ + E+EN+LKS+H+++++T+S   EG+L  QK  WRP   Q
Sbjct  1167  GKLIVRDESDAIGEVENLLKSLHWEVQLTFSKDQEGILSAQKGDWRPTAYQ  1217



>ref|XP_004171289.1| PREDICTED: probable methyltransferase PMT27-like, partial [Cucumis 
sativus]
Length=296

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  183  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQPVLAEVDRIVRPG  242

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  243  GKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  289



>ref|XP_010679826.1| PREDICTED: probable methyltransferase PMT27 [Beta vulgaris subsp. 
vulgaris]
Length=953

 Score =   173 bits (438),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K +C LM ++ E+DRI+RP 
Sbjct  846  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKERCKLMPVMAEIDRIVRPG  905

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+H+++ +T+S   EG+L   K+ WRP
Sbjct  906  GKLIVRDESSTIGEVENLLKSLHWEVHLTFSKDQEGILSATKSDWRP  952



>ref|XP_009398710.1| PREDICTED: probable methyltransferase PMT27 [Musa acuminata subsp. 
malaccensis]
Length=1006

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 71/110 (65%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHAD LFS+IK++C ++ L+ EVDRI+RP 
Sbjct  893   TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADRLFSQIKQRCKILPLIAEVDRIVRPG  952

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEV  317
             GK+IVRD + T +E+E++LKS+H+ +R+T+S   EG+LC +K+ WRP+++
Sbjct  953   GKIIVRDDSVTTSEVESLLKSLHWVVRLTFSKDQEGILCAEKSEWRPEKL  1002



>ref|XP_008337883.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=968

 Score =   172 bits (437),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  853  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLAPVLAEVDRIVRPG  912

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  913  GKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  959



>emb|CDY17234.1| BnaA05g09540D [Brassica napus]
Length=762

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L  ++ EVDRILRPE
Sbjct  645  TLPVIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLESVMAEVDRILRPE  704

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP + +T+  AIA
Sbjct  705  GTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRPTQTETIESAIA  762



>ref|XP_009143789.1| PREDICTED: probable methyltransferase PMT25 [Brassica rapa]
Length=762

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L  ++ EVDRILRPE
Sbjct  645  TLPVIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLESVMAEVDRILRPE  704

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP + +T+  AIA
Sbjct  705  GTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRPTQTETIESAIA  762



>ref|XP_010239480.1| PREDICTED: probable methyltransferase PMT25 [Brachypodium distachyon]
Length=859

 Score =   171 bits (434),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCES STYPRSYDL+HADHLFS +K +C L  ++ EVDRILRPE
Sbjct  748  TLPIIYERGLFGMYHDWCESLSTYPRSYDLVHADHLFSSLKDRCKLRPVMAEVDRILRPE  807

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQT  311
            GK+IVR+  ET  E+E I K++H+ + M  S   E LLC +KTMWRP EV++
Sbjct  808  GKVIVREDRETAEEVERIAKTLHWKVGMAVSKEGERLLCFEKTMWRPTEVES  859



>ref|XP_008811930.1| PREDICTED: probable methyltransferase PMT24 [Phoenix dactylifera]
Length=955

 Score =   172 bits (436),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS+I ++C +M ++ EVDRILRP 
Sbjct  849  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSQINKRCEIMPVIAEVDRILRPG  908

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD +  ++++EN+LKS+H+++R+T+S   EG+L  +K  WRP
Sbjct  909  GKLIVRDESAVVSKVENLLKSLHWEVRLTFSKNKEGILWAEKLDWRP  955



>ref|XP_006340936.1| PREDICTED: probable methyltransferase PMT27-like [Solanum tuberosum]
Length=888

 Score =   172 bits (435),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++K++C ++ ++ EVDRI+RP 
Sbjct  775  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSQLKKRCKIVAVMAEVDRIVRPG  834

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T  E+EN+LKS+H++IR T S    G+L  QKT WRP
Sbjct  835  GKLIVRDDSATTKEVENLLKSLHWEIRKTISQNQVGILSAQKTFWRP  881



>ref|XP_007046783.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX90940.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=920

 Score =   172 bits (435),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+ ++C L  ++ EVDRI+RP 
Sbjct  807  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLTKRCKLEPVMAEVDRIVRPG  866

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD ++ + E+EN+LKS+H+++ +T+S  DEG+L  QK  WRP   Q
Sbjct  867  GKLIVRDESKAIGEVENLLKSLHWEVHLTFSKDDEGILSAQKGDWRPTTYQ  917



>gb|KJB40187.1| hypothetical protein B456_007G049800 [Gossypium raimondii]
Length=942

 Score =   172 bits (435),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSK++++C L  ++ EVDRI+RP 
Sbjct  829  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKLEKRCKLQPVLAEVDRIVRPG  888

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            GKLIVRD ++ + E+EN+LKS+H+++ +T+S   EG+L  QK  WRP   Q
Sbjct  889  GKLIVRDESDAIGEVENLLKSLHWEVHLTFSKDQEGILSAQKGDWRPTAYQ  939



>ref|XP_006856007.1| hypothetical protein AMTR_s00059p00036620 [Amborella trichopoda]
 gb|ERN17474.1| hypothetical protein AMTR_s00059p00036620 [Amborella trichopoda]
Length=214

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+I+E GL  +YHDWCE FSTYPRSYDLLHADHLFS++K +C  +G++VE+DR+LRP 
Sbjct  100  TLPLIFEGGLLDIYHDWCEPFSTYPRSYDLLHADHLFSRLKNRCKPLGIIVEMDRLLRPG  159

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQ  314
            G +IVRD  E L  LE IL+S+H++IRMTY+   EG+LC QKTMWRP +  
Sbjct  160  GWVIVRDKVEILDPLEAILRSLHWEIRMTYAQEKEGILCSQKTMWRPSQTH  210



>ref|XP_009346291.1| PREDICTED: probable methyltransferase PMT27 [Pyrus x bretschneideri]
Length=962

 Score =   171 bits (434),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  847  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSKLKKRCKLAPVLGEVDRIVRPG  906

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  907  GKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  953



>ref|XP_008338020.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=965

 Score =   171 bits (434),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  850  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLAPVLAEVDRIVRPG  909

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GK IVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  910  GKFIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGNWRP  956



>ref|XP_007203224.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
 gb|EMJ04423.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
Length=977

 Score =   171 bits (434),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 70/107 (65%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFS++K++C L  ++ E+DRI+RP 
Sbjct  862  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSRLKKRCKLPPVLAEIDRIVRPG  921

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+H+++ +T S   EG+L  QK  WRP
Sbjct  922  GKLIVRDESSTIGEVENLLKSLHWEVSLTVSKNQEGMLSAQKGKWRP  968



>ref|XP_002310282.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
 gb|EEE90732.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
Length=847

 Score =   170 bits (431),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI RP 
Sbjct  734  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLAPVLAEVDRIARPG  793

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  323
            GKLIVRD +  + E+EN+LKS+H+++ + +S   EGLL  QK  WRP+
Sbjct  794  GKLIVRDESSAIEEVENLLKSLHWEVHLIFSKDQEGLLSAQKGEWRPQ  841



>emb|CBI17424.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   170 bits (430),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 69/107 (64%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C +  L+ E+DRI+RP 
Sbjct  747  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKIAPLMAEIDRIVRPG  806

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD +  + E+EN+LKS+H+++ + +S   EG+L  QK+ WRP
Sbjct  807  GKLIVRDESSAIGEVENLLKSLHWEVHLAFSKDQEGILSAQKSYWRP  853



>emb|CDX84330.1| BnaC04g10920D [Brassica napus]
Length=713

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESF+TYPR+YDLLHADHLFS ++++C L  ++ EVDRILRPE
Sbjct  596  TLPIIYERGLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCKLESVMAEVDRILRPE  655

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPKEVQTLAYAIA  293
            G  I+RD  ET+ E+E ++KSM ++++ T S  +EGLL ++K+ WRP + +T+  AIA
Sbjct  656  GTFIIRDDMETIGEVEKMVKSMKWEVKTTQSKDNEGLLSIKKSWWRPTQTETIKSAIA  713



>gb|KGN48886.1| hypothetical protein Csa_6G504660 [Cucumis sativus]
Length=928

 Score =   170 bits (431),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  815  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQPVLAEVDRIVRPG  874

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  875  GKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  921



>ref|XP_002267515.2| PREDICTED: probable methyltransferase PMT27 [Vitis vinifera]
Length=938

 Score =   170 bits (431),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 69/107 (64%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C +  L+ E+DRI+RP 
Sbjct  825  TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKIAPLMAEIDRIVRPG  884

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD +  + E+EN+LKS+H+++ + +S   EG+L  QK+ WRP
Sbjct  885  GKLIVRDESSAIGEVENLLKSLHWEVHLAFSKDQEGILSAQKSYWRP  931



>ref|XP_008440784.1| PREDICTED: probable methyltransferase PMT27 [Cucumis melo]
Length=933

 Score =   170 bits (431),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  820  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQPVLAEVDRIVRPG  879

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  880  GKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  926



>ref|XP_010254848.1| PREDICTED: probable methyltransferase PMT28 [Nelumbo nucifera]
 ref|XP_010254849.1| PREDICTED: probable methyltransferase PMT28 [Nelumbo nucifera]
Length=721

 Score =   168 bits (426),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNL-MGLVVEVDRILRP  470
            TLPI+YERGL G+YHDWCE+F TYPRSYDLLHADHLFS++K++C   +G+VVE+DRILRP
Sbjct  614  TLPIVYERGLMGIYHDWCEAFGTYPRSYDLLHADHLFSRLKKRCKQPVGIVVEMDRILRP  673

Query  469  EGKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
             G  I+RD  + L  LE IL+S+H++IRMTY+   EG++C QKTMWRP
Sbjct  674  GGWTIIRDKVQILEHLEVILRSLHWEIRMTYAQDKEGIMCAQKTMWRP  721



>ref|XP_004149997.1| PREDICTED: probable methyltransferase PMT27-like [Cucumis sativus]
Length=882

 Score =   170 bits (430),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLP+IYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI+RP 
Sbjct  769  TLPVIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCKLQPVLAEVDRIVRPG  828

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRP  326
            GKLIVRD + T+ E+EN+LKS+ +++ +T+S   EGLL  QK  WRP
Sbjct  829  GKLIVRDESSTIGEVENLLKSLRWEVHLTFSKNQEGLLSAQKGDWRP  875



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score =   170 bits (430),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  646  TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
            TLPIIYERGLFG+YHDWCESFSTYPRSYDLLHADHLFS++K++C ++ ++ E+DRI++P 
Sbjct  821  TLPIIYERGLFGIYHDWCESFSTYPRSYDLLHADHLFSRLKKRCKVVPVMAEIDRIVKPG  880

Query  466  GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  323
            GKLIVRD +  + E+ENILKS+H+++R+ +S   EG+L  QK+ WRP+
Sbjct  881  GKLIVRDKSSIVGEVENILKSLHWEVRLIFSKDQEGILSAQKSDWRPR  928



>ref|XP_011025891.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27 
[Populus euphratica]
Length=1039

 Score =   170 bits (431),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -2

Query  646   TLPIIYERGLFGMYHDWCESFSTYPRSYDLLHADHLFSKIKRKCNLMGLVVEVDRILRPE  467
             TLPIIYERGLFG+YHDWCESFSTYPR+YDLLHADHLFSK+K++C L  ++ EVDRI RP 
Sbjct  926   TLPIIYERGLFGIYHDWCESFSTYPRTYDLLHADHLFSKLKKRCQLAPVLAEVDRIARPG  985

Query  466   GKLIVRDHTETLTELENILKSMHYDIRMTYSNGDEGLLCVQKTMWRPK  323
             GKLIVRD +  + E+EN+LKS+H+++ + +S   EGLL  QK  WRP+
Sbjct  986   GKLIVRDESRAIEEVENLLKSLHWEVHLIFSKDQEGLLIAQKGEWRPQ  1033



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000