BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041B05

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    207   3e-61   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    207   3e-61   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   207   3e-61   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   207   3e-61   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   207   4e-61   Citrus sinensis [apfelsine]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    206   6e-61   Vitis vinifera
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    206   6e-61   Vitis vinifera
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             206   8e-61   Citrus clementina [clementine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             206   8e-61   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             206   9e-61   
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   206   1e-60   Citrus sinensis [apfelsine]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    204   4e-60   
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   204   7e-60   Citrus sinensis [apfelsine]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          202   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                202   4e-59   Morus notabilis
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   201   8e-59   Citrus sinensis [apfelsine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         201   9e-59   Ricinus communis
ref|NP_001242098.1|  uncharacterized protein LOC100813881               200   1e-58   
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               195   2e-58   Gossypium arboreum [tree cotton]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               199   2e-58   Glycine max [soybeans]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    199   2e-58   
gb|KJB80005.1|  hypothetical protein B456_013G076900                    199   2e-58   Gossypium raimondii
gb|ACU18529.1|  unknown                                                 199   2e-58   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    200   2e-58   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             198   2e-58   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    199   2e-58   
gb|KJB80004.1|  hypothetical protein B456_013G076900                    199   2e-58   Gossypium raimondii
gb|KJB79994.1|  hypothetical protein B456_013G076500                    199   3e-58   Gossypium raimondii
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         198   5e-58   Jatropha curcas
gb|KJB80000.1|  hypothetical protein B456_013G076800                    198   6e-58   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    198   6e-58   Gossypium raimondii
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    198   7e-58   Populus euphratica
gb|KJB79996.1|  hypothetical protein B456_013G076600                    197   8e-58   Gossypium raimondii
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    198   8e-58   Glycine max [soybeans]
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     198   9e-58   Glycine soja [wild soybean]
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    199   1e-57   Glycine max [soybeans]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    199   1e-57   
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          188   1e-57   
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    197   2e-57   Nicotiana tomentosiformis
gb|KJB79995.1|  hypothetical protein B456_013G076600                    197   2e-57   Gossypium raimondii
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    196   3e-57   
emb|CDP19777.1|  unnamed protein product                                196   3e-57   Coffea canephora [robusta coffee]
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               197   4e-57   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     196   5e-57   Glycine soja [wild soybean]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    196   8e-57   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    196   1e-56   Fragaria vesca subsp. vesca
gb|AFK43607.1|  unknown                                                 190   2e-56   Lotus japonicus
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               194   2e-56   Prunus mume [ume]
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             194   2e-56   Phaseolus vulgaris [French bean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             194   2e-56   Phaseolus vulgaris [French bean]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             194   3e-56   Prunus persica
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          194   3e-56   Sesamum indicum [beniseed]
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    192   3e-56   Populus euphratica
ref|XP_002516727.1|  uv excision repair protein rad23, putative         194   3e-56   Ricinus communis
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    194   3e-56   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           194   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    194   3e-56   Populus euphratica
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    194   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          195   4e-56   
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    193   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          194   4e-56   Populus euphratica
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               194   4e-56   Pyrus x bretschneideri [bai li]
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    193   5e-56   Populus euphratica
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             192   5e-56   
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    193   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    193   5e-56   Populus euphratica
emb|CDP02781.1|  unnamed protein product                                193   5e-56   Coffea canephora [robusta coffee]
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    193   6e-56   Populus euphratica
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          193   6e-56   
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    193   7e-56   Cicer arietinum [garbanzo]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          193   7e-56   Citrus sinensis [apfelsine]
gb|EPS71284.1|  hypothetical protein M569_03474                         193   8e-56   Genlisea aurea
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             193   9e-56   
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          192   1e-55   
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  192   1e-55   Citrus sinensis [apfelsine]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             192   2e-55   Citrus clementina [clementine]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          192   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    194   2e-55   
gb|ABD96960.1|  hypothetical protein                                    192   3e-55   Tarenaya spinosa
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          191   3e-55   Sesamum indicum [beniseed]
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    191   3e-55   Nicotiana sylvestris
gb|KEH44233.1|  RAD23 UV excision repair family protein                 191   3e-55   Medicago truncatula
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          185   4e-55   Nicotiana tomentosiformis
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               191   4e-55   Solanum lycopersicum
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                191   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          191   4e-55   Phoenix dactylifera
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    191   5e-55   Nicotiana sylvestris
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          191   5e-55   Solanum tuberosum [potatoes]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             191   5e-55   Prunus persica
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               191   6e-55   Nicotiana sylvestris
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                194   6e-55   
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             190   6e-55   Prunus persica
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   8e-55   Elaeis guineensis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   8e-55   Elaeis guineensis
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          190   8e-55   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             190   9e-55   Populus trichocarpa [western balsam poplar]
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               190   1e-54   
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    190   1e-54   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           189   1e-54   
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    190   1e-54   Populus euphratica
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             190   1e-54   
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          190   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               189   1e-54   Vitis vinifera
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    189   1e-54   Populus euphratica
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          189   1e-54   Amborella trichopoda
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    189   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   2e-54   Elaeis guineensis
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    189   2e-54   Populus euphratica
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   2e-54   Elaeis guineensis
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          190   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    190   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    189   2e-54   Populus euphratica
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    191   2e-54   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    191   2e-54   Phoenix dactylifera
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    191   2e-54   
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               190   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    190   2e-54   Phoenix dactylifera
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          188   6e-54   Elaeis guineensis
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          187   6e-54   Tarenaya hassleriana [spider flower]
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    187   7e-54   Nicotiana sylvestris
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    187   7e-54   Nicotiana tomentosiformis
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    187   1e-53   Nicotiana sylvestris
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    187   1e-53   Nicotiana tomentosiformis
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             186   3e-53   Capsella rubella
gb|ABB02636.1|  RAD23-like                                              186   3e-53   Solanum tuberosum [potatoes]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             186   3e-53   
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    186   3e-53   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    185   3e-53   
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             186   4e-53   Eutrema salsugineum [saltwater cress]
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    186   4e-53   Phoenix dactylifera
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    186   4e-53   Phoenix dactylifera
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             185   4e-53   
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             187   4e-53   Capsella rubella
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    185   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    185   6e-53   Solanum lycopersicum
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    185   6e-53   Solanum lycopersicum
ref|NP_198663.1|  ubiquitin receptor RAD23d                             185   7e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         185   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    184   8e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             186   9e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    184   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    185   9e-53   Tarenaya hassleriana [spider flower]
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    184   1e-52   Solanum lycopersicum
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        184   1e-52   Nicotiana tabacum [American tobacco]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                186   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    184   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    184   2e-52   Camelina sativa [gold-of-pleasure]
dbj|BAC76393.1|  RAD23-like protein                                     182   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    184   2e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               184   2e-52   Solanum tuberosum [potatoes]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          184   2e-52   Nelumbo nucifera [Indian lotus]
ref|NP_186903.1|  UV excision repair protein RAD23C                     184   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          183   4e-52   Elaeis guineensis
ref|NP_001189793.1|  UV excision repair protein RAD23C                  184   4e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67404.1|  BnaA07g14440D                                          183   4e-52   
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               183   5e-52   Brassica rapa
emb|CDY58121.1|  BnaCnng32650D                                          183   5e-52   Brassica napus [oilseed rape]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    183   1e-51   Arabis alpina [alpine rockcress]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    183   1e-51   Arabis alpina [alpine rockcress]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          181   2e-51   
emb|CDY01661.1|  BnaC04g30910D                                          181   2e-51   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               181   3e-51   Brassica rapa
emb|CDX74522.1|  BnaA04g08670D                                          181   3e-51   
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    179   1e-50   Arabis alpina [alpine rockcress]
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          179   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          179   2e-50   Cucumis melo [Oriental melon]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       179   3e-50   Cucumis sativus [cucumbers]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                177   4e-50   Erythranthe guttata [common monkey flower]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                177   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          177   4e-50   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          175   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          175   4e-49   
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               166   5e-49   Gossypium arboreum [tree cotton]
emb|CDX74251.1|  BnaA03g27960D                                          175   6e-49   
emb|CAA72741.1|  RAD23, isoform I                                       174   6e-49   Daucus carota [carrots]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    174   7e-49   Tarenaya hassleriana [spider flower]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    174   7e-49   Tarenaya hassleriana [spider flower]
emb|CDX91998.1|  BnaC03g33000D                                          175   8e-49   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               175   8e-49   Brassica rapa
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               174   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    172   6e-48   Setaria italica
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   9e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          172   1e-47   Oryza brachyantha
gb|ACN40029.1|  unknown                                                 172   1e-47   Picea sitchensis
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    171   2e-47   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ98767.1|  predicted protein                                      170   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ00429.1|  hypothetical protein OsI_22453                          170   6e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001057334.1|  Os06g0264300                                       170   8e-47   
gb|ACG32894.1|  DNA repair protein RAD23                                169   9e-47   Zea mays [maize]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          168   2e-46   Oryza sativa Indica Group [Indian rice]
gb|EMT27109.1|  Putative DNA repair protein RAD23                       169   2e-46   
gb|EMS61794.1|  putative DNA repair protein RAD23                       169   3e-46   Triticum urartu
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          168   3e-46   Brachypodium distachyon [annual false brome]
ref|NP_001061854.1|  Os08g0430200                                       167   1e-45   
ref|NP_001149140.1|  LOC100282762                                       166   1e-45   Zea mays [maize]
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    165   2e-45   Cicer arietinum [garbanzo]
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          166   2e-45   
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   3e-45   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               166   3e-45   Zea mays [maize]
ref|NP_001266655.1|  DNA repair protein RAD23                           165   3e-45   
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    156   5e-45   
gb|KEH21499.1|  RAD23 UV excision repair family protein                 162   2e-44   Medicago truncatula
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          162   5e-44   Fragaria vesca subsp. vesca
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    162   5e-44   Brachypodium distachyon [annual false brome]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    162   5e-44   Brachypodium distachyon [annual false brome]
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                160   6e-43   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          157   2e-42   Amborella trichopoda
gb|ABK24371.1|  unknown                                                 157   4e-42   Picea sitchensis
gb|ACH72675.1|  RAD23                                                   156   6e-42   Pinus sylvestris var. mongolica
ref|NP_001063134.1|  Os09g0407200                                       156   7e-42   
gb|KJB69954.1|  hypothetical protein B456_011G053200                    154   9e-42   Gossypium raimondii
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    155   1e-41   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       155   1e-41   Brachypodium distachyon [annual false brome]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               155   1e-41   Gossypium arboreum [tree cotton]
ref|XP_001763027.1|  predicted protein                                  155   2e-41   
gb|KJB69952.1|  hypothetical protein B456_011G053200                    154   2e-41   Gossypium raimondii
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         154   2e-41   Jatropha curcas
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            152   2e-41   
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          154   3e-41   Citrus sinensis [apfelsine]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    154   5e-41   Gossypium raimondii
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    151   1e-40   Nicotiana sylvestris
gb|KJB34921.1|  hypothetical protein B456_006G091100                    151   1e-40   Gossypium raimondii
gb|AAB65841.1|  osRAD23                                                 153   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    152   1e-40   Nicotiana tomentosiformis
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    152   2e-40   Nicotiana tomentosiformis
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               152   2e-40   Fragaria vesca subsp. vesca
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    144   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               152   2e-40   Vitis vinifera
emb|CBI25247.3|  unnamed protein product                                152   2e-40   Vitis vinifera
ref|XP_002303970.1|  DNA repair protein RAD23                           150   4e-40   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          151   5e-40   Populus euphratica
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    150   6e-40   Nicotiana sylvestris
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             150   6e-40   Populus trichocarpa [western balsam poplar]
gb|EMT30328.1|  Putative DNA repair protein RAD23                       152   6e-40   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    150   6e-40   Nicotiana sylvestris
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    151   7e-40   Setaria italica
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               150   9e-40   Gossypium arboreum [tree cotton]
gb|AFK37577.1|  unknown                                                 150   1e-39   Lotus japonicus
gb|EMS50196.1|  putative DNA repair protein RAD23                       152   1e-39   Triticum urartu
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             149   2e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          149   2e-39   Nelumbo nucifera [Indian lotus]
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              145   2e-39   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      149   3e-39   Brassica rapa
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          149   3e-39   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             149   3e-39   
ref|XP_002299163.1|  DNA repair protein RAD23                           148   4e-39   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          149   4e-39   Populus euphratica
emb|CDX81753.1|  BnaC08g38480D                                          148   5e-39   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          148   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             148   6e-39   Capsella rubella
dbj|BAC76389.1|  RAD23-like protein                                     148   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    148   6e-39   Nelumbo nucifera [Indian lotus]
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               148   6e-39   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          147   6e-39   Sesamum indicum [beniseed]
gb|ACF79443.1|  unknown                                                 147   7e-39   Zea mays [maize]
ref|NP_850982.1|  ubiquitin receptor RAD23b                             148   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             148   7e-39   Prunus persica
dbj|BAC76390.1|  RAD23-like protein                                     147   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149553.1|  LOC100283179                                       148   8e-39   Zea mays [maize]
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          147   9e-39   Prunus mume [ume]
ref|NP_565216.2|  ubiquitin receptor RAD23b                             147   9e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ABG89119.1|  Rad23-3Ai                                               147   9e-39   synthetic construct
dbj|BAC76391.1|  RAD23-like protein                                     147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173070.1|  DNA repair protein RAD23A                             147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          147   1e-38   Solanum tuberosum [potatoes]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          147   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              147   1e-38   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    147   2e-38   Nicotiana sylvestris
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          147   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    147   2e-38   Nicotiana sylvestris
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    145   2e-38   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      147   2e-38   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 147   2e-38   
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              143   2e-38   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               146   2e-38   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      146   2e-38   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    146   3e-38   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    146   3e-38   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             145   4e-38   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              145   5e-38   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      145   6e-38   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    145   6e-38   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              145   8e-38   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          145   9e-38   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             145   9e-38   
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    145   9e-38   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             144   1e-37   
gb|AAF68123.1|AC010793_18  F20B17.8                                     144   1e-37   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             145   1e-37   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    144   1e-37   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               144   1e-37   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    144   2e-37   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    144   2e-37   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    144   2e-37   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               144   2e-37   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             144   3e-37   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       144   3e-37   
gb|ACU20959.1|  unknown                                                 143   3e-37   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    143   3e-37   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                143   3e-37   
ref|NP_001240038.1|  uncharacterized protein LOC100819019               143   4e-37   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         142   5e-37   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               143   5e-37   
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    142   6e-37   
ref|XP_001752264.1|  predicted protein                                  135   6e-37   
emb|CDO98260.1|  unnamed protein product                                142   1e-36   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     143   1e-36   
gb|AEA86336.1|  putative DNA repair protein                             136   2e-36   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    141   3e-36   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    141   3e-36   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    141   3e-36   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             140   3e-36   
gb|ACJ83410.1|  unknown                                                 135   3e-36   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          140   5e-36   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     140   5e-36   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    140   5e-36   
ref|NP_974181.1|  ubiquitin receptor RAD23b                             140   6e-36   
gb|AEA86337.1|  putative DNA repair protein                             135   6e-36   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      139   8e-36   
emb|CDY35071.1|  BnaA06g10810D                                          139   9e-36   
ref|XP_003637292.1|  RAD23 protein                                      135   1e-35   
emb|CDY33351.1|  BnaC05g12320D                                          139   1e-35   
ref|XP_003637291.1|  RAD23 protein                                      137   4e-35   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    137   4e-35   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    137   5e-35   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    135   3e-34   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          135   3e-34   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    135   3e-34   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    135   4e-34   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    134   1e-33   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          134   1e-33   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               133   2e-33   
emb|CAA72742.1|  RAD23 protein, isoform II                              133   3e-33   
emb|CDX79333.1|  BnaC06g19700D                                          133   4e-33   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    132   4e-33   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    132   4e-33   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    132   5e-33   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    132   5e-33   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          132   6e-33   
ref|XP_001780766.1|  predicted protein                                  132   7e-33   
emb|CDX67983.1|  BnaA07g20230D                                          132   7e-33   
dbj|BAK04690.1|  predicted protein                                      130   1e-32   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   2e-32   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   2e-32   
gb|EEC72612.1|  hypothetical protein OsI_06092                          130   3e-32   
ref|NP_001046083.1|  Os02g0179300                                       130   3e-32   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          129   5e-32   
ref|NP_001148810.1|  LOC100282427                                       129   5e-32   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 129   5e-32   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          129   9e-32   
gb|ACG24239.1|  hypothetical protein                                    121   1e-31   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     125   3e-31   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     127   4e-31   
emb|CAB65692.1|  Rad23 Protein                                          119   4e-31   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    126   1e-30   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          125   1e-30   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    125   1e-30   
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   124   3e-30   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     121   8e-29   
dbj|BAC76395.1|  RAD23-like protein                                     118   4e-28   
gb|KHF98435.1|  Putative DNA repair RAD23-4 -like protein               108   3e-27   
ref|XP_002444377.1|  hypothetical protein SORBIDRAFT_07g020960          106   3e-25   
gb|KDO46128.1|  hypothetical protein CISIN_1g0198172mg                  104   4e-25   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    109   1e-24   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    109   1e-24   
dbj|BAJ97496.1|  predicted protein                                      104   5e-23   
ref|XP_005708114.1|  nucleotide excision repair protein                 102   6e-22   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    100   2e-21   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...  99.0    3e-21   
gb|KGL75456.1|  UV excision repair protein RAD23 B                    99.0    4e-21   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...  98.2    6e-21   
gb|EIE84327.1|  UV excision repair protein Rad23                      98.2    9e-21   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  98.2    1e-20   
gb|EXX69202.1|  Rad23p                                                96.7    2e-20   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...  96.7    2e-20   
gb|ESA07268.1|  hypothetical protein GLOINDRAFT_82043                 93.2    2e-20   
gb|EXX69203.1|  Rad23p                                                96.7    2e-20   
gb|EXX69201.1|  Rad23p                                                96.7    3e-20   
gb|KFU98476.1|  UV excision repair protein RAD23 B                    96.7    3e-20   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...  95.9    5e-20   
ref|XP_008297295.1|  PREDICTED: UV excision repair protein RAD23 ...  95.9    5e-20   
ref|XP_004570397.1|  PREDICTED: UV excision repair protein RAD23 ...  95.9    5e-20   
ref|XP_005802841.1|  PREDICTED: UV excision repair protein RAD23 ...  95.5    6e-20   
ref|XP_002432231.1|  uv excision repair protein rad23, putative       95.5    6e-20   
ref|XP_003446521.1|  PREDICTED: UV excision repair protein RAD23 ...  95.5    6e-20   
emb|CDQ83149.1|  unnamed protein product                              95.9    6e-20   
ref|XP_007573182.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  95.5    6e-20   
emb|CDQ90828.1|  unnamed protein product                              95.5    6e-20   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...  95.5    6e-20   
gb|KJB69953.1|  hypothetical protein B456_011G053200                  95.1    7e-20   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...  95.1    7e-20   
ref|XP_006677785.1|  hypothetical protein BATDEDRAFT_16317            95.1    8e-20   
emb|CAF91196.1|  unnamed protein product                              94.7    9e-20   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...  95.1    9e-20   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...  94.4    1e-19   
dbj|BAM18172.1|  UV excision repair protein rad23                     94.0    1e-19   
ref|XP_002948806.1|  hypothetical protein VOLCADRAFT_104016           94.7    1e-19   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5     94.4    2e-19   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...  94.4    2e-19   
ref|XP_002114015.1|  hypothetical protein TRIADDRAFT_58050            94.4    2e-19   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like  94.4    2e-19   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein         94.4    2e-19   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  94.0    2e-19   
ref|XP_010306604.1|  PREDICTED: UV excision repair protein RAD23 ...  90.5    3e-19   
gb|KFY35746.1|  hypothetical protein V495_07984                       89.4    3e-19   
gb|ACN58624.1|  UV excision repair protein RAD23 homolog A            89.4    3e-19   
gb|KFP78177.1|  UV excision repair protein RAD23 B                    92.0    4e-19   
ref|XP_010284737.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    4e-19   
ref|XP_009070739.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    4e-19   
gb|KFM76006.1|  UV excision repair protein RAD23-like protein         89.7    4e-19   
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    5e-19   
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    5e-19   
gb|KFV42406.1|  UV excision repair protein RAD23 B                    93.2    5e-19   
ref|XP_009977358.1|  PREDICTED: UV excision repair protein RAD23 ...  90.9    5e-19   
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    5e-19   
ref|XP_005994200.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    5e-19   
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    5e-19   
ref|XP_010161922.1|  PREDICTED: UV excision repair protein RAD23 ...  90.9    5e-19   
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    6e-19   
gb|KFP28504.1|  UV excision repair protein RAD23 B                    92.8    6e-19   
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    6e-19   
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  92.4    6e-19   
gb|KFV48041.1|  UV excision repair protein RAD23 B                    92.8    6e-19   
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    6e-19   
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    6e-19   
gb|KFV93588.1|  UV excision repair protein RAD23 B                    91.3    7e-19   
gb|KFP54135.1|  UV excision repair protein RAD23 B                    92.8    7e-19   
ref|XP_009958718.1|  PREDICTED: UV excision repair protein RAD23 ...  90.5    7e-19   
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    7e-19   
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    7e-19   
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    7e-19   
gb|KFY41736.1|  hypothetical protein V494_02817                       89.4    7e-19   
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    7e-19   
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    7e-19   
ref|XP_009996457.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    8e-19   
ref|XP_010150954.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    8e-19   
gb|KFP45297.1|  UV excision repair protein RAD23 B                    92.4    8e-19   
ref|XP_005240425.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    8e-19   
gb|KFP78669.1|  UV excision repair protein RAD23 B                    92.4    8e-19   
dbj|BAM19254.1|  UV excision repair protein rad23                     92.0    8e-19   
ref|XP_010741704.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    8e-19   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    9e-19   
ref|XP_001625753.1|  predicted protein                                92.4    9e-19   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    9e-19   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  92.8    9e-19   
gb|KFM01514.1|  UV excision repair protein RAD23 B                    92.4    9e-19   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    9e-19   
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    1e-18   
gb|KFQ93153.1|  UV excision repair protein RAD23 B                    92.4    1e-18   
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    1e-18   
gb|KFY70736.1|  hypothetical protein V499_08973                       91.7    1e-18   
gb|KFP09954.1|  UV excision repair protein RAD23 B                    92.4    1e-18   
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    1e-18   
gb|KFZ11589.1|  hypothetical protein V501_04678                       91.7    1e-18   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    1e-18   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  92.4    1e-18   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...  92.0    1e-18   
gb|KFU90019.1|  UV excision repair protein RAD23 B                    92.0    1e-18   
gb|KFY23884.1|  hypothetical protein V493_05572                       89.0    1e-18   
gb|KFW73791.1|  UV excision repair protein RAD23 B                    92.0    1e-18   
ref|XP_008495758.1|  PREDICTED: UV excision repair protein RAD23 ...  91.7    1e-18   
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...  91.7    1e-18   
ref|XP_009685841.1|  PREDICTED: UV excision repair protein RAD23 ...  91.7    1e-18   
ref|XP_004339463.1|  Rad23, putative                                  92.0    1e-18   
ref|XP_005446959.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    1e-18   
gb|AFM90399.1|  UV excision repair protein RAD23-like B protein       92.0    1e-18   
gb|KFW80798.1|  UV excision repair protein RAD23 B                    92.0    1e-18   
gb|KIL68983.1|  hypothetical protein M378DRAFT_158134                 91.7    1e-18   
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    1e-18   
gb|KFY87294.1|  hypothetical protein V500_07097                       92.0    1e-18   
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    1e-18   
ref|XP_010011187.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    2e-18   
ref|XP_009964886.1|  PREDICTED: UV excision repair protein RAD23 ...  93.6    2e-18   
gb|KFP03775.1|  UV excision repair protein RAD23 B                    91.7    2e-18   
gb|KFY51543.1|  hypothetical protein V496_08814                       89.0    2e-18   
gb|KGL96224.1|  UV excision repair protein RAD23 B                    91.7    2e-18   
gb|KFY14526.1|  hypothetical protein V492_02569                       90.9    2e-18   
gb|KFQ43918.1|  UV excision repair protein RAD23 B                    91.3    2e-18   
ref|XP_002606011.1|  hypothetical protein BRAFLDRAFT_61506            90.9    2e-18   
gb|KFV87804.1|  UV excision repair protein RAD23 B                    91.3    2e-18   
ref|XP_007875448.1|  UV excision repair protein Rad23                 91.3    2e-18   
gb|KFO78985.1|  UV excision repair protein RAD23 B                    91.3    2e-18   
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...  90.9    2e-18   
ref|XP_006631678.1|  PREDICTED: UV excision repair protein RAD23 ...  91.3    2e-18   
ref|XP_005013373.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  92.4    2e-18   
gb|KFP68145.1|  UV excision repair protein RAD23 B                    91.3    2e-18   
gb|KFW08178.1|  UV excision repair protein RAD23 B                    91.3    2e-18   
ref|XP_003643857.2|  PREDICTED: UV excision repair protein RAD23 ...  89.4    3e-18   
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...  90.1    3e-18   
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...  90.5    3e-18   
ref|XP_010869793.1|  PREDICTED: UV excision repair protein RAD23 ...  92.0    3e-18   



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  296  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  355

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  356  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  295  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  354

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  355  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  302  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  361

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  362  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  301  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  360

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  361  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  402



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  302  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  361

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  362  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEERE
Sbjct  296  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEERE  355

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  356  AIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEERE
Sbjct  297  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEERE  356

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  357  AIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  300  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  360  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  299  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  358

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  359  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  400



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  300  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  360  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  329  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  388

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  389  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  430



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  284  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  344  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHEFED  385



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEERE
Sbjct  296  QPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEERE  355

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  356  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEP+EGGEGNILGQLA+SMPQAV VTPEERE
Sbjct  300  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPLEGGEGNILGQLASSMPQAVTVTPEERE  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HE+ED
Sbjct  360  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEYED  401



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGN+LGQL+A+MPQAV VTPEERE
Sbjct  318  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNLLGQLSAAMPQAVTVTPEERE  377

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  378  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDD  419



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/100 (94%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = -1

Query  598  MLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAI  419
            +LQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAI
Sbjct  299  ILQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAI  358

Query  418  ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  359  ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ DFLRLINEPVEGGEGNI+GQLAA+MPQAV VTPEERE
Sbjct  308  QPMLQELGKQNPNLVRLIQEHQTDFLRLINEPVEGGEGNIMGQLAAAMPQAVTVTPEERE  367

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  368  AIERLEAMGFDRGLVLEVFFACNKNEELAANYLLDHMHEFED  409



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  299  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGTMPQAVTVTPEERQ  358

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  359  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  400



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  121  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  180

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  181  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  222



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA++MPQAV VTPEER+
Sbjct  291  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLASAMPQAVTVTPEERQ  350

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  351  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  392



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  281  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  341  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  284  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  344  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  385



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  281  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  341  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  300  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  360  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  401



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/100 (95%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEERE
Sbjct  234  QPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEERE  293

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  294  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  333



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  282  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  342  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  383



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  283  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  343  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  283  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  343  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  282  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  341  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  382



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  281  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  341  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  382



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  283  QPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  343  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/100 (94%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMR IQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEERE
Sbjct  279  QPMLQELGKQNPHLMRFIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEERE  338

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  339  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  378



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  239  QPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  298

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  299  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  340



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEP EGGEGNILGQ+A+ MPQAV VTPEER+
Sbjct  300  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGGEGNILGQMASGMPQAVTVTPEERQ  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  360  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  401



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  315  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  374

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  375  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  416



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  367  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  426

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  427  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  468



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+
Sbjct  368  QPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQ  427

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  428  AIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  469



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  10   QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  69

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  70   AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEERE
Sbjct  294  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEERE  353

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLE MGFD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  354  AIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  395



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEERE
Sbjct  283  QPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  343  AIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEERE
Sbjct  276  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLE MGFD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  336  AIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  377



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEP+EGGEGNILGQLA +MPQ +QVT EERE
Sbjct  289  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPIEGGEGNILGQLAGAMPQTIQVTAEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI RLE MGFDRA VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  349  AIRRLEEMGFDRATVLEVFFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+
Sbjct  306  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQ  365

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  366  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  407



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+
Sbjct  308  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQ  367

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  368  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  409



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEERE
Sbjct  300  QPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEERE  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  360  AIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHMHEFED  401



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEERE
Sbjct  299  QPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEERE  358

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  359  AIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHMHEFED  400



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLIQ+HQ DFLRLINEPVEGGEGNILGQ A A+MPQAV VTPEER
Sbjct  125  QPMLQELGKQNPHLMRLIQDHQVDFLRLINEPVEGGEGNILGQPAGAAMPQAVSVTPEER  184

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  185  EAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  227



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  284  QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  344  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+
Sbjct  300  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVSVTAEERQ  359

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  360  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  401



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+
Sbjct  298  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVTVTAEERQ  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  358  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  284  QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  344  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEERE
Sbjct  280  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEERE  338

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  339  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  380



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  237  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  295

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  296  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  337



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG +GN+LGQLA+++PQ+V VTPEERE
Sbjct  281  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-DGNLLGQLASAVPQSVSVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMH+FE+
Sbjct  340  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHDFEE  381



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  286  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  344

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  345  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  386



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  285  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  344  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  285  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  344  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EGN+LGQLAA MPQA+ VTPEERE
Sbjct  290  QPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGNVLGQLAAGMPQALTVTPEERE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  350  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEGG GNIL QLA +MPQA+QVTPEERE
Sbjct  332  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGGAGNILEQLAGAMPQAIQVTPEERE  391

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  392  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE  433



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 3/102 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEERE
Sbjct  289  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  346  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  387



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNI G LAA+MPQ+V VTPEERE
Sbjct  287  QPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNISGPLAAAMPQSVTVTPEERE  346

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  347  AIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  388



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  290  QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  350  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  391



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  273  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  332  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  373



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEERE
Sbjct  251  QPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEERE  310

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  311  AIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  352



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 3/102 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEERE
Sbjct  288  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEERE  344

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  345  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  291  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  350  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  391



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEERE
Sbjct  287  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFD ALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  346  AIERLEAMGFDPALVLEVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEERE
Sbjct  290  QPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  349  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  286  QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  346  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  387



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGEGN+LGQ+A  MPQAV VTPEER+
Sbjct  298  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGEGNLLGQMAGGMPQAVTVTPEERQ  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  358  AIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEERE
Sbjct  289  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  349  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LGQLA  MPQAV VTPEERE
Sbjct  288  QPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEGGEGDLLGQLAGGMPQAVTVTPEERE  347

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDH HEFED
Sbjct  348  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHGHEFED  389



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEERE
Sbjct  295  QPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEERE  354

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  355  AIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  396



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN +LGQLAA+MPQA+ VTPEER
Sbjct  296  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEER  355

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLE MGFD  LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  356  EAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHMHEFEE  398



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEERE
Sbjct  266  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEERE  325

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  326  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEERE
Sbjct  289  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  349  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG NI+ QLA  +PQA+QVTPEER
Sbjct  305  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEER  364

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  365  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFDE  407



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 99/102 (97%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLAA+MPQAV VTPEERE
Sbjct  387  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNLLGQLAAAMPQAVTVTPEERE  445

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDR +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  446  AIERLEAMGFDRNIVLEVFFACNKNEELAANYLLDHMHEFEE  487



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG NI+ QLA  +PQA+QVTPEER
Sbjct  333  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEER  392

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  393  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFDE  435



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEERE
Sbjct  280  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEERE  338

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  339  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  380



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGG EGNILGQLAA+MPQA+QVTPEER
Sbjct  293  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEER  352

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  353  EAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  395



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGEGN +LGQ+AA MPQ+V VTPEER
Sbjct  294  QPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGEGNNLLGQMAAGMPQSVTVTPEER  353

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            +AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  354  QAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFDE  396



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEERE
Sbjct  94   QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEERE  152

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  153  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE  194



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN +LGQLAA+MPQA+ VTPEER
Sbjct  307  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEER  366

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  367  EAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  409



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG EGNILGQLA +MPQ V VTPEERE
Sbjct  281  QPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-EGNILGQLAEAMPQTVNVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  340  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  381



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E ++LGQLA++MPQA+ VTPEERE
Sbjct  283  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPTEGAESDLLGQLASAMPQALTVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  343  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGG EGNILGQLAA+MPQA+QVTPEER
Sbjct  275  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEER  334

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  335  EAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHIHEFEE  377



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEERE
Sbjct  290  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  349  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 98/102 (96%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEERE
Sbjct  286  QPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  344  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEERE
Sbjct  287  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  346  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 99/102 (97%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+LGQL+A+MPQAV VTPEERE
Sbjct  448  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNLLGQLSAAMPQAVTVTPEERE  506

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  507  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDD  548



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 98/102 (96%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEERE
Sbjct  286  QPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  344  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEERE
Sbjct  295  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEERE  354

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  355  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEERE
Sbjct  294  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEERE  353

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  354  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  395



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   190 bits (482),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 98/102 (96%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEERE
Sbjct  285  QPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  343  AIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  384



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  299  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  358  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEERE
Sbjct  289  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEERE  347

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  348  AIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHLHEFDE  389



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  299  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  358  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  284  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  343  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  384



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  298  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  356

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  357  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  398



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVTP
Sbjct  312  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTP  371

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  372  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE  417



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 100/106 (94%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTP
Sbjct  315  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTP  374

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  375  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  420



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQL  ++PQAV +TPEERE
Sbjct  282  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLG-TVPQAVTITPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            +IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  340  SIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  282  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  341  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP LMRLIQEHQADFLRLINE P EG EGN+LGQLA++MPQAV VTPEER
Sbjct  287  QPMLQELGKQNPQLMRLIQEHQADFLRLINEQPAEGAEGNLLGQLASAMPQAVTVTPEER  346

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEA+GFDRALVLEVFFACNKNEELAANYLLDHM+EFE+
Sbjct  347  EAIERLEALGFDRALVLEVFFACNKNEELAANYLLDHMNEFEE  389



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EG N+LGQLAA MPQA+ VTPEER
Sbjct  290  QPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGSNVLGQLAAGMPQALTVTPEER  349

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  350  EAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  392



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEERE
Sbjct  320  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEERE  379

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  380  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  421



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  281  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  340  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  381



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEERE
Sbjct  321  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEERE  380

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  381  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  422



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 100/106 (94%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTP
Sbjct  314  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTP  373

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  374  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEERE
Sbjct  307  QPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEERE  366

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  367  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  408



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEERE
Sbjct  308  QPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEERE  367

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  368  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  409



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEERE
Sbjct  264  QPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEERE  322

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  323  AIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  364



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEERE
Sbjct  351  QPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEERE  410

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  411  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  452



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEERE
Sbjct  350  QPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEERE  409

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  410  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEERE
Sbjct  350  QPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEERE  409

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  410  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 100/106 (94%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GNILGQLAA MPQ  A+QVTP
Sbjct  317  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTP  376

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  377  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  422



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEERE
Sbjct  349  QPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEERE  408

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  409  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  450



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E ++LGQ A+ MPQA+ VTPEERE
Sbjct  283  QPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESDLLGQFASPMPQALTVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  343  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEG NI  QL  +MPQA+QVTPEER
Sbjct  281  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGGNISSQLGGAMPQAIQVTPEER  340

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGF+R LVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  341  EAIERLEAMGFERGLVLEVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  287  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  346  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  283  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  342  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  269  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  327

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  328  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE  369



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  265  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  323

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  324  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE  365



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  284  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  343  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  384



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  284  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEE+AANYLLDHMHEF++
Sbjct  343  AIERLEAMGFDRALVLQVFFACNKNEEMAANYLLDHMHEFDE  384



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  276  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  334

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  335  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEERE
Sbjct  270  QPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEERE  328

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  329  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  370



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEERE
Sbjct  267  QPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEERE  325

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  326  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  288  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVIEQLEAAMPQAVTVTPEERE  346

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  347  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEERE
Sbjct  291  QPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEERE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  350  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEERE
Sbjct  288  QPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEERE  346

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  347  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ GQL A MPQ  A+QVTP
Sbjct  267  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTP  326

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  327  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  372



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG +AA +PQ  A+QVTP
Sbjct  322  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGHMAAGIPQPQAIQVTP  381

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLE MGFDRALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  382  EEREAIERLEGMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE  427



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  276  QPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  334

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  335  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  283  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  342  AIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  383



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  281  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  340  AIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  381



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  277  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  336  AIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  277  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  336  AIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  275  QPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  333

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  334  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  375



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ GQL A MPQ  A+QVTP
Sbjct  311  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTP  370

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  371  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  416



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  273  QPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  332  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  373



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEERE
Sbjct  286  QPMLQELGKQNPQLMRLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEERE  344

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  345  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  265  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  323

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  324  AIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHMHEFDE  365



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVE  EGN+ GQ A ++PQAV VTPEERE
Sbjct  287  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVES-EGNVPGQPAGAIPQAVTVTPEERE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  346  AIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE  387



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG +GN+LGQLA +MPQ+V VT EERE
Sbjct  344  QPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-DGNVLGQLAEAMPQSVAVTAEERE  402

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  403  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  444



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEERE
Sbjct  283  QPMLQELGKQNPQLMRLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEERE  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  342  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  383



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  280  QPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  338

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  339  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  380



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT 
Sbjct  232  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTH  291

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  292  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  337



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  278  QPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  336

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  337  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  378



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEERE
Sbjct  282  QPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEERE  340

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVL+VFFAC KNEE+AANYLLDHMHEF++
Sbjct  341  AIERLEAMGFDRALVLQVFFACXKNEEMAANYLLDHMHEFDE  382



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 95/102 (93%), Gaps = 4/102 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+ GQ+A   P  VQVTPEERE
Sbjct  286  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNLFGQMA---PATVQVTPEERE  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  342  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE  383



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT 
Sbjct  314  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTH  373

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  374  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            +PMLQELGKQNP +MRLIQEHQ +FL LINEP EGGE N+LGQLAA+MPQA+ VTPEE E
Sbjct  290  RPMLQELGKQNPLVMRLIQEHQDEFLCLINEPAEGGESNLLGQLAAAMPQALTVTPEECE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  350  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 99/106 (93%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASMPQ--AVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA MPQ  A+QVT 
Sbjct  313  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTH  372

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  373  EEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  418



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  281  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  340  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  281  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  339

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  340  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  381



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  283  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEERE  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  342  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  383



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTP
Sbjct  320  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTP  379

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EER+AIERLE MGF+RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  380  EERDAIERLEGMGFERALVLEVFFACNKDEELAANYLLDHIHEFEE  425



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 4/106 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTP  437
            QPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTP
Sbjct  330  QPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTP  389

Query  436  EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EER+AIERLE MGF+RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  390  EERDAIERLEGMGFERALVLEVFFACNKDEELAANYLLDHIHEFEE  435



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQEHQ +FLRLINEP EG EG NILGQL   MPQA+ VTPEE 
Sbjct  289  QPMLQELGKQNPQILRLIQEHQGEFLRLINEPAEGTEGGNILGQLPTGMPQALSVTPEEH  348

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  349  EAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  391



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEERE
Sbjct  277  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  336  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  377



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEERE
Sbjct  277  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  336  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  377



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEERE
Sbjct  279  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEERE  337

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  338  AIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEE  379



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEERE
Sbjct  291  QPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVIEQLEAAMPQAVTVTPEERE  349

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF+RA+VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  350  AIERLEAMGFERAMVLEVFFACNKNEELAANYLLDHMHEFDE  391



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGEGN+LG   A++PQA+ ++PEERE
Sbjct  286  QPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGEGNVLGD--AAVPQAIAISPEERE  343

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  344  AIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHMHEFED  385



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 1/101 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEERE
Sbjct  319  QPMLQELGKQNPQLIRLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEERE  377

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  302
            AI+RLE MGFDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  378  AIQRLEDMGFDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  418



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 1/101 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEERE
Sbjct  317  QPMLQELGKQNPQLIRLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEERE  375

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  302
            AI+RLE MGFDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  376  AIQRLEDMGFDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  416



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEER  428
            QPMLQELGKQNP L+RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEER
Sbjct  274  QPMLQELGKQNPQLVRLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEER  333

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            E+IERLEAMGFD+ALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  334  ESIERLEAMGFDQALVLEVFFACNKNEELAANYLLDHMHEFEE  376



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEER  428
            QPMLQELGKQNP L+RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEER
Sbjct  273  QPMLQELGKQNPQLVRLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEER  332

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            E+IERLEAMGFD+ALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  333  ESIERLEAMGFDQALVLEVFFACNKNEELAANYLLDHMHEFEE  375



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGEGN LG   A++PQA+ +TPEERE
Sbjct  260  QPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGEGNALGD--AAVPQAIAITPEERE  317

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  318  AIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHMHEFED  359



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EERE
Sbjct  285  QPMLQELGKQNPNLVRLIGAHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREERE  342

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF RA+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  343  AIERLEAMGFARAIVLQVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EERE
Sbjct  279  QPMLQELGKQNPNLVRLIGTHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREERE  336

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF RA+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  337  AIERLEAMGFARAIVLQVFFACNKNEELAANYLLDHMHEFED  378



>gb|KHF97937.1| Putative DNA repair RAD23-4 -like protein [Gossypium arboreum]
Length=88

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  562  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  383
            MRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA 
Sbjct  1    MRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRAT  60

Query  382  VLEVFFACNKNEELAANYLLDHMHEFED  299
            VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  61   VLQVFFACNKNEELAANYLLDHMHDFQD  88



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 3/104 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEE
Sbjct  299  QPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEE  357

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            R+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  358  RDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 5/101 (5%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLMRLIQEHQADFL+LINEP+EGGE N+LG      PQA+ VTPEER+
Sbjct  287  QPMLQELGKQNPHLMRLIQEHQADFLQLINEPMEGGE-NLLGH----GPQAISVTPEERD  341

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  302
            AIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHMHEFE
Sbjct  342  AIERLEAMGFDRELVLEVFFACNKNEELAANYLLDHMHEFE  382



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEERE
Sbjct  277  QPMLQELGKQNPQLMRLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEERE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF+R + LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  336  AIERLEAMGFNRDIALEVFIACNKNEELAANYLLDHIHEFED  377



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEERE
Sbjct  278  QPMLQELGKQNPQLMRLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEERE  336

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGF+R + LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  337  AIERLEAMGFNRDIALEVFIACNKNEELAANYLLDHIHEFED  378



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 3/104 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEE
Sbjct  301  QPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEE  359

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            R+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  360  RDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  403



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 3/104 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEE
Sbjct  299  QPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEE  357

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            R+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  358  RDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP LMRLIQ+HQADFLRLINEPVEG EGN+L QL ++MP +V VTPEERE
Sbjct  302  QPMLQELGKQNPQLMRLIQDHQADFLRLINEPVEG-EGNLLSQLTSAMPASVSVTPEERE  360

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLE MGF RA VL+V+FACNKNEELAANYLLDHM EFE+
Sbjct  361  AIERLEGMGFRRATVLQVYFACNKNEELAANYLLDHMDEFEN  402



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA+MPQAVQVTPEER
Sbjct  305  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGAGGNILGQLAAAMPQAVQVTPEER  364

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  365  EAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  407



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  255  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  314

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  315  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  354



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  274  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  333

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  334  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  373



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  258  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  317

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  318  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  357



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQA+ VTPEER
Sbjct  305  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGTGGNILGQLAAAMPQALTVTPEER  364

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  365  EAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  407



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQEL KQNP LMRLIQ+HQADFLRL+NEPVEG EG+   QLA +MPQA+ VTPEERE
Sbjct  302  QPMLQELSKQNPQLMRLIQDHQADFLRLVNEPVEGAEGDFFNQLAGAMPQAINVTPEERE  361

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  362  AIERLEAMGFDRALVIEAFLACDKNEQLAANYLLEHAGDYED  403



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  293  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  352

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  353  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  392



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  277  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  336

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  337  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  376



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE  
Sbjct  296  QPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHA  355

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  305
             IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  356  TIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  395



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEER
Sbjct  310  QPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEER  369

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE+MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  370  EAIQRLESMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  412



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEE
Sbjct  308  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGTAGGNILGQLAAAMPQALTVTPEE  367

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            REAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  368  REAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEE
Sbjct  308  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGAAGGNILGQLAAAMPQALTVTPEE  367

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            REAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  368  REAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEER
Sbjct  297  QPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEER  356

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  357  EAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QP+LQELGKQNP +++LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE E
Sbjct  298  QPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENE  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  358  AIQRLEQMGFDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  399



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEER
Sbjct  319  QPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEER  378

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  379  EAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  421



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEER
Sbjct  320  QPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEER  379

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  380  EAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  422



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQA-VQVTPEE  431
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQA V VTPEE
Sbjct  308  QPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAAGNILGQLAAAMPQAAVTVTPEE  367

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            RE+I+RLEAMGF+R LVLEVFFACN++EELAANYLLDH HE+ED
Sbjct  368  RESIQRLEAMGFNRELVLEVFFACNRDEELAANYLLDHGHEYED  411



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QP+LQELGKQNP +++LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE E
Sbjct  298  QPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENE  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNK+E LAANYLLDHM+EF+D
Sbjct  358  AIQRLEQMGFDRDLVLEVFFACNKDELLAANYLLDHMNEFDD  399



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEER
Sbjct  297  QPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEER  356

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  357  EAIQRLEGMGFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM LIQEHQADFLRLINEP  GGE N+  QL A++PQ + +TPEE E
Sbjct  278  QPMLQELGKQNPHLMELIQEHQADFLRLINEP--GGEENLESQLGAAVPQTITITPEEHE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  336  AIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQNEFDD  377



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEERE
Sbjct  288  QPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEERE  347

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAA-NYLLDHMHEFE  302
            AIERLEAMGFDRALV EV+FACNKNEELA+  +L    H+F 
Sbjct  348  AIERLEAMGFDRALVPEVYFACNKNEELASIPFLCLGWHKFS  389



>ref|XP_008649304.1| PREDICTED: ubiquitin receptor RAD23d-like [Zea mays]
Length=104

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -1

Query  598  MLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREA  422
            MLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREA
Sbjct  1    MLQELGKQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREA  60

Query  421  IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            I+RLE MGF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  61   IQRLEGMGFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  101



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEER
Sbjct  300  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEER  359

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  360  EAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEER
Sbjct  300  QPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEER  359

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  360  EAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>gb|AFW87603.1| hypothetical protein ZEAMMB73_681598 [Zea mays]
Length=104

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = -1

Query  598  MLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREA  422
            MLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREA
Sbjct  1    MLQELGKQNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREA  60

Query  421  IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            I+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  61   IQRLEGMGFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  101



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP+LM LIQEHQADFLRLINEP  GGE N+ GQL A  PQ + +TPEE E
Sbjct  271  QPMLQELGKQNPNLMELIQEHQADFLRLINEP--GGEENLEGQLGALAPQTITITPEENE  328

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  329  AIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQNEFDD  370



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL--AASMPQAVQVTPEE  431
            QPML ELGKQNPHLM+LIQ HQADFLRLINEPVEGG    L     +A+MPQAV VTPEE
Sbjct  287  QPMLLELGKQNPHLMQLIQAHQADFLRLINEPVEGGGEGNLLGQLGSAAMPQAVTVTPEE  346

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            REAIERLEAMGF+RALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  347  REAIERLEAMGFERALVLEVYFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QP+LQELGKQNP +++LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E E
Sbjct  287  QPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENE  346

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  347  AIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  388



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QP+LQELGKQNP +++LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E E
Sbjct  286  QPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  346  AIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLLDHMNEFDD  387



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQA+FL+LINEP+EG EG+I  Q    MP A+ VTPEE+E
Sbjct  320  QPMLQELGKQNPQLLRLIQEHQAEFLQLINEPLEGSEGDIFDQPEQDMPHAINVTPEEQE  379

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E + AC++NEELAANYLL+H  +FED
Sbjct  380  AIERLEAMGFDRALVIEAYLACDRNEELAANYLLEHAGDFED  421



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQEL KQNP L+RLIQEHQA+FL+LINEP EG EG++ GQ    MPQ++ VTPEERE
Sbjct  269  QPMLQELSKQNPQLLRLIQEHQAEFLQLINEPAEGAEGDLFGQAEQDMPQSITVTPEERE  328

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  329  AIERLEAMGFDRALVIEAFLACDRNEELAINYLLENPGDYED  370



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQEL KQNP LMRLIQ+HQA+FL LINE  EG   ++LGQ AA MPQ++ VTPEERE
Sbjct  292  QPMLQELSKQNPQLMRLIQDHQAEFLHLINEETEG---DLLGQFAAEMPQSINVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  349  AIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQEL KQNP LMRLIQ+HQA+FL LINE  +G   ++LGQ AA MPQ++ VTPEERE
Sbjct  292  QPMLQELSKQNPQLMRLIQDHQAEFLHLINEETDG---DLLGQFAAEMPQSINVTPEERE  348

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  349  AIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEER  428
            QP+LQELGKQNP +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE 
Sbjct  286  QPLLQELGKQNPQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEEN  345

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI RLEAMGFDRALVL+VFFACNK+E+LAANYLLDHM+EF+D
Sbjct  346  EAILRLEAMGFDRALVLDVFFACNKDEQLAANYLLDHMNEFDD  388



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+E
Sbjct  216  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQE  275

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  276  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENGGDFED  317



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  286  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  345

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  346  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  387



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+E
Sbjct  272  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQDMPHAINVTPAEQE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  332  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  373



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  287  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  346

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  347  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  388



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  272  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  332  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  373



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  273  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  332

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  333  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  374



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QP+LQELGKQNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE 
Sbjct  289  QPLLQELGKQNPQILQLIQDNQAEFLRLINEPAEGDEDENLLDQFAEGVPQTIAVTPEEN  348

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI RLE MGFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  349  EAILRLEGMGFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  391



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP AV VTP E+E
Sbjct  261  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAVNVTPAEQE  320

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  321  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>ref|XP_001763027.1| predicted protein [Physcomitrella patens]
 gb|EDQ72232.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEP-VEGGEGNILGQLAASMPQAVQVTPEER  428
            QPMLQELGKQNP L+RLI ++QA+FLRLINE   EG EG+ILGQLA +MPQ++ VTPEER
Sbjct  267  QPMLQELGKQNPALLRLINDNQAEFLRLINEAGAEGAEGDILGQLAGAMPQSINVTPEER  326

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI+RLE MGF+R LV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  327  EAIDRLEGMGFERTLVIEAFLACDKNEQLAANYLLEHAGDYED  369



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+E
Sbjct  261  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQE  320

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  321  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas]
Length=352

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH A+FL+LINEP+EG EG+I  Q+   MP A+ VTP E+E
Sbjct  251  QPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLEGSEGDIFDQVDQDMPHAINVTPAEQE  310

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  311  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  352



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQ +FL+LINEPV+G EG++  Q    MP A+ VTP E+E
Sbjct  200  QPMLQELGKQNPQLLRLIQEHQTEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQE  259

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  260  AIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  301



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEHQA+FL+LINEPV+G EG++  Q    MP A+ VTP E+E
Sbjct  276  QPMLQELGKQNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQE  335

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  336  AIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  377



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  272  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  332  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+E
Sbjct  195  QPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQE  254

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  255  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  296



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  204  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQE  263

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  264  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED  305



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEER  428
            QP+LQELGKQNP +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE 
Sbjct  286  QPLLQELGKQNPQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEED  345

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI RLE MGFDRALVL+VFFACNK+E+LAANYLLDHM+EF D
Sbjct  346  EAILRLEPMGFDRALVLDVFFACNKDEQLAANYLLDHMNEFAD  388



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+E
Sbjct  266  QPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQE  325

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  326  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+E
Sbjct  265  QPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQE  324

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  325  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  366



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+E
Sbjct  270  QPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDMFDQPDQEMPHAINVTPAEQE  329

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  330  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  371



>gb|AAD34676.1|AC006341_4 Similar to gb|Y12014 RAD23 protein isoform II from Daucus carota. 
This gene is probably cut off. EST gb|AA651284 comes from 
this gene [Arabidopsis thaliana]
Length=113

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP L+RLIQE+QA+FL+L+NEP EG +G+  I  Q    MP +V VTPEE
Sbjct  10   QPMLQELGKQNPQLLRLIQENQAEFLQLLNEPYEGSDGDVDIFDQPDQEMPHSVNVTPEE  69

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            +E+IERLEAMGFDRA+V+E F +C++NEELAANYLL+H  +FED
Sbjct  70   QESIERLEAMGFDRAIVIEAFLSCDRNEELAANYLLEHSADFED  113



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q    +P A+ VTP E+E
Sbjct  310  QPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQPEQELPHAINVTPAEQE  369

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  370  AIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED  411



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q    +P A+ VTP E+E
Sbjct  298  QPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQPEQELPHAINVTPAEQE  357

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  358  AIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED  399



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  257  QPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  316

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  317  AIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  358



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  271  QPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  330

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  331  AIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>ref|XP_009797065.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+E
Sbjct  266  QPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQE  325

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  326  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  271  QPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQE  330

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  331  AIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>gb|EMT30328.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=456

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QP+LQELGKQNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE 
Sbjct  331  QPLLQELGKQNPQILQLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEEN  390

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI RLE MGFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  391  EAILRLEGMGFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  433



>ref|XP_009797063.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797064.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V VTP+E+E
Sbjct  267  QPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSVTPQEQE  326

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  327  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  368



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG---GEGNILGQLAASMPQAVQVTPE  434
            QP+LQELGKQNP +M+LIQE+QA+F+RLINEP+EG    E N+L Q+A +  + + VTPE
Sbjct  281  QPLLQELGKQNPQVMQLIQENQAEFMRLINEPLEGDEENEMNMLDQIADAA-ETIAVTPE  339

Query  433  EREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            E EAI RLE MGFDRALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  340  ENEAILRLEGMGFDRALVLEVFFACNKNEQLAANYLLDHMHEFDN  384



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPML ELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+E
Sbjct  272  QPMLLELGKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQE  331

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  332  AIERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 5/102 (5%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQELGKQNPHLM+LIQEHQ+DFL LINEP EG E      LAA M QA+ VTPEE E
Sbjct  280  QPMLQELGKQNPHLMQLIQEHQSDFLNLINEP-EGEEN----PLAAGMTQAITVTPEEDE  334

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AI+RLE MGFDR LVLEVF ACN+NE+LAANYLLDH +EF+D
Sbjct  335  AIQRLEDMGFDRDLVLEVFIACNRNEDLAANYLLDHQNEFDD  376



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEER  428
            QP+LQELGKQNP +++LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE 
Sbjct  289  QPLLQELGKQNPQILQLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEEN  348

Query  427  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            EAI RLE MGFDRALVLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  349  EAILRLEGMGFDRALVLEVYFACNKDETLAANYLLDHMNEFDD  391



>ref|XP_002890153.1| hypothetical protein ARALYDRAFT_312599 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66412.1| hypothetical protein ARALYDRAFT_312599 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEE  431
            QPMLQELGKQNP L+RLIQE+QA+FL+L+NEP EG +G+  I  Q    MP AV VTPEE
Sbjct  261  QPMLQELGKQNPQLLRLIQENQAEFLQLLNEPYEGSDGDMDIFDQPEQEMPHAVNVTPEE  320

Query  430  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            +EAI+RLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  321  QEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLEHSADFED  364



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  604  QPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEERE  425
            QPMLQEL KQNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+E
Sbjct  277  QPMLQELSKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQE  336

Query  424  AIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  299
            AIERLEAMGFDRALV+E F AC++NEELA NYLL++  +FED
Sbjct  337  AIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED  378



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370