BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF041A09

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU17965.1|  unknown                                                 212   3e-65   Glycine max [soybeans]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    223   3e-65   Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   219   1e-63   Solanum lycopersicum
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    219   1e-63   Nicotiana sylvestris
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    218   2e-63   Solanum lycopersicum
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    218   3e-63   Nicotiana tomentosiformis
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        216   2e-62   Morus notabilis
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       214   2e-62   Glycine soja [wild soybean]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    215   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    213   4e-62   Glycine max [soybeans]
gb|AFS65092.1|  DnaK-type molecular chaperone hsp70                     201   5e-62   Elaeis guineensis
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     214   8e-62   Glycine soja [wild soybean]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    214   8e-62   Glycine max [soybeans]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     214   9e-62   Glycine soja [wild soybean]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         212   3e-61   Jatropha curcas
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    212   4e-61   Nelumbo nucifera [Indian lotus]
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   204   7e-61   Citrus sinensis [apfelsine]
gb|ACA23466.1|  heat shock protein 70                                   198   8e-61   Arachis diogoi
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    205   1e-60   Eucalyptus grandis [rose gum]
gb|ABK55692.1|  heat shock protein 70 isoform-1                         196   2e-60   Cucumis sativus [cucumbers]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             209   3e-60   Phaseolus vulgaris [French bean]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         209   3e-60   Jatropha curcas
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                209   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    209   5e-60   Solanum tuberosum [potatoes]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     209   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    199   5e-60   Elaeis guineensis
gb|EAY81899.1|  hypothetical protein OsI_37065                          204   6e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             208   7e-60   Phaseolus vulgaris [French bean]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    208   1e-59   Phoenix dactylifera
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    208   1e-59   Cicer arietinum [garbanzo]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     207   2e-59   Elaeis guineensis
ref|XP_002316294.1|  heat shock protein 70                              207   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    207   2e-59   Populus euphratica
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    207   2e-59   Fragaria vesca subsp. vesca
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     207   2e-59   
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    207   3e-59   Glycine max [soybeans]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    207   3e-59   Phoenix dactylifera
gb|KJB16980.1|  hypothetical protein B456_002G258500                    206   3e-59   Gossypium raimondii
gb|ACJ11741.1|  heat shock protein 70                                   207   3e-59   Gossypium hirsutum [American cotton]
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    205   4e-59   Oryza sativa Japonica Group [Japonica rice]
emb|CCJ09763.1|  putative heat shock protein-70kDa                      196   4e-59   Hirudo medicinalis
ref|XP_006378714.1|  heat shock protein 70 cognate                      206   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    206   5e-59   Populus euphratica
gb|KJB16979.1|  hypothetical protein B456_002G258500                    206   5e-59   Gossypium raimondii
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    205   8e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AAA82974.1|  HSP70b                                                  193   9e-59   Pisum sativum [garden pea]
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             205   1e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    205   1e-58   Citrus sinensis [apfelsine]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             205   1e-58   Citrus clementina [clementine]
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             205   1e-58   Capsella rubella
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       205   1e-58   Phaseolus vulgaris [French bean]
ref|XP_007009369.1|  Heat shock protein 70                              205   2e-58   
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          204   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    204   2e-58   Nicotiana sylvestris
gb|ABK94007.1|  unknown                                                 191   2e-58   Populus trichocarpa [western balsam poplar]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    205   2e-58   Gossypium raimondii
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     204   2e-58   
ref|NP_001068540.1|  Os11g0703900                                       204   2e-58   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    204   2e-58   Oryza brachyantha
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    204   2e-58   Elaeis guineensis
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    204   2e-58   
tpg|DAA44672.1|  TPA: hsp70 protein                                     202   2e-58   
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             204   2e-58   Phaseolus vulgaris [French bean]
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       203   3e-58   Gossypium arboreum [tree cotton]
emb|CDP00073.1|  unnamed protein product                                204   3e-58   Coffea canephora [robusta coffee]
gb|EAY98319.1|  hypothetical protein OsI_20227                          199   3e-58   Oryza sativa Indica Group [Indian rice]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     204   4e-58   Vigna radiata [mung bean]
dbj|BAD02271.1|  heat shock protein 70                                  190   5e-58   Nicotiana benthamiana
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    203   5e-58   Fragaria vesca subsp. vesca
gb|AAB65162.1|  heat shock cognate protein                              196   6e-58   Solanum commersonii
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     203   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          202   9e-58   
ref|NP_187864.1|  heat shock protein 70-4                               202   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAA47948.2|  heat shock protein 70                                  202   1e-57   Oryza sativa Indica Group [Indian rice]
emb|CAA05547.1|  heat shock protein 70                                  202   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    202   1e-57   Gossypium raimondii
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    202   1e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                202   1e-57   Zea mays [maize]
gb|AEP40944.1|  heat shock protein 70 family protein                    191   1e-57   Posidonia oceanica
gb|ABD32895.1|  Heat shock protein Hsp70                                202   1e-57   Medicago truncatula
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    202   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     202   1e-57   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     202   2e-57   Phoenix dactylifera
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                202   2e-57   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          202   2e-57   Sorghum bicolor [broomcorn]
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    200   3e-57   
gb|AAP04522.1|  heat shock protein 70                                   201   3e-57   Nicotiana tabacum [American tobacco]
gb|AAR17080.1|  heat shock protein 70-3                                 201   3e-57   Nicotiana tabacum [American tobacco]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    201   4e-57   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    201   4e-57   Nicotiana tomentosiformis
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    201   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    201   5e-57   Fragaria vesca subsp. vesca
ref|XP_003625487.1|  Heat shock protein                                 202   5e-57   
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    201   5e-57   Solanum lycopersicum
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    201   6e-57   Elaeis guineensis
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    201   6e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001049719.2|  Os03g0277300                                       195   6e-57   
gb|EAY89457.1|  hypothetical protein OsI_10990                          196   7e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_001055754.1|  Os05g0460000                                       200   7e-57   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    200   8e-57   Cicer arietinum [garbanzo]
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    200   1e-56   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     201   1e-56   Triticum urartu
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    199   1e-56   Nicotiana tomentosiformis
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    199   1e-56   
emb|CAA83548.1|  PsHSC71.0                                              199   2e-56   Pisum sativum [garden pea]
gb|AII99890.1|  heat shock protein                                      200   2e-56   Cicer arietinum [garbanzo]
gb|AIU34470.1|  putative heat shock protein                             199   3e-56   Taraxacum brevicorniculatum
ref|XP_002311161.1|  heat shock protein 70                              199   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     199   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    199   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    199   3e-56   Pyrus x bretschneideri [bai li]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     198   3e-56   Triticum urartu
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     198   4e-56   
gb|AFK37867.1|  unknown                                                 185   5e-56   Lotus japonicus
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    198   5e-56   
ref|XP_002528432.1|  heat shock protein, putative                       198   5e-56   Ricinus communis
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    198   6e-56   Tarenaya hassleriana [spider flower]
ref|NP_001140835.1|  uncharacterized protein LOC100272911               196   7e-56   Zea mays [maize]
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     197   7e-56   Brachypodium distachyon [annual false brome]
gb|EAY89450.1|  hypothetical protein OsI_10982                          193   9e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     197   9e-56   Sesamum indicum [beniseed]
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    197   1e-55   Setaria italica
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    197   1e-55   Solanum lycopersicum
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    197   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       197   1e-55   Cucumis melo [Oriental melon]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    197   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     197   1e-55   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    197   1e-55   Fragaria vesca subsp. vesca
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    197   1e-55   Sesamum indicum [beniseed]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     198   1e-55   Triticum urartu
dbj|BAK00257.1|  predicted protein                                      197   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        197   2e-55   Solanum lycopersicum
gb|AAV98051.1|  heat shock protein 70                                   197   2e-55   Medicago sativa [alfalfa]
ref|XP_003621886.1|  Heat shock protein                                 197   2e-55   Medicago truncatula
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     196   2e-55   Fragaria vesca subsp. vesca
gb|AEO13403.1|  heat shock 70                                           195   2e-55   Glycine max [soybeans]
tpg|DAA55190.1|  TPA: heat shock protein70-4                            194   2e-55   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    196   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    196   2e-55   Zea mays [maize]
gb|EPS68565.1|  hypothetical protein M569_06198                         196   2e-55   Genlisea aurea
gb|ACJ54890.1|  heat shock protein 70                                   196   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    197   2e-55   
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    196   2e-55   Solanum tuberosum [potatoes]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     196   2e-55   Glycine max [soybeans]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       196   3e-55   Glycine soja [wild soybean]
dbj|BAJ91305.1|  predicted protein                                      196   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     196   3e-55   Vitis vinifera
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     196   4e-55   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       196   4e-55   Cenchrus americanus [bulrush millet]
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    196   4e-55   Sesamum indicum [beniseed]
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    196   4e-55   Arabis alpina [alpine rockcress]
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   5e-55   Populus euphratica
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             195   5e-55   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   5e-55   Brachypodium distachyon [annual false brome]
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   5e-55   Glycine max [soybeans]
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   5e-55   
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    195   5e-55   Prunus mume [ume]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   6e-55   Cucumis sativus [cucumbers]
gb|ACJ85522.1|  unknown                                                 195   6e-55   Medicago truncatula
gb|ADD64906.1|  heat shock protein-like protein                         182   6e-55   Tragopogon dubius [yellow salsify]
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     188   7e-55   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    195   7e-55   Populus euphratica
ref|XP_009784010.1|  PREDICTED: heat shock cognate 70 kDa protein...    182   7e-55   Nicotiana sylvestris
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    195   7e-55   
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     194   9e-55   Prunus mume [ume]
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    194   9e-55   Setaria italica
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             194   1e-54   Prunus persica
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    184   1e-54   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    194   1e-54   Solanum tuberosum [potatoes]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    194   1e-54   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    194   1e-54   Solanum lycopersicum
gb|AGR45355.1|  HSP70                                                   194   1e-54   Dendrobium officinale
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     194   1e-54   Vigna radiata [mung bean]
gb|AHW48175.1|  heat shock protein 70                                   192   2e-54   Triticum aestivum [Canadian hard winter wheat]
gb|AEO22185.1|  CytHSP70                                                192   2e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    194   2e-54   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    194   2e-54   Tarenaya hassleriana [spider flower]
dbj|BAA34919.1|  heat shock protein 70 cognate                          189   2e-54   Salix gilgiana
ref|NP_001049712.1|  Os03g0276500                                       194   2e-54   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     194   2e-54   Triticum urartu
gb|ACB70177.1|  70 kDa heat shock protein                               193   3e-54   Capparis spinosa [caper]
gb|AAB99745.1|  HSP70                                                   193   3e-54   Triticum aestivum [Canadian hard winter wheat]
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     197   3e-54   
gb|ACM42161.1|  heat shock protein 70.58                                193   3e-54   Ageratina adenophora
emb|CAA67588.1|  70 kD heatshockprotein                                 183   4e-54   Medicago sativa [alfalfa]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    193   4e-54   Zea mays [maize]
gb|ACJ11745.1|  heat shock protein 70                                   193   4e-54   Gossypium hirsutum [American cotton]
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    192   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    192   5e-54   Cicer arietinum [garbanzo]
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          192   5e-54   Sorghum bicolor [broomcorn]
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    190   6e-54   Populus euphratica
gb|AAB88009.1|  heat shock cognate protein HSC70                        192   6e-54   Brassica napus [oilseed rape]
emb|CDY40362.1|  BnaA10g27060D                                          189   6e-54   Brassica napus [oilseed rape]
dbj|BAJ86014.1|  predicted protein                                      192   7e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT97046.1|  heat shock protein 70                                   192   7e-54   Capsicum annuum
gb|ACJ11742.1|  heat shock protein 70                                   192   7e-54   Gossypium hirsutum [American cotton]
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   7e-54   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             192   7e-54   Citrus clementina [clementine]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     193   8e-54   Eucalyptus grandis [rose gum]
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    182   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    192   9e-54   Setaria italica
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     192   9e-54   Vitis vinifera
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     192   1e-53   Petunia x hybrida [garden petunia]
gb|KJB20110.1|  hypothetical protein B456_003G133400                    192   1e-53   Gossypium raimondii
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    192   1e-53   Petunia x hybrida [garden petunia]
gb|ABP01597.1|  heat shock protein 70                                   184   1e-53   Ageratina adenophora
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     191   1e-53   Populus euphratica
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             191   1e-53   Citrus clementina [clementine]
gb|AFU34347.1|  70-kDa heat shock protein                               191   1e-53   Ipomoea batatas [batate]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   1e-53   Brachypodium distachyon [annual false brome]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         191   1e-53   Jatropha curcas
gb|ABP35942.1|  heat shock protein 70                                   191   2e-53   Cyclamen persicum
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    191   2e-53   Phoenix dactylifera
ref|XP_002527736.1|  heat shock protein, putative                       191   2e-53   Ricinus communis
emb|CAA55183.1|  heat shock protein 70 kDa                              181   2e-53   Zea mays [maize]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             191   2e-53   Phaseolus vulgaris [French bean]
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   
emb|CDP09040.1|  unnamed protein product                                191   2e-53   Coffea canephora [robusta coffee]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   Phoenix dactylifera
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   Cucumis melo [Oriental melon]
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          191   2e-53   Amborella trichopoda
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   Solanum tuberosum [potatoes]
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   Pyrus x bretschneideri [bai li]
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  181   2e-53   Citrus sinensis [apfelsine]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   2e-53   
gb|ADZ46371.1|  HSP70                                                   191   2e-53   Malus hupehensis
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     191   2e-53   Vitis vinifera
ref|XP_002312090.1|  heat shock protein 70 cognate                      191   2e-53   Populus trichocarpa [western balsam poplar]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                191   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             191   2e-53   Populus trichocarpa [western balsam poplar]
emb|CAA82915.1|  heat shock protein 70                                  178   2e-53   Trifolium repens [creeping white clover]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    191   3e-53   
emb|CAB72129.1|  heat shock protein 70                                  191   3e-53   Cucumis sativus [cucumbers]
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       191   3e-53   Solanum lycopersicum
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    190   3e-53   Phoenix dactylifera
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    190   3e-53   Solanum tuberosum [potatoes]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        190   3e-53   Solanum lycopersicum
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                190   3e-53   
ref|XP_002312089.1|  heat shock protein 70 cognate                      190   3e-53   
gb|AAP42157.1|AF509339_1  heat shock protein 70                         186   3e-53   Saussurea medusa
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    190   4e-53   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     191   4e-53   Triticum urartu
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    190   4e-53   Solanum tuberosum [potatoes]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    190   4e-53   Populus euphratica
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     190   4e-53   Nicotiana sylvestris
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           190   4e-53   Cucurbita maxima [Boston marrow]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       190   5e-53   Medicago truncatula
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    190   5e-53   Brassica rapa
gb|EEC71767.1|  hypothetical protein OsI_04375                          186   6e-53   Oryza sativa Indica Group [Indian rice]
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     190   6e-53   Vigna radiata [mung bean]
emb|CDX73815.1|  BnaA03g32320D                                          190   6e-53   
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         189   6e-53   Jatropha curcas
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    192   6e-53   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    190   6e-53   Oryza brachyantha
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          179   6e-53   Prunus dulcis [sweet almond]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       189   7e-53   Nicotiana tomentosiformis
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    189   7e-53   
emb|CAB72130.1|  heat shock protein 70                                  189   7e-53   Cucumis sativus [cucumbers]
gb|ACJ11740.1|  heat shock protein 70                                   189   7e-53   Gossypium hirsutum [American cotton]
emb|CDY00784.1|  BnaC03g37680D                                          189   8e-53   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    189   8e-53   Brassica rapa
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       189   9e-53   Glycine soja [wild soybean]
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     189   9e-53   Nicotiana tomentosiformis
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    189   1e-52   
ref|XP_003621869.1|  Heat shock protein                                 189   1e-52   Medicago truncatula
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       188   1e-52   Phytolacca acinosa [food pokeberry]
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    189   1e-52   
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     189   1e-52   Cucumis melo [Oriental melon]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    189   1e-52   
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    189   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       189   1e-52   Triticum urartu
dbj|BAD94875.1|  heat-shock protein                                     177   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       188   1e-52   Medicago truncatula
emb|CDY52661.1|  BnaC01g38510D                                          189   1e-52   Brassica napus [oilseed rape]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    183   2e-52   Arabis alpina [alpine rockcress]
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    189   2e-52   Solanum tuberosum [potatoes]
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             188   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     188   2e-52   Eucalyptus grandis [rose gum]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     189   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    188   2e-52   
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       188   2e-52   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    188   2e-52   
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       188   2e-52   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             188   2e-52   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             188   2e-52   
ref|XP_002532297.1|  heat shock protein, putative                       188   3e-52   
gb|KJB46580.1|  hypothetical protein B456_007G375600                    188   3e-52   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       188   3e-52   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         187   4e-52   
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    187   4e-52   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       187   4e-52   
gb|ADD71975.1|  heat shock protein 70                                   187   4e-52   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    187   4e-52   
emb|CDY50531.1|  BnaA01g30490D                                          187   4e-52   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                187   4e-52   
gb|AAV97978.1|  heat shock protein hsp70                                187   4e-52   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         187   5e-52   
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       187   5e-52   
gb|AGL07711.1|  heat shock protein 70                                   187   5e-52   
gb|ACR38891.1|  heat shock protein 70                                   187   5e-52   
gb|KHN17505.1|  Heat shock 70 kDa protein                               185   5e-52   
gb|AEX55235.1|  heat shock protein 70                                   182   5e-52   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    191   5e-52   
gb|AAX07349.1|  heat shock protein 70                                   182   7e-52   
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    187   7e-52   
dbj|BAD22854.1|  heat shock protein 70                                  182   7e-52   
gb|AFA51946.1|  heat shock protein 70                                   186   8e-52   
dbj|BAP90755.1|  heat shock protein 70                                  186   8e-52   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             186   8e-52   
ref|NP_001044757.1|  Os01g0840100                                       186   9e-52   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             186   9e-52   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    186   1e-51   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                186   1e-51   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    186   1e-51   
ref|WP_039310754.1|  molecular chaperone DnaK                           186   1e-51   
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           182   1e-51   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          185   1e-51   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    186   1e-51   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        186   1e-51   
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    186   1e-51   
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    184   1e-51   
gb|ABX76301.1|  heat shock protein 70                                   186   1e-51   
gb|ACD93209.1|  heat shock protein 70                                   186   2e-51   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    186   2e-51   
emb|CDP09035.1|  unnamed protein product                                186   2e-51   
emb|CAA55184.1|  heat shock protein 70 kDa                              176   2e-51   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    186   2e-51   
ref|XP_002873056.1|  HSC70-1                                            185   2e-51   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               185   2e-51   
emb|CAA54419.1|  heat shock cognate 70-1                                185   2e-51   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  185   2e-51   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             185   2e-51   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             185   2e-51   
gb|AEK70336.1|  heat shock protein 70                                   185   3e-51   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    185   3e-51   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    185   3e-51   
ref|NP_195870.1|  heat shock cognate protein 70-1                       185   3e-51   
emb|CAA52684.1|  heat shock protein 70 cognate                          185   3e-51   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    185   3e-51   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    185   3e-51   
gb|AIA22210.1|  heat shock protein 70                                   185   3e-51   
ref|XP_002873055.1|  predicted protein                                  185   3e-51   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          185   3e-51   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    185   3e-51   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             185   3e-51   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    185   3e-51   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        185   3e-51   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    185   3e-51   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          185   4e-51   
gb|AAA62445.1|  heat shock protein                                      184   4e-51   
gb|EEC76425.1|  hypothetical protein OsI_14101                          181   4e-51   
emb|CDX93666.1|  BnaA06g03820D                                          176   5e-51   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    184   5e-51   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             184   6e-51   
gb|AIZ68155.1|  heat shock protein 70                                   184   7e-51   
ref|NP_195869.1|  heat shock protein 70                                 184   7e-51   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    184   7e-51   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    184   7e-51   
gb|EPS60056.1|  heat shock protein 70                                   184   9e-51   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    183   1e-50   
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    177   1e-50   
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    183   1e-50   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             183   1e-50   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    183   2e-50   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    182   2e-50   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             182   2e-50   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    182   2e-50   
ref|XP_001783063.1|  predicted protein                                  173   2e-50   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             182   3e-50   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    182   3e-50   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                182   3e-50   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    182   3e-50   
ref|XP_006408646.1|  hypothetical protein EUTSA_v10002169mg             181   3e-50   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          182   3e-50   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             182   3e-50   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    182   4e-50   
ref|NP_001051724.1|  Os03g0821100                                       182   4e-50   
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             181   5e-50   
gb|ABX26256.1|  heat shock protein 70-like protein                      169   5e-50   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             181   7e-50   
dbj|BAJ34054.1|  unnamed protein product                                181   8e-50   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             181   9e-50   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        181   9e-50   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    181   9e-50   
ref|XP_002512742.1|  heat shock protein, putative                       181   1e-49   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    180   1e-49   
gb|KJB36734.1|  hypothetical protein B456_006G174000                    181   1e-49   
gb|ACC93947.1|  heat-shock protein 70                                   181   1e-49   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               181   1e-49   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   180   1e-49   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    180   1e-49   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    180   2e-49   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       180   2e-49   
ref|NP_001119156.1|  heat shock cognate protein 70-1                    178   2e-49   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    180   2e-49   
ref|XP_002512741.1|  heat shock protein, putative                       180   2e-49   
ref|NP_187555.1|  heat shock protein 70-3                               180   2e-49   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    180   2e-49   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    179   2e-49   
emb|CAA44820.1|  heat shock protein 70                                  179   3e-49   
ref|XP_003610287.1|  Heat-shock protein                                 179   3e-49   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             179   3e-49   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             179   3e-49   
dbj|BAK02194.1|  predicted protein                                      179   4e-49   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    179   4e-49   
gb|ACH61066.1|  heat shock protein 70 kDa                               170   4e-49   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       179   5e-49   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          179   6e-49   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          178   7e-49   
gb|ACD45076.1|  heat-shock protein 70                                   178   8e-49   
gb|AAA82975.1|  PsHSP71.2                                               178   1e-48   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    178   1e-48   
gb|KHN14134.1|  Heat shock 70 kDa protein                               178   1e-48   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    180   1e-48   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        177   1e-48   
gb|EPS64948.1|  hypothetical protein M569_09829                         177   1e-48   
emb|CDY49668.1|  BnaC06g01970D                                          176   2e-48   
gb|AAP33015.1|  HSP70                                                   164   2e-48   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               177   2e-48   
gb|ACH61090.1|  heat shock protein 70 kDa                               168   2e-48   
ref|XP_001767839.1|  predicted protein                                  177   2e-48   
ref|XP_001759874.1|  predicted protein                                  177   3e-48   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          176   3e-48   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       176   3e-48   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    176   3e-48   
gb|ABK25453.1|  unknown                                                 176   4e-48   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          176   4e-48   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    175   4e-48   
gb|AAS09825.1|  heat shock cognate protein 70                           176   5e-48   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               176   6e-48   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          176   6e-48   
ref|XP_001783048.1|  predicted protein                                  176   6e-48   
emb|CAA27330.1|  heat shock protein 70                                  175   7e-48   
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    174   8e-48   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     176   9e-48   
prf||1205208A  heat shock protein hsp70                                 175   1e-47
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        175   1e-47   
gb|KDO37859.1|  hypothetical protein CISIN_1g041209mg                   171   1e-47   
ref|XP_001785822.1|  predicted protein                                  174   2e-47   
ref|XP_007013854.1|  Heat shock protein 70B                             174   2e-47   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   174   2e-47   
ref|XP_001751923.1|  predicted protein                                  174   2e-47   
emb|CDO98244.1|  unnamed protein product                                174   3e-47   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       173   5e-47   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             173   5e-47   
gb|ABR18415.1|  unknown                                                 173   6e-47   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               172   1e-46   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          172   1e-46   
ref|NP_173055.1|  heat shock protein 70B                                172   1e-46   
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        164   2e-46   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          172   2e-46   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          172   2e-46   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          171   2e-46   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             171   3e-46   
gb|ADB85350.1|  putative heat shock cognate                             171   3e-46   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          171   3e-46   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             171   3e-46   
dbj|BAJ34597.1|  unnamed protein product                                171   3e-46   
gb|AIU40169.1|  heat shock protein 70                                   171   5e-46   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          170   6e-46   
ref|XP_007023492.1|  Heat shock protein 70B                             170   6e-46   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     170   6e-46   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          170   6e-46   
ref|XP_002502667.1|  heat shock 70 kDa protein                          170   7e-46   
emb|CEG00633.1|  Heat shock protein 70 family                           170   7e-46   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               169   1e-45   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          169   1e-45   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             169   1e-45   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    169   2e-45   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    169   2e-45   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          169   2e-45   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    169   2e-45   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         169   2e-45   
ref|XP_003064239.1|  heat shock protein 70kDa                           168   2e-45   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               168   3e-45   
ref|XP_009123001.1|  PREDICTED: probable mediator of RNA polymera...    157   3e-45   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               168   3e-45   
emb|CDY70331.1|  BnaAnng33370D                                          156   5e-45   
emb|CDP02832.1|  unnamed protein product                                167   6e-45   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               167   6e-45   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               167   9e-45   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    167   9e-45   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         166   1e-44   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    167   1e-44   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             166   1e-44   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             166   1e-44   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   166   1e-44   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    166   2e-44   
ref|XP_001781229.1|  predicted protein                                  166   2e-44   
emb|CDY33359.1|  BnaC05g12240D                                          165   2e-44   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          166   2e-44   
emb|CDY35063.1|  BnaA06g10730D                                          164   2e-44   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               166   3e-44   
ref|XP_008352210.1|  PREDICTED: heat shock 70 kDa protein-like          159   3e-44   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    165   3e-44   
emb|CDX83960.1|  BnaC08g16850D                                          165   3e-44   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          165   3e-44   
dbj|BAD02273.1|  heat shock protein 70                                  154   4e-44   
emb|CCD74508.1|  early-responsive to dehydration 2                      164   5e-44   
gb|AFG26330.1|  heat shock protein 70                                   153   6e-44   



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENY+YNMRNTIKDEKI  KL P DKKK
Sbjct  101  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIKDEKIGGKLDPADKKK  160

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQL EADEFEDKMKELESICNPIIAKMYQGGAGPDV   MD+D   
Sbjct  161  IEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAMDDD---  217

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  218  --VPAAGSGAGPKIEEVD  233



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL PD+KKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED++EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPD+A GMDED
Sbjct  576  IEDSVEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDMAGGMDED  632



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL PD+KKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED++EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG AGPD+A GMDED
Sbjct  576  IEDSVEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGRAGPDMAGGMDED  632



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 125/139 (90%), Gaps = 5/139 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GGAGPDVAAGMDEDgp  216
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ GGAGPD+A GMDED  
Sbjct  576  IEDAIDQAISWLDANQLAEADEFEDKMKELESICNPIIAKMYQDGGAGPDMAGGMDED--  633

Query  215  saggsgtgtgagPKIEEVD  159
              G S   +GAGPKIEEVD
Sbjct  634  --GPSAGASGAGPKIEEVD  650



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 115/118 (97%), Gaps = 1/118 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL PD+KKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA-GPDVAAGMDED  222
            IED++EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA GPD+A GMDED
Sbjct  576  IEDSVEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGASGPDMAGGMDED  633



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 125/138 (91%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI++AI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAGPD+A GMDED   
Sbjct  576  IEDAIDEAISWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGPDMAGGMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
             G S   +GAGPKIEEVD
Sbjct  632  -GPSAGASGAGPKIEEVD  648



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 123/139 (88%), Gaps = 4/139 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KDEKISSKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKISSKLSPSDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV-AAGMDEDgp  216
            IEDAI+ AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  GPDV  AGMDED  
Sbjct  576  IEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGPDVGGAGMDED--  633

Query  215  saggsgtgtgagPKIEEVD  159
                   G+GAGPKIEEVD
Sbjct  634  -DVPPAGGSGAGPKIEEVD  651



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENY+YNMRNTIKDEKI  KL P DKKK
Sbjct  453  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIKDEKIGGKLDPADKKK  512

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQL EADEFEDKMKELESICNPIIAKMYQGGAGPDV   MD+D   
Sbjct  513  IEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAMDDD---  569

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  570  --VPAAGSGAGPKIEEVD  585



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 4/140 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTI+DEKI SKL+P+DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGSKLKPEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIA+MYQGGAG D+  A GMD+D 
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAQMYQGGAGADMDGAGGMDDD-  634

Query  218  psaggsgtgtgagPKIEEVD  159
              A  +G G GAGPKIEEVD
Sbjct  635  -CAPSAGGGRGAGPKIEEVD  653



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  453  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKK  512

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLDGNQLAEADEFEDKMKELES CNPIIAKMYQG   PD+A GMDED   
Sbjct  513  IEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDED---  569

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  570  -VPPSGSGGAGPKIEEVD  586



>gb|AFS65092.1| DnaK-type molecular chaperone hsp70, partial [Elaeis guineensis]
Length=140

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTI+D+KI+SKL   DKKK
Sbjct  8    LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDDKIASKLPAADKKK  67

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDA+E+AIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ GAG DVA GMDED
Sbjct  68   IEDAVEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGADVAGGMDED  123



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG   PD+A GMDED   
Sbjct  576  IEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  -VPPSGSGGAGPKIEEVD  649



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG   PD+A GMDED   
Sbjct  576  IEDAIESAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  -VPPSGSGGAGPKIEEVD  649



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLDGNQLAEADEFEDKMKELES CNPIIAKMYQG   PD+A GMDED   
Sbjct  576  IEDAIESAIQWLDGNQLAEADEFEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  -VPPSGSGGAGPKIEEVD  649



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ G+GPD+A GMDED   
Sbjct  576  IEDAIEQAIHWLDANQLAEADEFEDKMKELESICNPIIAKMYQ-GSGPDMAGGMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  632  -APPAGGSSAGPKIEEVD  648



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 124/138 (90%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNT+KDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAGPD  AGMDED   
Sbjct  576  IEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGPDAGAGMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
             G S  GTGAGPKIEEVD
Sbjct  632  -GPSVGGTGAGPKIEEVD  648



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAED+EHKKKVEAKNALENYAYNMRNTIKDEKIS+KL   DKKK
Sbjct  197  LSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKK  256

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQGG G D  A MDED   
Sbjct  257  IEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGG-GADAGASMDED---  312

Query  212  aggsgtgtgagPKIEEVD  159
               +G G+GAGPKIEEVD
Sbjct  313  GPSAGAGSGAGPKIEEVD  330



>gb|ACA23466.1| heat shock protein 70 [Arachis diogoi]
Length=172

 Score =   198 bits (504),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN LENYAYNMRNTIKD+KISSKL P DK K
Sbjct  43   LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTIKDDKISSKLSPADKTK  102

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV  243
            I+DAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAG +V
Sbjct  103  IDDAIEQAIQWLDANQLAEADEFEDKMKELESICNPIIAKMYQGGAGGEV  152



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKIS+KL   DKKK
Sbjct  283  LSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKISAKLPAADKKK  342

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AI WLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ GAGPD+  GMDED   
Sbjct  343  IEDAIEEAIHWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGPDMGGGMDED---  398

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  399  -VPPAGGSGAGPKIEEVD  415



>gb|ABK55692.1| heat shock protein 70 isoform-1 [Cucumis sativus]
Length=117

 Score =   196 bits (497),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  8    LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  67

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGP  249
            IEDAIEQA+QWLD NQLAEADEFEDKMKELESICNPI+AKMYQG  GP
Sbjct  68   IEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQGAGGP  115



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 118/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLD NQL EADEFEDKMKELESICNPIIAKMYQG   PD+A GMDED   
Sbjct  576  IEDAIESAIQWLDTNQLGEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  -VPPSGSGGAGPKIEEVD  649



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLATDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAG DV   MD+D   
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADVGGSMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -VPPAGGSGAGPKIEEVD  648



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLGADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            +EDAIE AIQWLD NQL EADEFEDKMKELE ICNPIIAKMYQG  GPD+A GMDED   
Sbjct  576  VEDAIEGAIQWLDANQLGEADEFEDKMKELEGICNPIIAKMYQGSGGPDMAGGMDED-GP  634

Query  212  aggsgtgtgagPKIEEVD  159
               +G  +G GPKIEEVD
Sbjct  635  PSAAGGSSGPGPKIEEVD  652



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 113/117 (97%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL P++K+K
Sbjct  516  LSKDEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPEEKQK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED++EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA  D+A GMDED
Sbjct  576  IEDSVEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA--DMAGGMDED  630



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNT+KDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEADEF+DKMKELESICNPIIAKMYQ GAGPD+  GMD++   
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPIIAKMYQ-GAGPDMGGGMDDE---  631

Query  212  aggsgtgtgagPKIEEVD  159
             G S  G+GAGPKIEEVD
Sbjct  632  -GPSVGGSGAGPKIEEVD  648



>ref|XP_010911697.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Elaeis guineensis]
Length=238

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+Y++EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  106  LSKEEIEKMVQDAEKYESEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPASDKKK  165

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED IEQAIQWLDGNQLAEADEFEDKMKELESICNPIIA MYQ GAG D+A GMD+D
Sbjct  166  IEDPIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAGMYQ-GAGADMAGGMDDD  221



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  301  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  360

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  361  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  416

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  417  DAPPAGGSGAGPKIEEVD  434



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA+EQ IQWLD NQL EADEFEDKMKELES+CNPIIAKMYQGGAGPD+   MD+D   
Sbjct  576  IEDAVEQTIQWLDTNQLGEADEFEDKMKELESLCNPIIAKMYQGGAGPDMGGAMDDD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  --VPAGGSGAGPKIEEVD  648



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKL  DDKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWL+GNQLAEADEFEDKMKELE ICNPIIAKMYQ GAGPD+A GM++D   
Sbjct  576  IEDAIEQAIQWLEGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGPDMADGMNDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
               +  G+G+GPKIEEVD
Sbjct  632  -APAAGGSGSGPKIEEVD  648



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI SKL P+DKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            I+DAIE +IQWLD NQLAEADEFEDKMKELE +CNPIIAKMYQGG  PD+A GM++D   
Sbjct  576  IDDAIEASIQWLDSNQLAEADEFEDKMKELEGLCNPIIAKMYQGGGAPDMAGGMNDD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                   +GAGPKIEEVD
Sbjct  633  -VPPSGSSGAGPKIEEVD  649



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KD+KISSKL  +DKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLTAEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAG D+ AGM++D   
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADMGAGMNDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
               S  G+G+GPKIEEVD
Sbjct  632  -APSAGGSGSGPKIEEVD  648



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI S+L P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLD NQLAE DEFEDKMKELESICNPIIAKMYQ GAGPD+   MDED   
Sbjct  576  IEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPIIAKMYQ-GAGPDMGGSMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               S  G+GAGPKIEEVD
Sbjct  632  -IPSTGGSGAGPKIEEVD  648



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI S+L P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLD NQLAE DEFEDKMKELESICNPIIAKMYQ GAGPD+   MDED   
Sbjct  576  IEDAIDQAIQWLDSNQLAEVDEFEDKMKELESICNPIIAKMYQ-GAGPDMGGSMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               S  G+GAGPKIEEVD
Sbjct  632  -IPSTGGSGAGPKIEEVD  648



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 121/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDE+HKKKVEAKNALENYAYNMRNTIKD+KI+SK+ P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTIKDDKIASKIDPSDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGA PD++ G D D   
Sbjct  576  IEDAIEEAIHWLDNNQLAEADEFEDKMKELESLCNPIIAKMYQGGAAPDMSGGADAD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -VPPSGGSGAGPKIEEVD  649



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED I+QAIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQG  GPDV   MD+D   
Sbjct  576  IEDTIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGAGGPDVGGXMDDD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -VPXAGGSGAGPKIEEVD  649



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KD+KI  KL P DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV      +   
Sbjct  576  IEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAGAAEDEY  635

Query  212  aggsgtgtgagPKIEEVD  159
            A     G+GAGPKIEEVD
Sbjct  636  AAPPSGGSGAGPKIEEVD  653



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 3/118 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKK+EAKNALENYAYNMRNTIKDEKI++KL P DKKK
Sbjct  515  LSKEEIEKMVQEAEKYKAEDEEHKKKIEAKNALENYAYNMRNTIKDEKIAAKLPPADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG-GAGPDVAAGMDED  222
            IEDAIEQAI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQG GAG D  AGMDED
Sbjct  575  IEDAIEQAINWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGAGMD--AGMDED  630



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNT+KDEKI SKL PDDKKK
Sbjct  481  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVKDEKIGSKLSPDDKKK  540

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+   MDED   
Sbjct  541  IEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQ-GAGGDMGGSMDED---  596

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  597  -APPSGGSGAGPKIEEVD  613



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL PDDKK+
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPDDKKR  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+   MDED   
Sbjct  576  IEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQ-GAGGDMGGSMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPSGGSGAGPKIEEVD  648



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  411  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  470

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED
Sbjct  471  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED  526



>emb|CCJ09763.1| putative heat shock protein-70kDa, partial [Hirudo medicinalis]
Length=229

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  98   LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSAADKKK  157

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGP  249
            IED+IE AIQWL+GNQLAEADEFEDKMKELESICNPIIAKMY GGAGP
Sbjct  158  IEDSIESAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYSGGAGP  205



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLD NQLAEADEF+DKMKELESICNPIIAKMYQ GAGPD+  GMD+D   
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMYQ-GAGPDMGGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPSGGSGAGPKIEEVD  648



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLD NQLAEADEF+DKMKELESICNPIIAKMYQ GAGPD+  GMD+D   
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFDDKMKELESICNPIIAKMYQ-GAGPDMGGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPAGGSGAGPKIEEVD  648



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNT+KDEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTVKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+   MDED   
Sbjct  576  IEDAIEEAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQ-GAGGDMGGSMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPSGGSGAGPKIEEVD  648



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  469  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  528

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  529  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  584

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  585  DAPPAGGSGAGPKIEEVD  602



>gb|AAA82974.1| HSP70b, partial [Pisum sativum]
Length=161

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMV+EAE+YKAEDEEHKKKV+AKNALENYAYNMRNTI DEKI SKL P+DKKK
Sbjct  47   LSKDDIEKMVEEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTINDEKIGSKLSPEDKKK  106

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            I+DAIE AIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQGG  PD+  G D+D
Sbjct  107  IDDAIEAAIQWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQGGGAPDM--GGDDD  161



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELESICNPIIA+MYQ GAGPD+  AAGMD+D 
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESICNPIIARMYQ-GAGPDMGGAAGMDDD-  633

Query  218  psaggsgtgtgagPKIEEVD  159
                 +    GAGPKIEEVD
Sbjct  634  ---APASGSGGAGPKIEEVD  650



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAED+EHKKKVEAKNALENYAYNMRNTIKDEKIS+KL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQGG G D  A MDED   
Sbjct  576  IEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGG-GADAGASMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               +G G+GAGPKIEEVD
Sbjct  632  GPSAGAGSGAGPKIEEVD  649



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAED+EHKKKVEAKNALENYAYNMRNTIKDEKIS+KL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQGG G D  A MDED   
Sbjct  576  IEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGG-GADAGASMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               +G G+GAGPKIEEVD
Sbjct  632  GPSAGAGSGAGPKIEEVD  649



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 3/119 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDED  222
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELES+CNPIIA+MYQ GAGPD+  A GMD+D
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQ-GAGPDMGGAGGMDDD  633



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  516  LSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQ+IQWLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAGPD+      D  +
Sbjct  576  IEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGAPPAD--T  633

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  634  EYTPSGGSGAGPKIEEVD  651



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 122/139 (88%), Gaps = 6/139 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKK EAKN+LENYAYNMRNT+KDEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKAEAKNSLENYAYNMRNTVKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV-AAGMDEDgp  216
            IEDAI+ A+QWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAGPD+  AGM +D  
Sbjct  576  IEDAIDGAVQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGPDMGGAGMADD--  632

Query  215  saggsgtgtgagPKIEEVD  159
                   G+GAGPKIEEVD
Sbjct  633  --IPPAGGSGAGPKIEEVD  649



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  499  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  558

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  559  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  614

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  615  DAPPAGGSGAGPKIEEVD  632



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPAGGSGAGPKIEEVD  648



>gb|ABK94007.1| unknown [Populus trichocarpa]
Length=125

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 5/130 (4%)
 Frame = -3

Query  548  MVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQA  369
            MVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QA
Sbjct  1    MVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQA  60

Query  368  IQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgt  189
            IQWLD NQLAEADEF+DKMKELESICNPIIAKMYQ GAGPD+  GMD+D         G+
Sbjct  61   IQWLDSNQLAEADEFDDKMKELESICNPIIAKMYQ-GAGPDMGGGMDDD----APPSGGS  115

Query  188  gagPKIEEVD  159
            GAGPKIEEVD
Sbjct  116  GAGPKIEEVD  125



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 5/140 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL PDDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+ AI WLD NQ AEADEFEDKMKELES+CNP+IAKMYQGGAGPD+  A GM +D 
Sbjct  576  IEDAIDAAINWLDANQSAEADEFEDKMKELESLCNPVIAKMYQGGAGPDMGRAGGMADD-  634

Query  218  psaggsgtgtgagPKIEEVD  159
                 S  G GAGPKIEEVD
Sbjct  635  --VPPSRGGGGAGPKIEEVD  652



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLTPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAGPD+   M++D   
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGPDMGGPMEDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                 +G+GAGPKIEEVD
Sbjct  632  -VPPASGSGAGPKIEEVD  648



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  DAPPAGGSGAGPKIEEVD  649



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  DAPPAGGSGAGPKIEEVD  649



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 123/138 (89%), Gaps = 3/138 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKK+EAKNALENYAYNMRNTI+DEKI++KL P DKKK
Sbjct  515  LSKEEIEKMVQEAEKYKAEDEEHKKKIEAKNALENYAYNMRNTIRDEKIAAKLPPADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED+IE+AI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAG  +A GMDED   
Sbjct  575  IEDSIEEAINWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGAGMADGMDED--V  631

Query  212  aggsgtgtgagPKIEEVD  159
               +G+  GAGPKIEEVD
Sbjct  632  PTAAGSSGGAGPKIEEVD  649



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDE+HKKKVEAKNALENYAYNMRNTIKDEKI++KL   DKKK
Sbjct  517  LSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTIKDEKIAAKLPAADKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE+AI WLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  577  IEDAIEKAISWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
             G +  G+ AGPKIEEVD
Sbjct  633  -GPTTGGSSAGPKIEEVD  649



>tpg|DAA44672.1| TPA: hsp70 protein [Zea mays]
Length=544

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEH+KKV AKN LENYAYNMRNTI+D+KI+SKL  DDKKK
Sbjct  411  LSKEEIEKMVQEAEKYKAEDEEHQKKVNAKNTLENYAYNMRNTIRDDKIASKLPEDDKKK  470

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            I+DA+E AI WLD NQLAE DEFEDKMKELE ICNPIIAKMYQG AGPD+A GMD+D   
Sbjct  471  IDDAVEGAINWLDNNQLAEVDEFEDKMKELEGICNPIIAKMYQGAAGPDMAGGMDQD---  527

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  528  -ASPAGGSGAGPKIEEVD  544



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  516  LSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQ+IQWLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAGPD+      D  +
Sbjct  576  IEDAIEQSIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGAPPAD--T  633

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  634  EYTPSGGSGAGPKIEEVD  651



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 122/139 (88%), Gaps = 5/139 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN LENYAYNMRNTIKDEKISSKL   DKKK
Sbjct  436  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNGLENYAYNMRNTIKDEKISSKLPAADKKK  495

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAG-MDEDgp  216
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ GAG D+ AG MD+D  
Sbjct  496  IEDAIEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGGDMGAGPMDDD--  552

Query  215  saggsgtgtgagPKIEEVD  159
                 G G+GAGPKIEEVD
Sbjct  553  -GPSVGGGSGAGPKIEEVD  570



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPD  246
            IEDAIE AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  GPD
Sbjct  576  IEDAIEGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGPD  624



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKK+
Sbjct  279  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLAADDKKR  338

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ G G D+A GMDED   
Sbjct  339  IEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQ-GPGADMAGGMDED---  394

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  395  --APAGGSGAGPKIEEVD  410



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KD+KI  KL P DKKK
Sbjct  515  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGGKLDPADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAGPD+      D   
Sbjct  575  IEDAIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAGPDMGGAPPAD--D  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  EYTPSGGSGAGPKIEEVD  650



>dbj|BAD02271.1| heat shock protein 70 [Nicotiana benthamiana]
Length=137

 Score =   190 bits (483),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 115/133 (86%), Gaps = 4/133 (3%)
 Frame = -3

Query  557  IEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAI  378
            IEKMVQEAE+YKAEDE+HKKKVEAKNALENYAYNMRNT+KDEKISSKL  DDKKKIEDAI
Sbjct  9    IEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTVKDEKISSKLSADDKKKIEDAI  68

Query  377  EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsg  198
            +QAI WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ GAG D  A MD+D   A  +G
Sbjct  69   DQAISWLDSNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGGDAGAPMDDD---APPAG  124

Query  197  tgtgagPKIEEVD  159
               GAGPKIEEVD
Sbjct  125  ASGGAGPKIEEVD  137



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 121/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEE KKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEVKKKVESKNALENYAYNMRNTIKDEKIASKLDAGDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEA+E++DK+KELE ICNPIIAKMYQGGA PD+  GMDED   
Sbjct  576  IEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMYQGGAAPDMGGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -VPPAGGSGAGPKIEEVD  649



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKL  +DKKK
Sbjct  206  LSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLGAEDKKK  265

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG +  A MD+D   
Sbjct  266  IEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGGEAGAPMDDD---  321

Query  212  aggsgtgtgagPKIEEVD  159
                   TGAGPKIEEVD
Sbjct  322  DAPPAGSTGAGPKIEEVD  339



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTI D+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTINDDKIASKLAAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEADEF+DKMKELESICNPIIAKMYQ GAG D+A GMD+D   
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFDDKMKELESICNPIIAKMYQ-GAGADMAGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPAGGSGAGPKIEEVD  648



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 120/138 (87%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D+  GMDED   
Sbjct  576  IEDAIEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADM-GGMDED---  630

Query  212  aggsgtgtgagPKIEEVD  159
                  G GAGPKIEEVD
Sbjct  631  --VPAGGNGAGPKIEEVD  646



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELES+CNPIIA+MYQ GAGPD+  A GMD+D 
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQ-GAGPDMGGAGGMDDD-  633

Query  218  psaggsgtgtgagPKIEEVD  159
                 +G   GAGPKIEEVD
Sbjct  634  ---TPAGGSGGAGPKIEEVD  650



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ AE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  515  LSKEEIEKMVQGAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQ GAG D+A GMDED   
Sbjct  575  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGADMAGGMDED---  630

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  631  DAPPAGGSGAGPKIEEVD  648



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 7/140 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELES+CNPIIA+MYQ GAGPD+  A GMD+D 
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQ-GAGPDMGGAGGMDDD-  633

Query  218  psaggsgtgtgagPKIEEVD  159
                 +G   GAGPKIEEVD
Sbjct  634  ---TPAGGSGGAGPKIEEVD  650



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 123/139 (88%), Gaps = 5/139 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKINSKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAG-MDEDgp  216
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ GAG D+ AG MD+D  
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGGDMGAGPMDDD--  632

Query  215  saggsgtgtgagPKIEEVD  159
                 G G+GAGPKIEEVD
Sbjct  633  -GPSVGGGSGAGPKIEEVD  650



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 3/119 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDED  222
            IEDAI+QAI+WLDGNQLAEADEF+DKMKELES+CNPIIA+MYQ GAGPD+  A GMDED
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFDDKMKELESLCNPIIARMYQ-GAGPDMGGAGGMDED  633



>ref|NP_001148198.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG30152.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 tpg|DAA44671.1| TPA: hsp70 protein [Zea mays]
Length=649

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEH+KKV AKN LENYAYNMRNTI+D+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHQKKVNAKNTLENYAYNMRNTIRDDKIASKLPEDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            I+DA+E AI WLD NQLAE DEFEDKMKELE ICNPIIAKMYQG AGPD+A GMD+D   
Sbjct  576  IDDAVEGAINWLDNNQLAEVDEFEDKMKELEGICNPIIAKMYQGAAGPDMAGGMDQD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -ASPAGGSGAGPKIEEVD  649



>gb|AEP40944.1| heat shock protein 70 family protein [Posidonia oceanica]
Length=200

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 118/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKK+E+KNALENYAYNMRNTI+DEKIS KL   DKKK
Sbjct  69   LSKEEIEKMVQEAEKYKSEDEEHKKKIESKNALENYAYNMRNTIRDEKISEKLAAADKKK  128

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI++AIQWLD NQL EADEF+DKMKELE++CNPIIAKMYQ GAG DV  GMDED   
Sbjct  129  IEDAIDEAIQWLDNNQLGEADEFDDKMKELENVCNPIIAKMYQ-GAGGDVDGGMDED---  184

Query  212  aggsgtgtgagPKIEEVD  159
              G    +G GPKIEEVD
Sbjct  185  --GLSAPSGPGPKIEEVD  200



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 116/138 (84%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+ KL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIAGKLDSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED IE AIQWLD NQLAEADEFEDKMKELE +CNPIIAKMYQGGAGPD+ A   +D   
Sbjct  576  IEDTIEAAIQWLDANQLAEADEFEDKMKELEGVCNPIIAKMYQGGAGPDMGAAPGDD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  -DAPSHAGGAGPKIEEVD  649



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE MVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   D+KK
Sbjct  516  LSKEEIENMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLAAADRKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAG D+A  MD+D   
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADMAGEMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
               +  G+GAGPKIEEVD
Sbjct  632  -VPAAGGSGAGPKIEEVD  648



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE +CNPIIAKMYQ GAG ++A GMDED
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGLCNPIIAKMYQ-GAGANMAGGMDED  631



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKN LENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTIKDDKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELES+CNPIIAKMY+ GAG D+A GMD+D
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESVCNPIIAKMYE-GAGADMAGGMDDD  631



>ref|NP_001167696.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG43177.1| heat shock cognate 70 kDa protein 2 [Zea mays]
Length=649

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEH+KKV AKN LENYAYNMRNTI+D+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHQKKVNAKNTLENYAYNMRNTIRDDKIASKLPVDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            I+DA+E AI WLD NQLAE DEFEDKMKELE ICNPIIAKMYQG AGPD+A GMD D   
Sbjct  576  IDDAVEGAINWLDNNQLAEVDEFEDKMKELEGICNPIIAKMYQGAAGPDMAGGMDRD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -ASPAGGSGAGPKIEEVD  649



>ref|XP_002468097.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
 gb|EER95095.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
Length=649

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTI+D+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIRDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            I+DAIE AI WLD NQLAE DEFEDKMKELE ICNPIIAKMYQG AGPD+A GMD+D   
Sbjct  576  IDDAIEGAINWLDNNQLAEVDEFEDKMKELEGICNPIIAKMYQGAAGPDMAGGMDQD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -APPAGGSGAGPKIEEVD  649



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 106/112 (95%), Gaps = 2/112 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKN+LENYAYNMRNTIKD+KISSKL P DKK 
Sbjct  411  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKL  470

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA--GPDV  243
            IEDAIEQAIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGA  GP+V
Sbjct  471  IEDAIEQAIQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAGEGPEV  522



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 118/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  632  -APPAGGSSAGPKIEEVD  648



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 118/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  632  -APPAGGSSAGPKIEEVD  648



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 119/141 (84%), Gaps = 7/141 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE MVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKEEIENMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKIGSKLDPTDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA---GPDVAAGMDED  222
            IEDAI+ AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQG     G D+ AGMD+D
Sbjct  576  IEDAIDGAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGAGADMGADMGAGMDDD  635

Query  221  gpsaggsgtgtgagPKIEEVD  159
                     G+GAGPKIEEVD
Sbjct  636  ----APPAGGSGAGPKIEEVD  652



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPAGGSGAGPKIEEVD  648



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 4/139 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVEAKNALENYAYNMRNTI+DEKI  KL P+DKKK
Sbjct  517  LSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIRDEKIGEKLGPEDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG-PDVAAGMDEDgp  216
            IE+AIEQAIQWL+GNQLAE DE EDKMKELESICNPIIAKMYQG AG PD+A GMD+D  
Sbjct  577  IEEAIEQAIQWLEGNQLAEVDELEDKMKELESICNPIIAKMYQGSAGAPDMAGGMDDD--  634

Query  215  saggsgtgtgagPKIEEVD  159
                  +G+GAGPKIEEVD
Sbjct  635  -HVPPSSGSGAGPKIEEVD  652



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            +EDAIEQAIQWLDGNQLAEA+E++DK+KELE ICNPIIAKMYQGGA PD+A G+DE+   
Sbjct  576  VEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMYQGGAPPDMAGGIDEE---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -VPPSGGSGAGPKIEEVD  649



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+ KL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIAGKLDSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED IE AIQWLD NQLAEADEFEDKMKELE +CNPIIAKMYQGGAGPD+ A   +D
Sbjct  576  IEDTIEAAIQWLDANQLAEADEFEDKMKELEGVCNPIIAKMYQGGAGPDMGAAPGDD  632



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLSADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                   TGAGPKIEEVD
Sbjct  632  DAPPAGSTGAGPKIEEVD  649



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLD NQLAEADEFEDKMKELE ICNPIIA+MYQ GAG DVA GM +D   
Sbjct  576  IEDAIEQAIQWLDNNQLAEADEFEDKMKELEGICNPIIARMYQ-GAGADVAGGMGDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -SPPAGGSGAGPKIEEVD  648



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 3/119 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKITSKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDED  222
            IEDAI+QAI+WLDGNQLAE DEFEDKMKELES+CNPIIA+MYQ GAGPD+  A GM+ED
Sbjct  576  IEDAIDQAIEWLDGNQLAETDEFEDKMKELESLCNPIIARMYQ-GAGPDMGGAGGMEED  633



>ref|NP_001049719.2| Os03g0277300 [Oryza sativa Japonica Group]
 dbj|BAF11633.2| Os03g0277300 [Oryza sativa Japonica Group]
Length=398

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDE+ + KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  262  LSKEEIERMVQEAEKYKAEDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  321

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIE AI+WLDGNQLAEADEFEDKMKELES+CNPII+KMYQGGAG    AGMDED
Sbjct  322  IEDAIEDAIKWLDGNQLAEADEFEDKMKELESLCNPIISKMYQGGAGG--PAGMDED  376



>gb|EAY89457.1| hypothetical protein OsI_10990 [Oryza sativa Indica Group]
Length=415

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDE+ + KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  279  LSKEEIERMVQEAEKYKAEDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  338

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIE AI+WLDGNQLAEADEFEDKMKELES+CNPII+KMYQGGAG    AGMDED
Sbjct  339  IEDAIEDAIKWLDGNQLAEADEFEDKMKELESLCNPIISKMYQGGAGG--PAGMDED  393



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKK+
Sbjct  515  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLAADDKKR  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ G G D+A GMDED   
Sbjct  575  IEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQ-GPGADMAGGMDED---  630

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  631  --APAGGSGAGPKIEEVD  646



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 121/139 (87%), Gaps = 5/139 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+ KL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIAGKLDSADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV-AAGMDEDgp  216
            IED+IEQAIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAGPD+  A  DE+  
Sbjct  576  IEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAGPDMGGAAADEE--  633

Query  215  saggsgtgtgagPKIEEVD  159
                   G+GAGPKIEEVD
Sbjct  634  --YAPSGGSGAGPKIEEVD  650



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+ KL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIAGKLDSADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAA  237
            IED+IEQAIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAGPD+  
Sbjct  576  IEDSIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAGPDMGG  627



>gb|EMS50129.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=736

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  604  LSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKK  663

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELE +CNPIIAKMYQ GAG D+A  MDED
Sbjct  664  IEDAIDQAIQWLDGNQLAEADEFDDKMKELEGLCNPIIAKMYQ-GAGADMAGAMDED  719



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 116/138 (84%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDE+HKKKVEAKNALENYAYNMRNT+KDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSVDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ GAG D  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAGGDAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                   + AGPKIEEVD
Sbjct  632  -VPPAGASSAGPKIEEVD  648



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 106/112 (95%), Gaps = 2/112 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKN+LENYAYNMRNTIKD+KISSKL P DKK 
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKL  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA--GPDV  243
            IEDAIEQAIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGA  GP+V
Sbjct  576  IEDAIEQAIQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAGEGPEV  627



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+ KL  +DKKK
Sbjct  515  LSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIAGKLDSEDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVA  240
            IED IEQAIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAGPD+ 
Sbjct  575  IEDTIEQAIQWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAGPDMG  625



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 106/112 (95%), Gaps = 2/112 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKN+LENYAYNMRNTIKD+KISSKL P DKK 
Sbjct  716  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKL  775

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA--GPDV  243
            IEDAIEQAIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGA  GP+V
Sbjct  776  IEDAIEQAIQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAGEGPEV  827



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI++AI WLD NQLAEADEFEDKMKELE++CNPIIAKMYQGGAG   AAGMDE+   
Sbjct  576  IEDAIDEAIAWLDTNQLAEADEFEDKMKELENVCNPIIAKMYQGGAGE--AAGMDEE---  630

Query  212  aggsgtgtgagPKIEEVD  159
               + +G GAGPKIEEVD
Sbjct  631  --PAPSGGGAGPKIEEVD  646



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMV+EAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKEEIEKMVEEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQG  G D+   MDED   
Sbjct  576  IEDAIDQAIHWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGD-GADMGGRMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               S  G+GAGPKIEEVD
Sbjct  632  -APSTGGSGAGPKIEEVD  648



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKISSKL   DKKK
Sbjct  516  LSKEEIERMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKISSKLSEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQA+QWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQG A  D+   MDED   
Sbjct  576  IEDAIEQAVQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQGSA--DMGGQMDED---  630

Query  212  aggsgtgtgagPKIEEVD  159
                G  +GAGPKIEEVD
Sbjct  631  GPAPGGASGAGPKIEEVD  648



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 3/119 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDED  222
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELES+CNPIIAKMYQ GAGPD+  A  MD+D
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGPDMGGAGAMDDD  633



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 118/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED+IE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D A  +D+D   
Sbjct  576  IEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGDGAGPVDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                 + +G GPKIEEVD
Sbjct  632  --APPSASGPGPKIEEVD  647



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AIQWLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG D+  GMD+D   
Sbjct  576  IEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMYQ-GAGADMEGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  632  --TPAASGGAGPKIEEVD  647



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AIQWLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG D+  GMD+D   
Sbjct  576  IEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMYQ-GAGADMEGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                    G GPKIEEVD
Sbjct  632  --TPAASGGPGPKIEEVD  647



>gb|AFK37867.1| unknown [Lotus japonicus]
Length=126

 Score =   185 bits (469),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 111/131 (85%), Gaps = 6/131 (5%)
 Frame = -3

Query  548  MVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQA  369
            MVQEAE+YK+EDEEH+KKVEAKNALENYAYNMRNTIKDEKI  KL P DKKKIEDAIEQA
Sbjct  1    MVQEAEKYKSEDEEHRKKVEAKNALENYAYNMRNTIKDEKIGGKLDPADKKKIEDAIEQA  60

Query  368  IQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV-AAGMDEDgpsaggsgtg  192
            IQWLD NQLAEADEFEDKMKELESI NPIIAKMYQG  GPD+  A MD+D         G
Sbjct  61   IQWLDSNQLAEADEFEDKMKELESIYNPIIAKMYQGAGGPDMGGAPMDDD-----TPAGG  115

Query  191  tgagPKIEEVD  159
            +GAGPKIEEVD
Sbjct  116  SGAGPKIEEVD  126



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 9/141 (6%)
 Frame = -3

Query  572  LSKEEIEKM-VQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKK  396
            LSKEEIEKM VQEAE+YK+EDEEHKKKV+AKN+LENYAYNMRNTIKD+KI+SKL  DDKK
Sbjct  515  LSKEEIEKMMVQEAEKYKSEDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLSADDKK  574

Query  395  KIEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDED  222
            KIEDAI+ AI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAGPD+  A GMDED
Sbjct  575  KIEDAIDGAINWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGPDMGGATGMDED  633

Query  221  gpsaggsgtgtgagPKIEEVD  159
                     G+GAGPKIEEVD
Sbjct  634  -----VPAGGSGAGPKIEEVD  649



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKK++AKNALENYAYNMRNT+KDEKISSKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKIDAKNALENYAYNMRNTVKDEKISSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLDANQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTI+DEKI SKL PDDKKK
Sbjct  516  LSKEEIEKMVQEAERYKAEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGSKLSPDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGA  255
            IED I++AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQG A
Sbjct  576  IEDTIDEAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGSA  621



>ref|NP_001140835.1| uncharacterized protein LOC100272911 [Zea mays]
 gb|ACF84762.1| unknown [Zea mays]
Length=562

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK EDEE K+KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  427  LSKEEIERMVQEAEKYKTEDEEVKRKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  486

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED IE AI+WLDGNQLAEA+EFEDKMKELESICNPII++MYQGGAG   AAGMDED
Sbjct  487  IEDTIEDAIKWLDGNQLAEAEEFEDKMKELESICNPIISQMYQGGAG---AAGMDED  540



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 119/139 (86%), Gaps = 7/139 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV-AAGMDEDgp  216
            IEDAI+ AIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+  +GMDED  
Sbjct  576  IEDAIDAAIQWLDTNQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGADMEGSGMDED--  632

Query  215  saggsgtgtgagPKIEEVD  159
                     G GPKIEEVD
Sbjct  633  ---TPAASGGPGPKIEEVD  648



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  304  LSKEDIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKK  363

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEA+EFEDKMKELE +CNPIIAKMYQ GAG D+A GMDED  +
Sbjct  364  IEDAIDGAISWLDSNQLAEAEEFEDKMKELEGVCNPIIAKMYQ-GAGADMAGGMDED--A  420

Query  212  aggsgtgtgagPKIEEVD  159
               +G  +G GPKIEEVD
Sbjct  421  PAAAGGSSGPGPKIEEVD  438



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   197 bits (501),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE +IQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ GAG DV   MD+D   
Sbjct  576  IEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGDVP--MDDD---  629

Query  212  aggsgtgtgagPKIEEVD  159
               + +G+GAGPKIEEVD
Sbjct  630  -APAPSGSGAGPKIEEVD  646



>ref|XP_004984739.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTI+D+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIRDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            I++AIE AI WLD NQLAE DEFEDKMKELE ICNPIIAKMYQG AGPD+A GM ED
Sbjct  576  IDEAIEGAITWLDNNQLAEVDEFEDKMKELEGICNPIIAKMYQGAAGPDMAGGMAED  632



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL  DD+ K
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            IEDAIEQAIQWLDGNQLAEA+EFEDKMKELES+CNPIIAKMYQG  G
Sbjct  576  IEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQGAGG  622



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 120/140 (86%), Gaps = 7/140 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  515  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLGADDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAA--GMDEDg  219
            +EDAI+ AI WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ GA PD+    GMDED 
Sbjct  575  VEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQ-GAAPDMGGGMGMDED-  632

Query  218  psaggsgtgtgagPKIEEVD  159
                 +G  +GAGPKIEEVD
Sbjct  633  ---APAGGSSGAGPKIEEVD  649



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEK+VQEAE++KAEDEEHKKKVE+KNALENYAYNMRNTI+DEKIS KL P DKKK
Sbjct  516  LSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRNTIRDEKISGKLAPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA+EQAIQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQGGA    AA M++D   
Sbjct  576  IEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMYQGGADMGSAA-MNDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPSGGSGAGPKIEEVD  648



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 118/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  524  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKK  583

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED+IE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D A  +D+D   
Sbjct  584  IEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGGDGAGPVDDD---  639

Query  212  aggsgtgtgagPKIEEVD  159
                 + +G GPKIEEVD
Sbjct  640  -DAPPSASGPGPKIEEVD  656



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL  DD+ K
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            IEDAIEQAIQWLDGNQLAEA+EFEDKMKELES+CNPIIAKMYQG  G
Sbjct  576  IEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQGAGG  622



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 116/138 (84%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI  KL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGEKLPGADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ G+GPD A  +D+D   
Sbjct  576  IEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GSGPDGAGPVDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  632  --VPAGSGGAGPKIEEVD  647



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 118/138 (86%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE +IQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  G    A MD+D   
Sbjct  576  IEDAIESSIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGG---EAPMDDD---  629

Query  212  aggsgtgtgagPKIEEVD  159
             G +   +G GPKIEEVD
Sbjct  630  -GPAPGASGPGPKIEEVD  646



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  631  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  690

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AIQWLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG D+  GMD+D   
Sbjct  691  IEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMYQ-GAGADMEGGMDDD---  746

Query  212  aggsgtgtgagPKIEEVD  159
                    G GPKIEEVD
Sbjct  747  --TPAASGGPGPKIEEVD  762



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KDEKI+SKL  DDKKK
Sbjct  515  LSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKIASKLGADDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            +EDA+E  I WLDGNQLAEA+EFEDKMKELE ICNPIIAKMYQ GA PD+  GM  D
Sbjct  575  VEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQ-GAAPDMGGGMGMD  630



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL  DD+ K
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            IEDAIEQAIQWLDGNQLAEA+EFEDKMKELES+CNPIIAKMYQG  G
Sbjct  576  IEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQGAGG  622



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN+LENYAYNMRNTIKDEKISSKL   DKK+
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQ  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGAG     G + D  +
Sbjct  576  IEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAG----EGPEVDDDA  631

Query  212  aggsgtgtgagPKIEEVD  159
            A       GAGPKIEEVD
Sbjct  632  APPPSGSGGAGPKIEEVD  649



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN+LENYAYNMRNTIKDEKISSKL   DKK+
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQ  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGAG     G + D  +
Sbjct  576  IEDAIEGAIQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAG----EGPEVDDDA  631

Query  212  aggsgtgtgagPKIEEVD  159
            A       GAGPKIEEVD
Sbjct  632  APPPSGSGGAGPKIEEVD  649



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 6/140 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEE KKKVE+KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEVKKKVESKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPD--VAAGMDEDg  219
            IEDAIEQAIQWLDGNQLAEA+E++DK+KELE ICNPIIAKMYQGGA PD  +  GMDED 
Sbjct  576  IEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMYQGGAAPDMGMGGGMDED-  634

Query  218  psaggsgtgtgagPKIEEVD  159
                    G+GAGPKIEEVD
Sbjct  635  ---VPPAGGSGAGPKIEEVD  651



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKN LENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  427  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKK  486

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  487  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  529



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 8/140 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKN+LENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  388  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRNTIKDEKIASKLPADDKKK  447

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+ AI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+  A GMDED 
Sbjct  448  IEDAIDAAISWLDANQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGEDMGGAGGMDED-  505

Query  218  psaggsgtgtgagPKIEEVD  159
                      G GPKIEEVD
Sbjct  506  ----APAGSGGPGPKIEEVD  521



>gb|ABF95267.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ26449.1| hypothetical protein OsJ_10337 [Oryza sativa Japonica Group]
Length=653

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDE+ + KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  517  LSKEEIERMVQEAEKYKAEDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIE AI+WLDGNQLAEADEFEDKMKELES+CNPII+KMYQGGAG    AGMDED
Sbjct  577  IEDAIEDAIKWLDGNQLAEADEFEDKMKELESLCNPIISKMYQGGAGG--PAGMDED  631



>ref|XP_008658250.1| PREDICTED: uncharacterized protein LOC100272911 isoform X1 [Zea 
mays]
 gb|AFW88811.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=652

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK EDEE K+KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  517  LSKEEIERMVQEAEKYKTEDEEVKRKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED IE AI+WLDGNQLAEA+EFEDKMKELESICNPII++MYQGGAG   AAGMDED
Sbjct  577  IEDTIEDAIKWLDGNQLAEAEEFEDKMKELESICNPIISQMYQGGAG---AAGMDED  630



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 6/119 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+Y++EDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKLQP DKKK
Sbjct  516  LSKEEIEKMVQEAEKYRSEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLQPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG--PDVAAGMDED  222
            IEDAI++AI+WLD NQL EADEFEDKMKELE ICNPIIAKMYQGG G  PD    MD+D
Sbjct  576  IEDAIDEAIKWLDANQLGEADEFEDKMKELEGICNPIIAKMYQGGEGGAPD----MDDD  630



>gb|ACJ54890.1| heat shock protein 70 [Oryza sativa Japonica Group]
Length=653

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDE+ + KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  517  LSKEEIERMVQEAEKYKAEDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIE AI+WLDGNQLAEADEFEDKMKELES+CNPII+KMYQGGAG    AGMDED
Sbjct  577  IEDAIEDAIKWLDGNQLAEADEFEDKMKELESLCNPIISKMYQGGAGG--PAGMDED  631



>gb|AFW88810.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=782

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK EDEE K+KVEA+NALENYAYNMRNT++DEKI+SKL  DDKKK
Sbjct  647  LSKEEIERMVQEAEKYKTEDEEVKRKVEARNALENYAYNMRNTVRDEKIASKLPADDKKK  706

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED IE AI+WLDGNQLAEA+EFEDKMKELESICNPII++MYQGGAG   AAGMDED
Sbjct  707  IEDTIEDAIKWLDGNQLAEAEEFEDKMKELESICNPIISQMYQGGAG---AAGMDED  760



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENY+YNMRNTIKD+KISSKL  +DKKK
Sbjct  516  LSKDEIEKMVQEAERYKAEDEEHKKKVEAKNALENYSYNMRNTIKDDKISSKLSAEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG +  A MD+D   
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGGEAGAPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                   TGAGPKIEEVD
Sbjct  632  DAPPAGSTGAGPKIEEVD  649



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  513  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKK  572

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  573  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  615



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 118/138 (86%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IE+AI+ AIQWLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG D+  GMD+D   
Sbjct  576  IEEAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMYQ-GAGADMEGGMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                    G GPKIEEVD
Sbjct  632  --TPAASGGPGPKIEEVD  647



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P+DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIEQAIQWLD NQLAEADEFEDKMKELES+CNPIIAKMYQG  G D    MDED
Sbjct  576  IEDAIEQAIQWLDANQLAEADEFEDKMKELESLCNPIIAKMYQGSGGGDFGGAMDED  632



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKN LENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|ACT34017.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
 gb|ACY00390.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
Length=649

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKV+AKN+LENYAYNMRNTI+D+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNSLENYAYNMRNTIRDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            I++AIE AI WLD NQLAE DEFEDKMKELE ICNPIIA+MYQG AGPD+A GM ED
Sbjct  576  IDEAIEGAITWLDNNQLAEVDEFEDKMKELEGICNPIIARMYQGAAGPDMAGGMAED  632



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+ AI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  G DV  GMDED
Sbjct  576  IEDAIDSAIHWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGADVGGGMDED  632



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 117/140 (84%), Gaps = 7/140 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIE+MVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNTI+DEKI  KL  DDKKK
Sbjct  516  LSKDEIERMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIRDEKIGEKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG--PDVAAGMDEDg  219
            IED+IE AI+WL+GNQLAE DEFEDKMKELESICNPIIAKMYQGG G  P  + GMD+D 
Sbjct  576  IEDSIEGAIEWLEGNQLAECDEFEDKMKELESICNPIIAKMYQGGEGGVPGASGGMDDD-  634

Query  218  psaggsgtgtgagPKIEEVD  159
                   +  G GPKIEEVD
Sbjct  635  ----APPSTGGPGPKIEEVD  650



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P +KKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPAEKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAI WLD NQLAEADEFEDKMKE+ESICNPIIAK+YQG  G D+   MDED   
Sbjct  576  IEDAIDQAIHWLDSNQLAEADEFEDKMKEVESICNPIIAKIYQGD-GADMGGRMDED---  631

Query  212  aggsgtgtgagPKIEEVD  159
               S  G+GAGPKIEEVD
Sbjct  632  -APSTGGSGAGPKIEEVD  648



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  504  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKK  563

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED+IE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D A  +D++   
Sbjct  564  IEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADGAGPVDDE---  619

Query  212  aggsgtgtgagPKIEEVD  159
                   +G GPKIEEVD
Sbjct  620  --APAGASGPGPKIEEVD  635



>ref|XP_003563611.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=648

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 116/138 (84%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQ+AE+YK+EDEEHKKKVEAKN LENYAYNMRNTI DEKI+SKL  DDKKK
Sbjct  517  LSKDDIEKMVQDAEKYKSEDEEHKKKVEAKNTLENYAYNMRNTISDEKIASKLPADDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA++QAIQWLD NQLAE DEFEDKMKELE +CNPIIAKMYQ GAG D+  GMDED   
Sbjct  577  IEDAVDQAIQWLDNNQLAEVDEFEDKMKELEGLCNPIIAKMYQ-GAGADMPGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  633  --APAASGGAGPKIEEVD  648



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE KNALENYAYNMRNTIKDEKISSKL  +DK K
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEGKNALENYAYNMRNTIKDEKISSKLSSEDKTK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            I++AIEQAIQWLD NQLAEADEFEDKMKELE ICNPIIAKMYQGGAG
Sbjct  576  IDNAIEQAIQWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQGGAG  622



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEK+VQEAE++KAEDEEHKKKVE+KNALENYAYNMRNTI+DEKI  KL P DKKK
Sbjct  481  LSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRNTIRDEKIGGKLAPADKKK  540

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA+EQAIQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQGGA    AA M++D   
Sbjct  541  IEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMYQGGADMGGAA-MNDD---  596

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  597  -APPSGGSGAGPKIEEVD  613



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED+IE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D A  +D++   
Sbjct  576  IEDSIETAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADGAGPVDDE---  631

Query  212  aggsgtgtgagPKIEEVD  159
                   +G GPKIEEVD
Sbjct  632  --APAGASGPGPKIEEVD  647



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEK+VQEAE++KAEDEEHKKKVE+KNALENYAYNMRNTI+DEKI  KL P DKKK
Sbjct  516  LSKEEIEKLVQEAEKFKAEDEEHKKKVESKNALENYAYNMRNTIRDEKIGGKLAPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA+EQAIQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQGGA    AA M++D   
Sbjct  576  IEDAVEQAIQWLDSNQLAESDEFEDKMKELESICNPIIAKMYQGGADMGGAA-MNDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  -APPSGGSGAGPKIEEVD  648



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 116/138 (84%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN+LENYAYNMRNTIKDEKISSKL   DKK+
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQ  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE A QWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQGGAG     G + D  +
Sbjct  576  IEDAIEGAFQWLDANQLAEADEFEDKMKELETICNPIIAKMYQGGAG----EGPEVDDDA  631

Query  212  aggsgtgtgagPKIEEVD  159
            A       GAGPKIEEVD
Sbjct  632  APPPSGSGGAGPKIEEVD  649



>gb|ADD64906.1| heat shock protein-like protein [Tragopogon dubius]
 gb|ADD64907.1| heat shock protein-like protein [Tragopogon porrifolius]
Length=137

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 18/128 (14%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  6    LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKK  65

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IEDAI++AI WLD NQLAEADEFEDKMKELE++CNPIIAKMYQ                 
Sbjct  66   IEDAIDEAIAWLDTNQLAEADEFEDKMKELENVCNPIIAKMYQGGAGGEAGGMDEEPAPS  125

Query  263  -GGAGPDV  243
             GGAGP +
Sbjct  126  GGGAGPKI  133



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 4/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  204  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLPAADKKK  263

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+QAIQWLD NQLAEADEF+DKMKELESICNPIIAKMYQG      A G++ED
Sbjct  264  IEDAIDQAIQWLDNNQLAEADEFDDKMKELESICNPIIAKMYQGAG----AGGVEED  316



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KD+KISSKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  261
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQG
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQG  619



>ref|XP_009784010.1| PREDICTED: heat shock cognate 70 kDa protein-like, partial [Nicotiana 
sylvestris]
Length=150

 Score =   182 bits (463),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVE KNALENYAYNMRNTIKD+KISS+L   DKK 
Sbjct  15   LSKEEIERMVQEAEKYKSEDEELKKKVETKNALENYAYNMRNTIKDDKISSQLPAADKKI  74

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI++AI+WLD NQLAE DEFEDKMKELE ICNPIIAKMYQGGAG    A MDED
Sbjct  75   IEDAIDEAIKWLDSNQLAEVDEFEDKMKELEGICNPIIAKMYQGGAG---GATMDED  128



>ref|XP_006649850.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=655

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  521  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKK  580

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEA+EFEDKMKELE +CNPIIAKMYQ GAG D+A GMDED  +
Sbjct  581  IEDAIDGAISWLDSNQLAEAEEFEDKMKELEGVCNPIIAKMYQ-GAGADMAGGMDED--A  637

Query  212  aggsgtgtgagPKIEEVD  159
               +G  +G GPKIEEVD
Sbjct  638  PPAAGGSSGPGPKIEEVD  655



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  GPDV  GMDED
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGPDVGGGMDED  632



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQ+AE+YK+EDEEHKKKVEAKN+LENYAYNMRNTI+DEKI+SKL  DDKKK
Sbjct  517  LSKEDIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIQDEKIASKLPADDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDA+EQAIQWLD NQLAE +EFEDKMKELE +CNPIIAKMYQ GAG D+A GM++D
Sbjct  577  IEDAVEQAIQWLDSNQLAEVEEFEDKMKELEGLCNPIIAKMYQ-GAGADMAGGMEDD  632



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 122/138 (88%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  GPDV  GMDED   
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGPDVGGGMDED---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  -VPPAGGSGAGPKIEEVD  649



>ref|XP_002805956.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Macaca mulatta]
Length=224

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHK+KVE+KN+LENYAYNMRNTIKDEKI++K+ P DKKK
Sbjct  88   LSKEEIEKMVQEAEKYKSEDEEHKRKVESKNSLENYAYNMRNTIKDEKIAAKVDPSDKKK  147

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            I+DAIEQAIQWLD NQLAEADEF+DKMKELESICNPIIAKMYQ
Sbjct  148  IDDAIEQAIQWLDNNQLAEADEFDDKMKELESICNPIIAKMYQ  190



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNTIKDEKI+SKL   D+KK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IE+AIEQAIQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQ GAG D+ A M +D   
Sbjct  576  IEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPIIAKMYQ-GAGGDMGADMGDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  GPAPSGGSGAGPKIEEVD  649



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 8/140 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKN+LENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+ AI WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ GAG D+  A GMDED 
Sbjct  576  IEDAIDAAISWLDANQLAEADEFEDKMKELESLCNPIIAKMYQ-GAGEDMGGAGGMDED-  633

Query  218  psaggsgtgtgagPKIEEVD  159
                      G GPKIEEVD
Sbjct  634  ----APAGSGGPGPKIEEVD  649



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNTIKDEKI+SKL   D+KK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IE+AIEQAIQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQ GAG D+ A M +D   
Sbjct  576  IEEAIEQAIQWLDANQLAESDEFEDKMKELESICNPIIAKMYQ-GAGGDMGADMGDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  632  GPAPSGGSGAGPKIEEVD  649



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 6/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVE+KN LENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVESKNTLENYAYNMRNTIKDEKIASKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+QAIQWL+ NQLAEADEF+DKMKELE ICNPIIAKMYQ GAGPD+  GM +D   
Sbjct  576  IEDAIDQAIQWLESNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGPDM-GGMPDD---  630

Query  212  aggsgtgtgagPKIEEVD  159
               +G G+ AGPKIEEVD
Sbjct  631  -IPTGGGSSAGPKIEEVD  647



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKN+LENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQL EADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDGNQLGEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV++KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  404  LSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKK  463

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AI WLD NQLAEADEF+DKMKELE ICNPIIAKMYQ GAG ++  GMDED   
Sbjct  464  IEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGAEMPGGMDED-AP  521

Query  212  aggsgtgtgagPKIEEVD  159
            A  +G  +G GPKIEEVD
Sbjct  522  ASAAGGSSGPGPKIEEVD  539



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV++KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  405  LSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKK  464

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AI WLD NQLAEADEF+DKMKELE ICNPIIAKMYQ GAG ++  GMDED   
Sbjct  465  IEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGAEMPGGMDED-AP  522

Query  212  aggsgtgtgagPKIEEVD  159
            A  +G  +G GPKIEEVD
Sbjct  523  ASAAGGSSGPGPKIEEVD  540



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMV+EAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVEEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG  261
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELE ICNPIIA+MYQG
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIARMYQG  619



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  276  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKK  335

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  336  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  378



>ref|NP_001049712.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|ABF95258.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11626.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|EAZ26443.1| hypothetical protein OsJ_10329 [Oryza sativa Japonica Group]
 dbj|BAG93163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66978.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=650

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEA+EFEDKMKELE +CNPIIAKMYQ GAG D+A GMDED  +
Sbjct  576  IEDAIDGAISWLDSNQLAEAEEFEDKMKELEGVCNPIIAKMYQ-GAGADMAGGMDED--A  632

Query  212  aggsgtgtgagPKIEEVD  159
               +G  +G GPKIEEVD
Sbjct  633  PAAAGGSSGPGPKIEEVD  650



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 8/140 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KD+KI+SKL  DDKKK
Sbjct  515  LSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVKDDKIASKLGADDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAA--GMDEDg  219
            +E+AIE  I WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ GA PD+    GMDED 
Sbjct  575  VEEAIEGTISWLDANQLAEADEFEDKMKELEGICNPIIAKMYQ-GAAPDMGGGMGMDED-  632

Query  218  psaggsgtgtgagPKIEEVD  159
                      GAGPKIEEVD
Sbjct  633  ----MPAGAGGAGPKIEEVD  648



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI SKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEF+DKMKELESICNPIIA+MYQ
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFKDKMKELESICNPIIARMYQ  618



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KD+KI+SKL  DDKKK
Sbjct  515  LSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVKDDKIASKLGADDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            +E+AIE  I WLD NQLAEADEFEDKMKELE ICNPIIAKMYQ GA PD+  GM  D
Sbjct  575  VEEAIEGTISWLDANQLAEADEFEDKMKELEGICNPIIAKMYQ-GAAPDMGGGMGMD  630



>gb|EMT15100.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=1430

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVE+KNALENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI+ AIQWLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG D+  GMD+D
Sbjct  576  IEDAIDAAIQWLDTNQLAEADEFEDKMKELEALCNPIIAKMYQ-GAGADMEGGMDDD  631



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 117/138 (85%), Gaps = 8/138 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNT+KDEKI  KL P+DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTVKDEKIGEKLSPEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ A+ WLD NQLAEA EFEDKMKELE++CNPIIAKMYQGGAG    A MD+D   
Sbjct  576  IEDAIDGAVSWLDNNQLAEAGEFEDKMKELENVCNPIIAKMYQGGAGD---AAMDDD---  629

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  630  --VPAGGSGAGPKIEEVD  645



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+E+ EHKKKVEAKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  81   LSKEEIEKMVQEAEKYKSEETEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKK  140

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIE AIQWLDGNQL EADEFEDKMKELE ICNPII KMYQ
Sbjct  141  IEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIGKMYQ  183



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 8/140 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVE+KN+LENYAYNMRNTIKDEKI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQDAEKYKSEDEEHKKKVESKNSLENYAYNMRNTIKDEKIASKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV--AAGMDEDg  219
            IEDAI+ AI WLD NQLAEADEF+DKMKELES+CNPIIAKMYQ GAG D+  + GMDED 
Sbjct  576  IEDAIDAAISWLDANQLAEADEFDDKMKELESLCNPIIAKMYQ-GAGADMGGSGGMDED-  633

Query  218  psaggsgtgtgagPKIEEVD  159
                      G GPKIEEVD
Sbjct  634  ----APAGSGGPGPKIEEVD  649



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+ AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_009380663.1| PREDICTED: heat shock cognate 70 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 116/138 (84%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMV+E+E+YKA+DEEHKKKVEAKNALENYAYNMRNTI+D+KISSKL P DKKK
Sbjct  515  LSKEEIEKMVRESEKYKADDEEHKKKVEAKNALENYAYNMRNTIRDDKISSKLSPGDKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI++ I+WLD NQLAEADEFEDKMKELES+CNPIIAKMYQ G      AGMDE    
Sbjct  575  IEDAIDETIKWLDNNQLAEADEFEDKMKELESLCNPIIAKMYQNG-----GAGMDEGRAK  629

Query  212  aggsgtgtgagPKIEEVD  159
             G +    GAGP IEEVD
Sbjct  630  GGATAGAGGAGPTIEEVD  647



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSTDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELE ICNPIIA+MYQ
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELEGICNPIIARMYQ  618



>ref|XP_002465468.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
 gb|EER92466.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
Length=652

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDEE K+KVEA+NALENYAYNMRNT++DEKI+SKL  +DKKK
Sbjct  517  LSKEEIERMVQEAEKYKAEDEEVKRKVEARNALENYAYNMRNTVRDEKIASKLPAEDKKK  576

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IED +E AI+WLDGNQLAEA+EFED+MKELE++CNPII+KMYQGGAG   AAGMDED
Sbjct  577  IEDTVEDAIKWLDGNQLAEAEEFEDEMKELENVCNPIISKMYQGGAG---AAGMDED  630



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 106/129 (82%), Gaps = 19/129 (15%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  383  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKK  442

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ                 
Sbjct  443  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEEDAPPA  502

Query  263  --GGAGPDV  243
              GGAGP +
Sbjct  503  GSGGAGPKI  511



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTI+DEKI  KL   DKKK
Sbjct  515  LSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIEQAIQWL+ NQL EADEFEDKMKELESICNPIIAKMYQG  G   AAGMD+D   
Sbjct  575  IEDAIEQAIQWLENNQLGEADEFEDKMKELESICNPIIAKMYQGAGGE--AAGMDDD---  629

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  630  --APPASGGAGPKIEEVD  645



>emb|CDY40362.1| BnaA10g27060D [Brassica napus]
Length=454

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTI+DEKI  KL   DKKK
Sbjct  324  LSKDDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKK  383

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IE++IEQAIQWL+ NQL EADEFEDKMKELESICNPIIAKMYQG  G   AAGMD+D   
Sbjct  384  IEESIEQAIQWLENNQLGEADEFEDKMKELESICNPIIAKMYQGAGGE--AAGMDDD---  438

Query  212  aggsgtgtgagPKIEEVD  159
                    GAGPKIEEVD
Sbjct  439  --APPASGGAGPKIEEVD  454



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV++KNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKAEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE AI WLD NQLAEADEF+DKMKELE ICNPIIAKMYQ GAG ++  GMDED   
Sbjct  576  IEDAIEGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGAEMPGGMDED-AP  633

Query  212  aggsgtgtgagPKIEEVD  159
            A  +G  +G GPKIEEVD
Sbjct  634  ASAAGGSSGPGPKIEEVD  651



>gb|AGT97046.1| heat shock protein 70 [Capsicum annuum]
Length=652

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDE  KKKVEAKN+LENYAYNMRNT+KDEK S KL P DK+K
Sbjct  515  LSKEEIERMVQEAEKYKAEDESMKKKVEAKNSLENYAYNMRNTVKDEKFSGKLDPSDKQK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IE A+++ I+WLDGNQLAE DEFEDK+KELE++CNPIIAKMYQGGAG DV  G D     
Sbjct  575  IEKAVDETIEWLDGNQLAEVDEFEDKLKELENLCNPIIAKMYQGGAGGDVPMGADSGAGY  634

Query  212  aggsgtgtgagPKIEEVD  159
              G     G GPKIEEVD
Sbjct  635  GQGGSADNGPGPKIEEVD  652



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKN+LENYAYNMRNTIKDEKI SKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIGSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+ AIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDGAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  411  LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  470

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQA+QWLD NQLAEADEFEDKMKELESICNPI+AKMYQ
Sbjct  471  IEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQ  513



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 1/110 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKV+AKNALENYAYNMRNTIKDEKIS+KL   DKKK
Sbjct  609  LSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKK  668

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDV  243
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ GAG D+
Sbjct  669  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ-GAGADM  717



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 104/132 (79%), Gaps = 22/132 (17%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTI+DEKI  KL   DKKK
Sbjct  80   LSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKK  139

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IED+IEQAIQWL+GNQLAEADEFEDKMKELESICNPIIAKMYQ                 
Sbjct  140  IEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDD  199

Query  263  -----GGAGPDV  243
                 GGAGP +
Sbjct  200  APPASGGAGPKI  211



>ref|XP_004984743.1| PREDICTED: heat shock cognate 70 kDa protein-like [Setaria italica]
Length=650

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 3/138 (2%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YKAEDEE K+KVEA+NALENYAYNMRNT++D+KI+SKL  +D+KK
Sbjct  516  LSKEEIERMVQEAEKYKAEDEEVKRKVEARNALENYAYNMRNTVRDDKIASKLPAEDRKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IED IE AI+WLDGNQLAEA+EFEDKMKELE ICNPII+KMYQG  G   AAGMDED P+
Sbjct  576  IEDTIEDAIKWLDGNQLAEAEEFEDKMKELEGICNPIISKMYQGEGG---AAGMDEDVPN  632

Query  212  aggsgtgtgagPKIEEVD  159
              G+G G+GAGPKIEEVD
Sbjct  633  GAGTGGGSGAGPKIEEVD  650



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE MVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKIS+KL P DKKK
Sbjct  516  LSKEEIENMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKISAKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDA+EQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAVEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 4/139 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVEAKNALENYAYNMRNTIKD+KI+S+L   DKK+
Sbjct  511  LSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKR  570

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDg-p  216
            IEDAI++AI+WLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAG    A MDEDG  
Sbjct  571  IEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGGAG---GATMDEDGPS  627

Query  215  saggsgtgtgagPKIEEVD  159
              G +G+ TGAGPKIEEVD
Sbjct  628  VGGSAGSQTGAGPKIEEVD  646



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 104/113 (92%), Gaps = 1/113 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI +KL P DKK+
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLNPADKKR  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAG  234
            IEDA+EQ I WLD NQLAEADEFEDKMKELE++CNPIIAKMYQ GAG + AAG
Sbjct  576  IEDAVEQTINWLDSNQLAEADEFEDKMKELENMCNPIIAKMYQ-GAGGEPAAG  627



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 4/139 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVEAKNALENYAYNMRNTIKD+KI+S+L   DKK+
Sbjct  516  LSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKR  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDg-p  216
            IEDAI++AI+WLD NQLAEADEFEDKMKELESICNPIIAKMYQGGAG    A MDEDG  
Sbjct  576  IEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGGAG---GATMDEDGPS  632

Query  215  saggsgtgtgagPKIEEVD  159
              G +G+ TGAGPKIEEVD
Sbjct  633  VGGSAGSQTGAGPKIEEVD  651



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 20/130 (15%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  168  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKK  227

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IEDAI++AI WLD NQLAEADEFEDKMKELE++CNPIIAKMYQ                 
Sbjct  228  IEDAIDEAIAWLDANQLAEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGAGGMDEEPA  287

Query  263  ---GGAGPDV  243
               GGAGP +
Sbjct  288  PSGGGAGPKI  297



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLAPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDE+HKKKVEAKNALENYAYNMRNT+KDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWL+GNQL EADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLEGNQLGEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YKAEDEEHKKKV+AKN+LENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEDIEKMVQEAEKYKAEDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAI+ AI WLD NQLAEADEF+DKMKELE ICNPIIAKMYQ GAG ++  GMDED   
Sbjct  576  IEDAIDGAITWLDNNQLAEADEFDDKMKELEGICNPIIAKMYQ-GAGAEMPGGMDED-TP  633

Query  212  aggsgtgtgagPKIEEVD  159
            A  +G  +G GPKIEEVD
Sbjct  634  ASTAGGSSGPGPKIEEVD  651



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKL   DKKK
Sbjct  485  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLAAADKKK  544

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  545  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  587



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENY+YNMRNTIKD+KISSKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIKDDKISSKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            IEDAI+ AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQG  G
Sbjct  576  IEDAIDGAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGAGG  622



>ref|XP_008812036.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=647

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMV+EAE+YKAEDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL P DKKK
Sbjct  515  LSKEEIEKMVREAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPPADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQ I+WLDGNQLAEADEFEDKMKELES+CNPIIA+MYQ
Sbjct  575  IEDAIEQTIRWLDGNQLAEADEFEDKMKELESLCNPIIARMYQ  617



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLSPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIE AIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIESAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>emb|CAA55183.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 8/140 (6%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQ+AE+YK+EDEEHKKKVEAKN+LENY+YNMRNTIKDEKI+SKL  DDKKK
Sbjct  86   LSKEEIEKMVQDAEKYKSEDEEHKKKVEAKNSLENYSYNMRNTIKDEKIASKLPADDKKK  145

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVA--AGMDEDg  219
            IEDAI+ AI WLD +Q AEADEFE KMKELES+CNPIIAKMY+ GAG D+    GMDED 
Sbjct  146  IEDAIDAAISWLDADQPAEADEFEYKMKELESLCNPIIAKMYK-GAGEDMGRPGGMDED-  203

Query  218  psaggsgtgtgagPKIEEVD  159
                        GPKIEEVD
Sbjct  204  ----APAGSAAPGPKIEEVD  219



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKN+LENYAYNMRNTIKDEKI+SKL  +DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIASKLPAEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQL EADEFEDKMKELES+CNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDGNQLGEADEFEDKMKELESLCNPIIAKMYQ  618



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  515  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  575  IEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  617



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNT+KDEKI SKL P DKKK
Sbjct  516  LSKDEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK EDEEHKKKVEAKNALENYAYNMRNTI+DEKI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKGEDEEHKKKVEAKNALENYAYNMRNTIRDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDA+EQAIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ
Sbjct  576  IEDAVEQAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ  618



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPI+AKMYQ
Sbjct  576  IEDAIEQAIQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQ  618



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 105/121 (87%), Gaps = 6/121 (5%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKK+VEAKNALENYAYNMRNTIKD+KI++KL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKRVEAKNALENYAYNMRNTIKDDKIAAKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQG------GAGPDVAAGM  231
            IEDAIEQAIQWLD NQLAEADEFEDKMKELE+ICNPIIAKMYQ       G+ P  A G 
Sbjct  576  IEDAIEQAIQWLDNNQLAEADEFEDKMKELETICNPIIAKMYQAGGADMPGSAPPFAGGA  635

Query  230  D  228
            D
Sbjct  636  D  636



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKDEKI+SKL  DDK K
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDKTK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            I+DAIEQAIQWLDGNQLAEA+EFEDKMKELES+CNPIIAKMYQ
Sbjct  576  IDDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQ  618



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD++I SKL   DKK+
Sbjct  69   LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDQIGSKLSAADKKR  128

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IED IE+A+QWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  129  IEDTIEEAMQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  171



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL   DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKV+AKNALENYAYNMRNT+KDEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTVKDEKIGAKLPPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQAIQWLDNNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 106/129 (82%), Gaps = 19/129 (15%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE+KN+LENYAYNMRNT+KDEKISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ                 
Sbjct  576  IEDAIDQAIQWLDTNQLAEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEEDAPPA  635

Query  263  --GGAGPDV  243
              GGAGP +
Sbjct  636  GSGGAGPKI  644



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 118/138 (86%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK+EIEKMVQEAE+YK+EDEEHKKKVE+KNALENYAYNMRNTIKDEKI+SKL   DKKK
Sbjct  516  LSKDEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDAIE +IQWLD NQLAE+DEFEDKMKELESICNPIIAKMYQG  G    A MD+D   
Sbjct  576  IEDAIEASIQWLDANQLAESDEFEDKMKELESICNPIIAKMYQGAGG---EAPMDDD--E  630

Query  212  aggsgtgtgagPKIEEVD  159
            A  S  G+ AGPKIEEVD
Sbjct  631  AAPSHGGSTAGPKIEEVD  648



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KD+KISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>emb|CAA82915.1| heat shock protein 70 [Trifolium repens]
Length=127

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  557  IEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAI  378
            IEKMVQEAE+YK+EDEEHKKKVEAKN+LENYAYNMRNTIKD+KISSK    DKK+IEDAI
Sbjct  5    IEKMVQEAEKYKSEDEEHKKKVEAKNSLENYAYNMRNTIKDDKISSKHSAGDKKQIEDAI  64

Query  377  EQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAG  252
            E AIQWLD NQLAEADEFE KMKELE++CNPIIAKMYQGGAG
Sbjct  65   EGAIQWLDANQLAEADEFEHKMKELETVCNPIIAKMYQGGAG  106



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQA+QWLD NQLAEADEFEDKMKELESICNPI+AKMYQ
Sbjct  576  IEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQ  618



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQA+QWLD NQLAEADEFEDKMKELESICNPI+AKMYQ
Sbjct  576  IEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQ  618



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVEAKN LENYAYNMRNTIKD+K+SS+L   DKKK
Sbjct  518  LSKEEIERMVQEAEKYKSEDEELKKKVEAKNGLENYAYNMRNTIKDDKVSSQLPAADKKK  577

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI++AI+WLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAG    A MDED
Sbjct  578  IEDAIDEAIKWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAG---GATMDED  631



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKVEAKNALENYAYNMRNTI+DEKI++KL   DKKK
Sbjct  515  LSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIRDEKIAAKLPQADKKK  574

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQAI WLDGNQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  575  IEDAIEQAINWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  617



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 114/138 (83%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEE KKKVEAKN+LENYAYNMRNT+KDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA++QAI WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQ GAG D    MD+D   
Sbjct  576  IEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMYQ-GAGGDAGVPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  632  -APPSGGSSAGPKIEEVD  648



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 114/138 (83%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEE KKKVEAKN+LENYAYNMRNT+KDEKI SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA++QAI WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQ GAG D    MD+D   
Sbjct  576  IEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMYQ-GAGGDAGVPMDDD---  631

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  632  -APPSGGSSAGPKIEEVD  648



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 114/138 (83%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEE KKKVEAKN+LENYAYNMRNT+KDEKI SKL  DDKKK
Sbjct  518  LSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKK  577

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA++QAI WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQ GAG D    MD+D   
Sbjct  578  IEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMYQ-GAGGDAGVPMDDD---  633

Query  212  aggsgtgtgagPKIEEVD  159
                  G+ AGPKIEEVD
Sbjct  634  -APPSGGSSAGPKIEEVD  650



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVEAKNALENY+YNMRNTIKD+KISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 18/128 (14%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  296  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKK  355

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ-----------------  264
            IEDAI++AI WLD NQLAEADEFEDKMKELE++CNPIIAKMYQ                 
Sbjct  356  IEDAIDEAISWLDSNQLAEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGGMDEDAAPS  415

Query  263  -GGAGPDV  243
             GGAGP +
Sbjct  416  GGGAGPKI  423



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKA+DEEHKKKVEAKN+LENYAYNMRNT++DEK SSKL P DKKK
Sbjct  523  LSKEEIEKMVQEAEKYKADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKK  582

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQA+QWLD NQLAEADEFEDKMKELESICNPI+AKMYQ
Sbjct  583  IEDAIEQAVQWLDNNQLAEADEFEDKMKELESICNPIVAKMYQ  625



>gb|EMS51616.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=759

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSK++IEKMVQ+AE+YK+EDEEHKKKV+AKN+LENYAYNMRNTI+DEKI+SKL  DDKKK
Sbjct  552  LSKDDIEKMVQDAEKYKSEDEEHKKKVDAKNSLENYAYNMRNTIQDEKIASKLPADDKKK  611

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDA++ AIQWLD NQL E DEFEDKMKELE +CNPIIAKMYQ GAG D+  GMDED
Sbjct  612  IEDAVDAAIQWLDANQLGEVDEFEDKMKELEGLCNPIIAKMYQ-GAGADMPGGMDED  667



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIE+MVQEAE+YK+EDEE KKKVEAKN LENYAYNMRNTIKD+K+SS+L   DKKK
Sbjct  516  LSKEEIERMVQEAEKYKSEDEELKKKVEAKNGLENYAYNMRNTIKDDKVSSQLPAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDED  222
            IEDAI++AI+WLD NQLAEADEFEDKMKELES+CNPIIAKMYQGGAG    A MDED
Sbjct  576  IEDAIDEAIKWLDSNQLAEADEFEDKMKELESVCNPIIAKMYQGGAG---GATMDED  629



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKE+IEKMVQEAE+YK+EDEEHKKKVE KNALENYAYNMRNTIKD+KISSKL  DDKKK
Sbjct  516  LSKEDIEKMVQEAEKYKSEDEEHKKKVETKNALENYAYNMRNTIKDDKISSKLAADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAIQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIDQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENY+YNMRNT+KDEKI+SKL  +DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTVKDEKIASKLSAEDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIE+AIQWLDGNQLAEADEFEDKMKELE ICNPIIAKMYQ
Sbjct  576  IEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ  618



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+ DEKI +KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIEQ+IQWLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  576  IEDAIEQSIQWLDANQLAEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAIE AIQWLDGNQL EADEFEDKMKELE ICNPIIA+MYQ
Sbjct  576  IEDAIEGAIQWLDGNQLGEADEFEDKMKELEGICNPIIARMYQ  618



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKDEKI+SKL+  DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+QAI+WLDGNQLAEADEFEDKMKELES+CNPIIA+MYQ
Sbjct  576  IEDAIDQAIEWLDGNQLAEADEFEDKMKELESVCNPIIARMYQ  618



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YKAEDEEHKKKV+AKNALENYAYNMRNTIKD+KI+SKL  DDKKK
Sbjct  290  LSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDDKIASKLSADDKKK  349

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQ  264
            IEDAI+ AI WLD NQLAEADEFEDKMKELESICNPIIAKMYQ
Sbjct  350  IEDAIDGAINWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ  392



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 120/138 (87%), Gaps = 5/138 (4%)
 Frame = -3

Query  572  LSKEEIEKMVQEAEQYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLQPDDKKK  393
            LSKEEIEKMVQEAE+YK+EDEEHKKKVEAKNALENYAYNMRNT+KDEKI  KL P DKKK
Sbjct  516  LSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKK  575

Query  392  IEDAIEQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGGAGPDVAAGMDEDgps  213
            IEDA+EQ IQWLD NQL EADEFEDKMKELESICNPIIAKMYQGGAGPD+  GMD+D   
Sbjct  576  IEDAVEQTIQWLDSNQLGEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGGMDDD---  632

Query  212  aggsgtgtgagPKIEEVD  159
                  G+GAGPKIEEVD
Sbjct  633  --VPAGGSGAGPKIEEVD  648



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750