BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040O07

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006448759.1|  hypothetical protein CICLE_v10016613mg             224   6e-70   Citrus clementina [clementine]
ref|XP_007147528.1|  hypothetical protein PHAVU_006G132100g             223   2e-69   Phaseolus vulgaris [French bean]
ref|XP_008225792.1|  PREDICTED: vesicle-associated membrane prote...    222   3e-69   Prunus mume [ume]
ref|XP_007212008.1|  hypothetical protein PRUPE_ppa011167mg             222   4e-69   Prunus persica
ref|XP_007024899.1|  Vesicle-associated membrane protein 726 isof...    222   5e-69   Theobroma cacao [chocolate]
gb|KHN14368.1|  Putative vesicle-associated membrane protein 726        221   2e-68   Glycine soja [wild soybean]
ref|XP_010242074.1|  PREDICTED: vesicle-associated membrane prote...    219   4e-68   Nelumbo nucifera [Indian lotus]
ref|NP_001236634.1|  uncharacterized protein LOC100500089               219   4e-68   
emb|CDP18918.1|  unnamed protein product                                219   5e-68   Coffea canephora [robusta coffee]
gb|KJB69905.1|  hypothetical protein B456_011G049200                    219   6e-68   Gossypium raimondii
ref|XP_010092659.1|  Putative vesicle-associated membrane protein...    219   7e-68   Morus notabilis
ref|XP_003535044.1|  PREDICTED: vesicle-associated membrane prote...    219   7e-68   
ref|XP_011096786.1|  PREDICTED: vesicle-associated membrane prote...    219   8e-68   Sesamum indicum [beniseed]
ref|XP_009618936.1|  PREDICTED: vesicle-associated membrane prote...    218   2e-67   Nicotiana tomentosiformis
ref|XP_009802587.1|  PREDICTED: vesicle-associated membrane prote...    218   2e-67   Nicotiana sylvestris
ref|XP_008383321.1|  PREDICTED: vesicle-associated membrane prote...    218   2e-67   Malus domestica [apple tree]
ref|XP_002530145.1|  Vesicle-associated membrane protein, putative      217   4e-67   Ricinus communis
gb|KJB57020.1|  hypothetical protein B456_009G150900                    215   5e-67   Gossypium raimondii
ref|XP_009604671.1|  PREDICTED: vesicle-associated membrane prote...    216   7e-67   Nicotiana tomentosiformis
ref|XP_002276767.1|  PREDICTED: putative vesicle-associated membr...    215   2e-66   Vitis vinifera
ref|XP_006377004.1|  hypothetical protein POPTR_0012s12000g             214   3e-66   Populus trichocarpa [western balsam poplar]
gb|KJB57019.1|  hypothetical protein B456_009G150900                    214   4e-66   Gossypium raimondii
gb|AFY26886.1|  vesicle-associated membrane protein 72                  214   4e-66   Morella rubra [Chinese arbutus]
gb|EYU43691.1|  hypothetical protein MIMGU_mgv1a013245mg                214   5e-66   Erythranthe guttata [common monkey flower]
ref|XP_011016724.1|  PREDICTED: vesicle-associated membrane prote...    214   6e-66   Populus euphratica
gb|KDP29315.1|  hypothetical protein JCGZ_19410                         214   6e-66   Jatropha curcas
ref|XP_004233223.1|  PREDICTED: vesicle-associated membrane prote...    213   9e-66   
ref|XP_008459063.1|  PREDICTED: vesicle-associated membrane prote...    213   1e-65   Cucumis melo [Oriental melon]
gb|ACU19359.1|  unknown                                                 213   1e-65   Glycine max [soybeans]
ref|XP_006352702.1|  PREDICTED: putative vesicle-associated membr...    213   1e-65   Solanum tuberosum [potatoes]
ref|XP_002322360.1|  hypothetical protein POPTR_0015s15690g             213   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004145455.1|  PREDICTED: putative vesicle-associated membr...    212   4e-65   Cucumis sativus [cucumbers]
ref|XP_004242395.1|  PREDICTED: vesicle-associated membrane prote...    211   1e-64   
ref|XP_011040378.1|  PREDICTED: vesicle-associated membrane prote...    211   1e-64   Populus euphratica
ref|XP_009588661.1|  PREDICTED: vesicle-associated membrane prote...    210   2e-64   Nicotiana tomentosiformis
gb|KHN08022.1|  Putative vesicle-associated membrane protein 726        208   1e-63   Glycine soja [wild soybean]
ref|XP_004505324.1|  PREDICTED: vesicle-associated membrane prote...    208   1e-63   
ref|XP_010038359.1|  PREDICTED: vesicle-associated membrane prote...    207   2e-63   Eucalyptus grandis [rose gum]
ref|XP_003594451.1|  Vesicle-associated membrane protein                207   2e-63   
ref|XP_009787803.1|  PREDICTED: vesicle-associated membrane prote...    207   3e-63   Nicotiana sylvestris
ref|XP_006583934.1|  PREDICTED: vesicle-associated membrane prote...    207   4e-63   Glycine max [soybeans]
gb|ACJ84389.1|  unknown                                                 206   4e-63   Medicago truncatula
ref|XP_010069066.1|  PREDICTED: putative vesicle-associated membr...    206   7e-63   Eucalyptus grandis [rose gum]
ref|XP_003607843.1|  Vesicle-associated membrane protein                206   1e-62   
gb|AFK40215.1|  unknown                                                 206   1e-62   Medicago truncatula
gb|KJB57021.1|  hypothetical protein B456_009G150900                    204   2e-62   Gossypium raimondii
ref|XP_010522416.1|  PREDICTED: vesicle-associated membrane prote...    204   3e-62   Tarenaya hassleriana [spider flower]
gb|AFK36461.1|  unknown                                                 204   3e-62   Lotus japonicus
emb|CDY10053.1|  BnaC08g43980D                                          204   3e-62   Brassica napus [oilseed rape]
emb|CAN65946.1|  hypothetical protein VITISV_029427                     203   5e-62   Vitis vinifera
ref|XP_002264270.1|  PREDICTED: vesicle-associated membrane prote...    204   6e-62   Vitis vinifera
ref|XP_010522412.1|  PREDICTED: vesicle-associated membrane prote...    204   6e-62   Tarenaya hassleriana [spider flower]
emb|CDY19450.1|  BnaC04g11490D                                          203   7e-62   Brassica napus [oilseed rape]
ref|XP_002267063.1|  PREDICTED: vesicle-associated membrane prote...    203   9e-62   Vitis vinifera
ref|XP_002304708.1|  synptobrevin-related family protein                203   1e-61   Populus trichocarpa [western balsam poplar]
gb|KDP26403.1|  hypothetical protein JCGZ_17561                         203   1e-61   Jatropha curcas
gb|KJB37799.1|  hypothetical protein B456_006G220500                    201   1e-61   Gossypium raimondii
ref|XP_010932918.1|  PREDICTED: putative vesicle-associated membr...    202   1e-61   
ref|XP_011020669.1|  PREDICTED: vesicle-associated membrane prote...    202   2e-61   Populus euphratica
ref|XP_007049803.1|  Vesicle-associated membrane protein 726            202   2e-61   
ref|XP_010542985.1|  PREDICTED: vesicle-associated membrane prote...    202   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_011080177.1|  PREDICTED: vesicle-associated membrane prote...    202   2e-61   Sesamum indicum [beniseed]
ref|XP_010109710.1|  Putative vesicle-associated membrane protein...    202   2e-61   Morus notabilis
ref|XP_010556949.1|  PREDICTED: vesicle-associated membrane prote...    202   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_010264069.1|  PREDICTED: vesicle-associated membrane prote...    202   2e-61   Nelumbo nucifera [Indian lotus]
gb|EYU46345.1|  hypothetical protein MIMGU_mgv1a013442mg                202   2e-61   Erythranthe guttata [common monkey flower]
gb|KDP20321.1|  hypothetical protein JCGZ_06407                         202   2e-61   Jatropha curcas
ref|XP_010674670.1|  PREDICTED: vesicle-associated membrane prote...    202   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007034424.1|  Vesicle-associated membrane protein 726 isof...    202   3e-61   
ref|XP_010556950.1|  PREDICTED: vesicle-associated membrane prote...    202   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_009413307.1|  PREDICTED: vesicle-associated membrane prote...    202   3e-61   
emb|CDX79510.1|  BnaC03g18460D                                          202   4e-61   
ref|XP_009132911.1|  PREDICTED: vesicle-associated membrane prote...    201   4e-61   Brassica rapa
emb|CDY18254.1|  BnaC05g02770D                                          201   4e-61   Brassica napus [oilseed rape]
ref|XP_009143895.1|  PREDICTED: vesicle-associated membrane prote...    202   4e-61   Brassica rapa
ref|NP_001030968.1|  vesicle-associated membrane protein 7B             200   4e-61   
ref|XP_006420620.1|  hypothetical protein CICLE_v10005852mg             201   4e-61   
gb|KHG06809.1|  hypothetical protein F383_08210                         201   4e-61   Gossypium arboreum [tree cotton]
emb|CDX86608.1|  BnaC08g00950D                                          201   4e-61   
gb|KDO77465.1|  hypothetical protein CISIN_1g027612mg                   199   4e-61   Citrus sinensis [apfelsine]
ref|XP_006650747.1|  PREDICTED: vesicle-associated membrane prote...    201   4e-61   Oryza brachyantha
ref|XP_009119258.1|  PREDICTED: vesicle-associated membrane prote...    201   5e-61   Brassica rapa
ref|XP_006410450.1|  hypothetical protein EUTSA_v10017216mg             201   5e-61   Eutrema salsugineum [saltwater cress]
ref|XP_007034425.1|  Vesicle-associated membrane protein 726 isof...    201   5e-61   
ref|XP_010509926.1|  PREDICTED: vesicle-associated membrane prote...    201   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010241141.1|  PREDICTED: putative vesicle-associated membr...    201   5e-61   Nelumbo nucifera [Indian lotus]
ref|NP_180871.1|  vesicle-associated membrane protein 722               201   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371850.1|  PREDICTED: vesicle-associated membrane prote...    201   6e-61   
ref|NP_001031469.1|  vesicle-associated membrane protein 722            201   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775432.1|  PREDICTED: vesicle-associated membrane prote...    201   6e-61   
gb|EPS70718.1|  hypothetical protein M569_04041                         201   7e-61   Genlisea aurea
ref|XP_002881263.1|  hypothetical protein ARALYDRAFT_482248             201   8e-61   
ref|XP_009627066.1|  PREDICTED: vesicle-associated membrane prote...    201   8e-61   Nicotiana tomentosiformis
ref|XP_008235502.1|  PREDICTED: vesicle-associated membrane prote...    201   8e-61   Prunus mume [ume]
ref|XP_011083121.1|  PREDICTED: vesicle-associated membrane prote...    201   9e-61   Sesamum indicum [beniseed]
ref|XP_006294968.1|  hypothetical protein CARUB_v10024024mg             201   1e-60   Capsella rubella
emb|CDP03855.1|  unnamed protein product                                200   1e-60   Coffea canephora [robusta coffee]
ref|XP_002521112.1|  Vesicle-associated membrane protein, putative      200   1e-60   Ricinus communis
ref|XP_006304190.1|  hypothetical protein CARUB_v10010251mg             200   1e-60   Capsella rubella
ref|XP_002892239.1|  vesicle-associated membrane protein 7B             200   1e-60   Arabidopsis lyrata subsp. lyrata
gb|KFK42812.1|  hypothetical protein AALP_AA1G041800                    200   1e-60   Arabis alpina [alpine rockcress]
ref|XP_010475139.1|  PREDICTED: vesicle-associated membrane prote...    200   1e-60   Camelina sativa [gold-of-pleasure]
gb|AAB80624.1|  Strong similarity to Arabidopsis ATHSAR1 (gb|M904...    198   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB37798.1|  hypothetical protein B456_006G220500                    200   2e-60   Gossypium raimondii
gb|KFK31144.1|  hypothetical protein AALP_AA6G074500                    199   3e-60   Arabis alpina [alpine rockcress]
ref|XP_006443628.1|  hypothetical protein CICLE_v10022162mg             199   3e-60   Citrus clementina [clementine]
ref|XP_003535217.1|  PREDICTED: putative vesicle-associated membr...    199   3e-60   Glycine max [soybeans]
gb|KCW57284.1|  hypothetical protein EUGRSUZ_H00084                     204   3e-60   Eucalyptus grandis [rose gum]
ref|XP_004134008.1|  PREDICTED: putative vesicle-associated membr...    199   3e-60   Cucumis sativus [cucumbers]
ref|XP_009336053.1|  PREDICTED: vesicle-associated membrane prote...    198   3e-60   Pyrus x bretschneideri [bai li]
emb|CDY06150.1|  BnaA09g50530D                                          199   3e-60   
ref|XP_009118621.1|  PREDICTED: vesicle-associated membrane prote...    199   4e-60   Brassica rapa
ref|NP_001280954.1|  putative vesicle-associated membrane protein...    199   4e-60   Malus domestica [apple tree]
ref|XP_008438380.1|  PREDICTED: putative vesicle-associated membr...    199   4e-60   Cucumis melo [Oriental melon]
gb|ADK78986.1|  VAMP721                                                 199   4e-60   Petunia integrifolia subsp. inflata
ref|XP_009371395.1|  PREDICTED: putative vesicle-associated membr...    199   4e-60   Pyrus x bretschneideri [bai li]
ref|XP_009351028.1|  PREDICTED: putative vesicle-associated membr...    199   4e-60   Pyrus x bretschneideri [bai li]
ref|NP_171967.1|  vesicle-associated membrane protein 7B                199   4e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43410.1|  putative vesicle-associated membrane protein, sy...    199   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803805.1|  PREDICTED: putative vesicle-associated membr...    199   5e-60   
gb|EYU17981.1|  hypothetical protein MIMGU_mgv1a013452mg                199   5e-60   Erythranthe guttata [common monkey flower]
gb|ABK22119.1|  unknown                                                 199   5e-60   Picea sitchensis
ref|XP_006418096.1|  hypothetical protein EUTSA_v10008729mg             199   5e-60   Eutrema salsugineum [saltwater cress]
ref|XP_003556884.1|  PREDICTED: putative vesicle-associated membr...    198   6e-60   Glycine max [soybeans]
emb|CDY15521.1|  BnaA08g28050D                                          198   7e-60   Brassica napus [oilseed rape]
ref|XP_007200442.1|  hypothetical protein PRUPE_ppa011218mg             198   8e-60   Prunus persica
gb|AAA56991.1|  formerly called HAT24; synaptobrevin-related protein    198   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004247095.1|  PREDICTED: vesicle-associated membrane prote...    198   8e-60   
gb|EYU31743.1|  hypothetical protein MIMGU_mgv1a013482mg                198   9e-60   Erythranthe guttata [common monkey flower]
ref|XP_009111083.1|  PREDICTED: vesicle-associated membrane prote...    198   9e-60   Brassica rapa
emb|CDX79466.1|  BnaC03g18020D                                          196   9e-60   
gb|KJB10140.1|  hypothetical protein B456_001G186000                    198   1e-59   Gossypium raimondii
ref|XP_009370116.1|  PREDICTED: putative vesicle-associated membr...    198   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_008380599.1|  PREDICTED: putative vesicle-associated membr...    198   1e-59   Malus domestica [apple tree]
gb|AAQ15287.1|  synptobrevin-related protein                            197   1e-59   Pyrus pyrifolia [sha li]
ref|XP_004290222.1|  PREDICTED: vesicle-associated membrane prote...    197   1e-59   Fragaria vesca subsp. vesca
ref|XP_008372458.1|  PREDICTED: putative vesicle-associated membr...    197   2e-59   
ref|XP_002889523.1|  vesicle-associated membrane protein 7B             197   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_006364264.1|  PREDICTED: vesicle-associated membrane prote...    197   2e-59   Solanum tuberosum [potatoes]
ref|XP_009335952.1|  PREDICTED: putative vesicle-associated membr...    197   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_010910152.1|  PREDICTED: vesicle-associated membrane prote...    197   2e-59   
ref|XP_002518125.1|  Vesicle-associated membrane protein, putative      197   2e-59   Ricinus communis
ref|NP_171968.1|  vesicle-associated membrane protein 726               196   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417150.1|  PREDICTED: vesicle-associated membrane prote...    196   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398406.1|  PREDICTED: putative vesicle-associated membr...    196   4e-59   
gb|KFK42811.1|  hypothetical protein AALP_AA1G041700                    196   4e-59   Arabis alpina [alpine rockcress]
ref|XP_003604990.1|  Vesicle-associated membrane protein                196   4e-59   Medicago truncatula
ref|XP_010069661.1|  PREDICTED: vesicle-associated membrane prote...    196   4e-59   Eucalyptus grandis [rose gum]
ref|XP_009132860.1|  PREDICTED: putative vesicle-associated membr...    196   5e-59   Brassica rapa
ref|XP_010475140.1|  PREDICTED: putative vesicle-associated membr...    196   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010457534.1|  PREDICTED: putative vesicle-associated membr...    196   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006857408.1|  hypothetical protein AMTR_s00067p00148060          196   6e-59   
ref|XP_004293741.1|  PREDICTED: putative vesicle-associated membr...    196   6e-59   Fragaria vesca subsp. vesca
ref|XP_004152023.1|  PREDICTED: putative vesicle-associated membr...    195   1e-58   Cucumis sativus [cucumbers]
ref|XP_006293513.1|  hypothetical protein CARUB_v10024029mg             195   1e-58   Capsella rubella
emb|CDY59642.1|  BnaAnng16140D                                          193   2e-58   Brassica napus [oilseed rape]
ref|XP_008465086.1|  PREDICTED: vesicle-associated membrane prote...    195   2e-58   Cucumis melo [Oriental melon]
ref|XP_006306317.1|  hypothetical protein CARUB_v10012187mg             194   2e-58   Capsella rubella
gb|KFK31080.1|  hypothetical protein AALP_AA6G065800                    194   2e-58   Arabis alpina [alpine rockcress]
emb|CDO99425.1|  unnamed protein product                                193   2e-58   Coffea canephora [robusta coffee]
gb|AAC04496.1|  putative synaptobrevin                                  194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034474.1|  PREDICTED: vesicle-associated membrane prote...    194   3e-58   Populus euphratica
gb|KEH41273.1|  synaptobrevin-like protein                              194   3e-58   Medicago truncatula
dbj|BAJ88124.1|  predicted protein                                      194   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010326818.1|  PREDICTED: putative vesicle-associated membr...    192   4e-58   
ref|XP_009143949.1|  PREDICTED: putative vesicle-associated membr...    194   4e-58   Brassica rapa
ref|XP_009408466.1|  PREDICTED: vesicle-associated membrane prote...    194   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002297816.2|  hypothetical protein POPTR_0001s14430g             194   5e-58   
ref|XP_007157801.1|  hypothetical protein PHAVU_002G099400g             193   8e-58   Phaseolus vulgaris [French bean]
ref|XP_011016158.1|  PREDICTED: vesicle-associated membrane prote...    193   8e-58   Populus euphratica
ref|XP_009621355.1|  PREDICTED: putative vesicle-associated membr...    193   8e-58   Nicotiana tomentosiformis
ref|XP_008224587.1|  PREDICTED: putative vesicle-associated membr...    193   8e-58   Prunus mume [ume]
ref|XP_007226125.1|  hypothetical protein PRUPE_ppa011188mg             193   9e-58   Prunus persica
ref|XP_010469563.1|  PREDICTED: vesicle-associated membrane prote...    193   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009767969.1|  PREDICTED: putative vesicle-associated membr...    192   1e-57   Nicotiana sylvestris
ref|XP_010413966.1|  PREDICTED: putative vesicle-associated membr...    192   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010413912.1|  PREDICTED: vesicle-associated membrane prote...    192   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010413913.1|  PREDICTED: vesicle-associated membrane prote...    192   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006360344.1|  PREDICTED: vesicle-associated membrane prote...    192   3e-57   Solanum tuberosum [potatoes]
ref|XP_010524695.1|  PREDICTED: putative vesicle-associated membr...    192   3e-57   Tarenaya hassleriana [spider flower]
ref|NP_180826.2|  vesicle-associated membrane protein 725               194   3e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19154.1|  BnaA04g18940D                                          191   3e-57   Brassica napus [oilseed rape]
ref|XP_003622969.1|  Vesicle-associated membrane protein                191   3e-57   Medicago truncatula
gb|EPS61521.1|  hypothetical protein M569_13274                         191   4e-57   Genlisea aurea
ref|XP_004247839.1|  PREDICTED: putative vesicle-associated membr...    191   4e-57   Solanum lycopersicum
gb|KJB42279.1|  hypothetical protein B456_007G153200                    191   4e-57   Gossypium raimondii
ref|XP_002879406.1|  hypothetical protein ARALYDRAFT_482195             191   5e-57   
ref|XP_010314763.1|  PREDICTED: putative vesicle-associated membr...    190   5e-57   
ref|XP_010326817.1|  PREDICTED: putative vesicle-associated membr...    191   5e-57   
ref|XP_006410397.1|  hypothetical protein EUTSA_v10017717mg             192   6e-57   
ref|XP_007140570.1|  hypothetical protein PHAVU_008G123800g             189   6e-57   Phaseolus vulgaris [French bean]
ref|XP_004955737.1|  PREDICTED: vesicle-associated membrane prote...    191   7e-57   Setaria italica
ref|XP_009608699.1|  PREDICTED: putative vesicle-associated membr...    191   8e-57   Nicotiana tomentosiformis
ref|XP_004514024.1|  PREDICTED: putative vesicle-associated membr...    191   8e-57   Cicer arietinum [garbanzo]
ref|XP_009757440.1|  PREDICTED: putative vesicle-associated membr...    190   9e-57   Nicotiana sylvestris
gb|KHM99990.1|  Putative vesicle-associated membrane protein 726        191   9e-57   Glycine soja [wild soybean]
gb|KJB22568.1|  hypothetical protein B456_004G058500                    190   9e-57   Gossypium raimondii
ref|XP_006349937.1|  PREDICTED: vesicle-associated membrane prote...    189   1e-56   Solanum tuberosum [potatoes]
ref|XP_007145403.1|  hypothetical protein PHAVU_007G235900g             190   1e-56   Phaseolus vulgaris [French bean]
ref|XP_004296647.1|  PREDICTED: putative vesicle-associated membr...    190   2e-56   Fragaria vesca subsp. vesca
ref|XP_002303031.1|  hypothetical protein POPTR_0002s24200g             189   2e-56   
ref|NP_001241434.1|  uncharacterized protein LOC100804314               189   2e-56   Glycine max [soybeans]
tpg|DAA59924.1|  TPA: putative vesicle-associated membrane protei...    187   2e-56   
ref|XP_009141263.1|  PREDICTED: vesicle-associated membrane prote...    189   2e-56   Brassica rapa
gb|KJB71677.1|  hypothetical protein B456_011G160700                    189   3e-56   Gossypium raimondii
ref|XP_003532299.1|  PREDICTED: vesicle-associated membrane prote...    189   4e-56   Glycine max [soybeans]
gb|AAF40460.1|AC004809_18  Strong similarity to the synaptobrevin...    189   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71680.1|  hypothetical protein M569_03080                         188   5e-56   Genlisea aurea
tpg|DAA42468.1|  TPA: putative vesicle-associated membrane protei...    187   5e-56   
ref|XP_004253005.1|  PREDICTED: putative vesicle-associated membr...    188   6e-56   Solanum lycopersicum
ref|XP_008234811.1|  PREDICTED: putative vesicle-associated membr...    188   6e-56   Prunus mume [ume]
ref|XP_004506588.1|  PREDICTED: vesicle-associated membrane prote...    188   6e-56   Cicer arietinum [garbanzo]
ref|XP_009335953.1|  PREDICTED: putative vesicle-associated membr...    188   6e-56   
gb|KCW62998.1|  hypothetical protein EUGRSUZ_G00599                     187   7e-56   Eucalyptus grandis [rose gum]
emb|CDY48531.1|  BnaC04g43180D                                          188   7e-56   Brassica napus [oilseed rape]
ref|XP_007140571.1|  hypothetical protein PHAVU_008G123800g             188   7e-56   Phaseolus vulgaris [French bean]
ref|XP_010068178.1|  PREDICTED: vesicle-associated membrane prote...    188   7e-56   
ref|XP_011091409.1|  PREDICTED: vesicle-associated membrane prote...    187   1e-55   Sesamum indicum [beniseed]
ref|XP_006349936.1|  PREDICTED: vesicle-associated membrane prote...    187   1e-55   Solanum tuberosum [potatoes]
ref|NP_001148792.1|  vesicle-associated membrane protein 725            187   3e-55   Zea mays [maize]
ref|XP_002459506.1|  hypothetical protein SORBIDRAFT_02g005730          186   3e-55   Sorghum bicolor [broomcorn]
ref|XP_010547078.1|  PREDICTED: vesicle-associated membrane prote...    187   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_010065488.1|  PREDICTED: vesicle-associated membrane prote...    186   3e-55   Eucalyptus grandis [rose gum]
ref|XP_011073775.1|  PREDICTED: putative vesicle-associated membr...    186   3e-55   Sesamum indicum [beniseed]
ref|XP_010547077.1|  PREDICTED: vesicle-associated membrane prote...    186   5e-55   Tarenaya hassleriana [spider flower]
gb|KJB33092.1|  hypothetical protein B456_006G056000                    185   7e-55   Gossypium raimondii
ref|XP_010923320.1|  PREDICTED: vesicle-associated membrane prote...    185   1e-54   
ref|XP_010065491.1|  PREDICTED: vesicle-associated membrane prote...    184   3e-54   Eucalyptus grandis [rose gum]
ref|NP_001059109.1|  Os07g0194000                                       184   3e-54   
gb|KDO77463.1|  hypothetical protein CISIN_1g027612mg                   183   4e-54   Citrus sinensis [apfelsine]
gb|AFK47779.1|  unknown                                                 183   4e-54   Medicago truncatula
gb|KJB22567.1|  hypothetical protein B456_004G058500                    183   5e-54   Gossypium raimondii
ref|NP_001051606.1|  Os03g0803000                                       183   6e-54   
ref|XP_006657530.1|  PREDICTED: vesicle-associated membrane prote...    183   7e-54   Oryza brachyantha
ref|XP_004981381.1|  PREDICTED: vesicle-associated membrane prote...    183   7e-54   Setaria italica
ref|XP_009418833.1|  PREDICTED: vesicle-associated membrane prote...    182   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004514025.1|  PREDICTED: putative vesicle-associated membr...    182   2e-53   Cicer arietinum [garbanzo]
gb|KJB42280.1|  hypothetical protein B456_007G153200                    182   2e-53   Gossypium raimondii
ref|XP_010934067.1|  PREDICTED: putative vesicle-associated membr...    181   3e-53   
ref|XP_010065492.1|  PREDICTED: vesicle-associated membrane prote...    181   3e-53   Eucalyptus grandis [rose gum]
gb|EAZ25708.1|  hypothetical protein OsJ_09541                          180   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808719.1|  PREDICTED: vesicle-associated membrane prote...    181   6e-53   
gb|KEH41272.1|  synaptobrevin-like protein                              177   7e-53   Medicago truncatula
gb|KDO77468.1|  hypothetical protein CISIN_1g027612mg                   179   1e-52   Citrus sinensis [apfelsine]
ref|XP_003557429.1|  PREDICTED: vesicle-associated membrane prote...    180   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_006649451.1|  PREDICTED: putative vesicle-associated membr...    180   1e-52   Oryza brachyantha
ref|XP_006448758.1|  hypothetical protein CICLE_v10016613mg             178   1e-52   
ref|XP_010684935.1|  PREDICTED: vesicle-associated membrane prote...    179   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008651398.1|  PREDICTED: putative vesicle-associated membr...    179   2e-52   
ref|XP_010065490.1|  PREDICTED: vesicle-associated membrane prote...    179   3e-52   Eucalyptus grandis [rose gum]
gb|EMT18448.1|  Putative vesicle-associated membrane protein 726        180   3e-52   
ref|XP_008651397.1|  PREDICTED: putative vesicle-associated membr...    179   3e-52   
gb|AFK39584.1|  unknown                                                 178   3e-52   Lotus japonicus
ref|XP_004492323.1|  PREDICTED: vesicle-associated membrane prote...    179   3e-52   Cicer arietinum [garbanzo]
ref|NP_001049070.1|  Os03g0165800                                       179   3e-52   
ref|XP_009388457.1|  PREDICTED: vesicle-associated membrane prote...    178   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149329.1|  vesicle-associated membrane protein 725            178   4e-52   Zea mays [maize]
ref|XP_004985586.1|  PREDICTED: putative vesicle-associated membr...    178   7e-52   Setaria italica
ref|XP_004985585.1|  PREDICTED: putative vesicle-associated membr...    177   8e-52   Setaria italica
gb|AFK40729.1|  unknown                                                 176   2e-51   Lotus japonicus
ref|XP_008660540.1|  PREDICTED: putative vesicle-associated membr...    176   3e-51   Zea mays [maize]
ref|XP_008660539.1|  PREDICTED: putative vesicle-associated membr...    176   4e-51   Zea mays [maize]
gb|ACU18382.1|  unknown                                                 174   5e-51   Glycine max [soybeans]
gb|ACO87682.1|  synaptobrevin-like protein                              175   9e-51   Brachypodium sylvaticum
ref|XP_002466264.1|  hypothetical protein SORBIDRAFT_01g004700          175   9e-51   
ref|XP_003558739.1|  PREDICTED: putative vesicle-associated membr...    175   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_003577814.1|  PREDICTED: putative vesicle-associated membr...    175   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_008644423.1|  PREDICTED: vesicle-associated membrane prote...    174   1e-50   
ref|XP_009141288.1|  PREDICTED: vesicle-associated membrane prote...    174   1e-50   Brassica rapa
gb|KCW50174.1|  hypothetical protein EUGRSUZ_K03606                     174   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010228179.1|  PREDICTED: vesicle-associated membrane prote...    174   3e-50   Brachypodium distachyon [annual false brome]
emb|CDY37751.1|  BnaA04g19170D                                          173   6e-50   Brassica napus [oilseed rape]
gb|EEC81677.1|  hypothetical protein OsI_25239                          173   8e-50   Oryza sativa Indica Group [Indian rice]
gb|KFK31079.1|  hypothetical protein AALP_AA6G065700                    172   8e-50   Arabis alpina [alpine rockcress]
emb|CDY23768.1|  BnaC04g43540D                                          170   1e-49   Brassica napus [oilseed rape]
ref|XP_001777330.1|  R-SNARE, VAMP72-family                             172   1e-49   
ref|XP_002960391.1|  hypothetical protein SELMODRAFT_164037             172   2e-49   Selaginella moellendorffii
ref|XP_002967324.1|  hypothetical protein SELMODRAFT_86867              171   2e-49   Selaginella moellendorffii
ref|XP_002986717.1|  hypothetical protein SELMODRAFT_235084             171   4e-49   Selaginella moellendorffii
ref|XP_008662658.1|  PREDICTED: vesicle-associated membrane prote...    171   4e-49   
gb|KJB57023.1|  hypothetical protein B456_009G150900                    170   6e-49   
gb|KHG23670.1|  vesicle-associated membrane protein                     170   1e-48   
ref|XP_001784148.1|  R-SNARE, VAMP72-family                             169   1e-48   
gb|ABK24294.1|  unknown                                                 169   2e-48   
ref|XP_004138954.1|  PREDICTED: putative vesicle-associated membr...    169   2e-48   
ref|XP_007140572.1|  hypothetical protein PHAVU_008G123900g             169   2e-48   
ref|XP_006664247.1|  PREDICTED: vesicle-associated membrane prote...    168   4e-48   
ref|XP_002468451.1|  hypothetical protein SORBIDRAFT_01g046130          167   1e-47   
gb|KCW63002.1|  hypothetical protein EUGRSUZ_G00602                     166   1e-47   
ref|XP_008457254.1|  PREDICTED: vesicle-associated membrane prote...    166   2e-47   
ref|XP_004963344.1|  PREDICTED: putative vesicle-associated membr...    166   2e-47   
gb|KDO49381.1|  hypothetical protein CISIN_1g0277592mg                  164   4e-47   
ref|XP_008223166.1|  PREDICTED: vesicle-associated membrane prote...    165   6e-47   
gb|KJB12630.1|  hypothetical protein B456_002G028200                    162   1e-46   
gb|KHG28831.1|  Vesicle-associated membrane protein                     165   1e-46   
ref|XP_011020670.1|  PREDICTED: vesicle-associated membrane prote...    163   2e-46   
ref|XP_007226119.1|  hypothetical protein PRUPE_ppa011159mg             164   2e-46   
gb|ABK27118.1|  unknown                                                 162   6e-46   
ref|XP_002273101.1|  PREDICTED: vesicle-associated membrane prote...    162   6e-46   
ref|XP_008390678.1|  PREDICTED: vesicle-associated membrane prote...    162   1e-45   
gb|AAS88558.1|  putative synaptobrevin                                  161   1e-45   
ref|XP_006414448.1|  hypothetical protein EUTSA_v10026189mg             160   3e-45   
gb|AAV49990.1|  putative synaptobrevin/VAMP                             160   4e-45   
ref|NP_001242377.1|  uncharacterized protein LOC100781950               160   5e-45   
gb|KFK44987.1|  hypothetical protein AALP_AA1G329300                    160   5e-45   
ref|XP_006582892.1|  PREDICTED: uncharacterized protein LOC100781...    160   5e-45   
ref|XP_003550254.1|  PREDICTED: vesicle-associated membrane prote...    160   7e-45   
emb|CAJ13552.1|  unnamed protein product                                160   7e-45   
ref|XP_009343983.1|  PREDICTED: vesicle-associated membrane prote...    160   8e-45   
ref|XP_010259650.1|  PREDICTED: vesicle-associated membrane prote...    159   9e-45   
gb|KJB12629.1|  hypothetical protein B456_002G028200                    160   1e-44   
emb|CAJ13539.1|  unnamed protein product                                160   1e-44   
ref|XP_004296828.1|  PREDICTED: vesicle-associated membrane prote...    159   1e-44   
sp|O23429.2|VA724_ARATH  RecName: Full=Vesicle-associated membran...    159   1e-44   
ref|XP_002868180.1|  hypothetical protein ARALYDRAFT_915207             159   1e-44   
ref|XP_003622943.1|  Vesicle-associated membrane protein                159   1e-44   
gb|ACJ84394.1|  unknown                                                 159   1e-44   
ref|XP_010449891.1|  PREDICTED: vesicle-associated membrane prote...    159   2e-44   
ref|XP_007154271.1|  hypothetical protein PHAVU_003G104700g             159   2e-44   
gb|KHG06808.1|  hypothetical protein F383_08210                         160   2e-44   
ref|XP_009352245.1|  PREDICTED: vesicle-associated membrane prote...    159   2e-44   
gb|KHG15268.1|  Vesicle-associated membrane protein                     159   2e-44   
ref|XP_010434919.1|  PREDICTED: vesicle-associated membrane prote...    158   2e-44   
emb|CAJ15414.1|  unnamed protein product                                158   3e-44   
ref|XP_010551064.1|  PREDICTED: vesicle-associated membrane prote...    158   3e-44   
ref|XP_006419598.1|  hypothetical protein CICLE_v10005844mg             158   4e-44   
ref|XP_006855544.1|  hypothetical protein AMTR_s00057p00217050          158   4e-44   
ref|XP_008392281.1|  PREDICTED: vesicle-associated membrane prote...    157   4e-44   
ref|XP_004171337.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    157   5e-44   
gb|AFK38247.1|  unknown                                                 157   5e-44   
ref|XP_009146719.1|  PREDICTED: vesicle-associated membrane prote...    157   5e-44   
ref|XP_006284495.1|  hypothetical protein CARUB_v10005687mg             157   5e-44   
ref|XP_007035565.1|  Vesicle-associated membrane protein 724            157   5e-44   
ref|NP_193313.5|  vesicle-associated membrane protein 724               157   5e-44   
emb|CAJ13968.1|  unnamed protein product                                157   6e-44   
ref|XP_007138903.1|  hypothetical protein PHAVU_009G247400g             157   6e-44   
emb|CDY22900.1|  BnaA01g18380D                                          157   6e-44   
ref|XP_004487861.1|  PREDICTED: vesicle-associated membrane prote...    157   7e-44   
emb|CDY44179.1|  BnaC01g22290D                                          157   7e-44   
gb|KCW63001.1|  hypothetical protein EUGRSUZ_G00601                     155   8e-44   
ref|XP_010037394.1|  PREDICTED: vesicle-associated membrane prote...    157   8e-44   
ref|XP_004143088.1|  PREDICTED: vesicle-associated membrane prote...    157   9e-44   
ref|XP_010931625.1|  PREDICTED: vesicle-associated membrane prote...    157   1e-43   
ref|NP_001237046.1|  uncharacterized protein LOC100527252               156   1e-43   
gb|KJB33093.1|  hypothetical protein B456_006G056000                    155   2e-43   
ref|XP_002516908.1|  Vesicle-associated membrane protein, putative      156   2e-43   
gb|EMT03059.1|  Putative vesicle-associated membrane protein 726        157   2e-43   
gb|AES87177.2|  synaptobrevin-like protein                              152   3e-43   
ref|XP_003604980.1|  Vesicle-associated membrane protein                152   3e-43   
gb|KDP27786.1|  hypothetical protein JCGZ_18866                         154   5e-43   
ref|XP_008458455.1|  PREDICTED: vesicle-associated membrane prote...    155   5e-43   
ref|XP_011071446.1|  PREDICTED: vesicle-associated membrane prote...    155   6e-43   
gb|KJB38624.1|  hypothetical protein B456_006G263500                    154   7e-43   
ref|NP_001067392.2|  Os12g0639800                                       154   9e-43   
gb|ABK23325.1|  unknown                                                 154   1e-42   
ref|XP_003533403.1|  PREDICTED: vesicle-associated membrane prote...    153   2e-42   
gb|EYU43939.1|  hypothetical protein MIMGU_mgv1a024116mg                151   2e-42   
gb|ACG34366.1|  vesicle-associated membrane protein 725                 155   3e-42   
ref|XP_006389238.1|  hypothetical protein POPTR_0034s00330g             153   3e-42   
emb|CDY19156.1|  BnaA04g18960D                                          150   3e-42   
ref|XP_003552141.1|  PREDICTED: vesicle-associated membrane prote...    152   3e-42   
ref|XP_011045447.1|  PREDICTED: vesicle-associated membrane prote...    153   3e-42   
ref|XP_008800852.1|  PREDICTED: vesicle-associated membrane prote...    153   4e-42   
ref|XP_006342793.1|  PREDICTED: vesicle-associated membrane prote...    152   6e-42   
ref|XP_009784059.1|  PREDICTED: vesicle-associated membrane prote...    152   8e-42   
emb|CDP19534.1|  unnamed protein product                                151   1e-41   
ref|XP_010024689.1|  PREDICTED: vesicle-associated membrane prote...    151   1e-41   
gb|KHG04679.1|  Vesicle-associated membrane protein                     151   1e-41   
ref|XP_004229234.1|  PREDICTED: vesicle-associated membrane prote...    151   1e-41   
ref|XP_009107862.1|  PREDICTED: vesicle-associated membrane prote...    150   2e-41   
ref|XP_009592498.1|  PREDICTED: vesicle-associated membrane prote...    150   2e-41   
emb|CDY22757.1|  BnaA08g05870D                                          150   2e-41   
ref|XP_002269134.1|  PREDICTED: vesicle-associated membrane prote...    150   3e-41   
ref|XP_007142865.1|  hypothetical protein PHAVU_007G023300g             150   4e-41   
gb|KHG13199.1|  vesicle-associated membrane protein                     151   6e-41   
ref|XP_002515759.1|  Vesicle-associated membrane protein, putative      150   6e-41   
gb|KDO77466.1|  hypothetical protein CISIN_1g027612mg                   148   9e-41   
ref|XP_011090953.1|  PREDICTED: vesicle-associated membrane prote...    149   9e-41   
ref|XP_008788949.1|  PREDICTED: vesicle-associated membrane prote...    149   1e-40   
gb|KDP43378.1|  hypothetical protein JCGZ_26478                         149   1e-40   
gb|KJB22566.1|  hypothetical protein B456_004G058500                    148   2e-40   
gb|KDO77469.1|  hypothetical protein CISIN_1g027612mg                   146   2e-40   
ref|NP_001059291.1|  Os07g0249200                                       149   2e-40   
ref|XP_008806092.1|  PREDICTED: vesicle-associated membrane prote...    148   3e-40   
ref|XP_006658441.1|  PREDICTED: vesicle-associated membrane prote...    146   5e-40   
gb|KEH22818.1|  synaptobrevin-like protein                              144   6e-40   
tpg|DAA42471.1|  TPA: putative vesicle-associated membrane protei...    146   6e-40   
ref|XP_007024900.1|  Vesicle-associated membrane protein 726 isof...    145   6e-40   
ref|XP_003555880.1|  PREDICTED: vesicle-associated membrane prote...    147   7e-40   
ref|XP_010024691.1|  PREDICTED: vesicle-associated membrane prote...    147   7e-40   
tpg|DAA42470.1|  TPA: putative vesicle-associated membrane protei...    145   8e-40   
ref|XP_010245408.1|  PREDICTED: vesicle-associated membrane prote...    147   9e-40   
gb|ACU23563.1|  unknown                                                 146   2e-39   
ref|XP_003536697.1|  PREDICTED: vesicle-associated membrane prote...    146   2e-39   
ref|XP_010943829.1|  PREDICTED: vesicle-associated membrane prote...    146   2e-39   
gb|AFK42000.1|  unknown                                                 145   3e-39   
ref|XP_008244890.1|  PREDICTED: vesicle-associated membrane prote...    145   6e-39   
ref|XP_007218295.1|  hypothetical protein PRUPE_ppa010737mg             145   6e-39   
gb|AFK34145.1|  unknown                                                 144   6e-39   
ref|XP_001779971.1|  R-SNARE, VAMP72-family                             145   6e-39   
ref|XP_003637224.1|  Vesicle-associated membrane protein                144   1e-38   
ref|XP_002315429.1|  hypothetical protein POPTR_0010s24630g             144   1e-38   
ref|XP_009355010.1|  PREDICTED: vesicle-associated membrane prote...    144   1e-38   
gb|KJB69906.1|  hypothetical protein B456_011G049200                    141   1e-38   
ref|XP_004497141.1|  PREDICTED: vesicle-associated membrane prote...    144   2e-38   
ref|XP_011024182.1|  PREDICTED: vesicle-associated membrane prote...    144   2e-38   
gb|ACU24529.1|  unknown                                                 144   2e-38   
gb|KGN66898.1|  hypothetical protein Csa_1G707630                       142   2e-38   
ref|XP_003574932.1|  PREDICTED: vesicle-associated membrane prote...    143   2e-38   
ref|XP_009622317.1|  PREDICTED: vesicle-associated membrane prote...    143   2e-38   
ref|XP_006855103.1|  hypothetical protein AMTR_s00031p00183990          143   2e-38   
ref|XP_008667191.1|  PREDICTED: uncharacterized protein LOC100193...    144   3e-38   
ref|XP_009414577.1|  PREDICTED: vesicle-associated membrane prote...    143   3e-38   
ref|XP_007010423.1|  Vesicle-associated membrane protein 727            143   4e-38   
ref|XP_010695070.1|  PREDICTED: vesicle-associated membrane prote...    143   4e-38   
ref|XP_010910975.1|  PREDICTED: vesicle-associated membrane prote...    142   4e-38   
ref|XP_004974203.1|  PREDICTED: vesicle-associated membrane prote...    142   6e-38   
ref|XP_008345948.1|  PREDICTED: vesicle-associated membrane prote...    142   6e-38   
emb|CDO99918.1|  unnamed protein product                                142   7e-38   
ref|XP_011032884.1|  PREDICTED: vesicle-associated membrane prote...    142   7e-38   
ref|XP_006403590.1|  hypothetical protein EUTSA_v10010674mg             142   7e-38   
ref|XP_002311006.1|  Vesicle-associated membrane protein 727            142   7e-38   
ref|XP_002459621.1|  hypothetical protein SORBIDRAFT_02g007620          144   7e-38   
ref|XP_003561275.1|  PREDICTED: vesicle-associated membrane prote...    142   8e-38   
emb|CDM82457.1|  unnamed protein product                                146   1e-37   
ref|XP_006361486.1|  PREDICTED: vesicle-associated membrane prote...    142   1e-37   
ref|XP_004249955.1|  PREDICTED: vesicle-associated membrane prote...    142   1e-37   
ref|XP_009419510.1|  PREDICTED: vesicle-associated membrane prote...    141   1e-37   
ref|XP_008662650.1|  PREDICTED: vesicle-associated membrane prote...    142   1e-37   
ref|XP_008662654.1|  PREDICTED: vesicle-associated membrane prote...    142   1e-37   
ref|XP_001764415.1|  R-SNARE, VAMP72-family                             141   2e-37   
ref|XP_011101625.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    141   2e-37   
ref|NP_850201.1|  vesicle-associated membrane protein 723               140   2e-37   
ref|XP_004955897.1|  PREDICTED: vesicle-associated membrane prote...    141   2e-37   
ref|XP_002959057.1|  hypothetical protein VOLCADRAFT_70298              140   2e-37   
emb|CDY07551.1|  BnaC06g15130D                                          141   2e-37   
ref|XP_010554503.1|  PREDICTED: vesicle-associated membrane prote...    141   2e-37   
ref|XP_010031285.1|  PREDICTED: vesicle-associated membrane prote...    140   2e-37   
ref|XP_004306429.1|  PREDICTED: vesicle-associated membrane prote...    140   2e-37   
ref|XP_006853346.1|  hypothetical protein AMTR_s00032p00095920          140   3e-37   
ref|XP_010427103.1|  PREDICTED: vesicle-associated membrane prote...    140   3e-37   
emb|CDX67594.1|  BnaA07g16340D                                          140   5e-37   
ref|XP_008456603.1|  PREDICTED: vesicle-associated membrane prote...    140   5e-37   
gb|KJB57022.1|  hypothetical protein B456_009G150900                    138   5e-37   
ref|XP_009103912.1|  PREDICTED: vesicle-associated membrane prote...    140   5e-37   
ref|XP_004140905.1|  PREDICTED: vesicle-associated membrane prote...    139   7e-37   
ref|NP_190998.1|  vesicle-associated membrane protein 727               139   8e-37   
ref|XP_002877968.1|  ATVAMP727                                          139   1e-36   
ref|XP_009139247.1|  PREDICTED: vesicle-associated membrane prote...    139   1e-36   
ref|XP_009412480.1|  PREDICTED: vesicle-associated membrane prote...    139   1e-36   
ref|XP_009412477.1|  PREDICTED: vesicle-associated membrane prote...    138   1e-36   
ref|XP_010504230.1|  PREDICTED: vesicle-associated membrane prote...    139   2e-36   
ref|XP_006291777.1|  hypothetical protein CARUB_v10017948mg             139   2e-36   
ref|NP_001136721.1|  uncharacterized protein LOC100216858               139   2e-36   
ref|XP_008457256.1|  PREDICTED: vesicle-associated membrane prote...    137   2e-36   
emb|CDX76153.1|  BnaA04g04170D                                          138   3e-36   
ref|XP_001692216.1|  R-SNARE protein, VAMP72-family                     137   4e-36   
ref|XP_009116118.1|  PREDICTED: vesicle-associated membrane prote...    137   4e-36   
ref|XP_008457255.1|  PREDICTED: vesicle-associated membrane prote...    136   7e-36   
emb|CDX78228.1|  BnaA09g34230D                                          137   7e-36   
gb|EPS64544.1|  hypothetical protein M569_10239                         136   7e-36   
ref|XP_010515951.1|  PREDICTED: vesicle-associated membrane prote...    137   7e-36   
ref|XP_007200441.1|  hypothetical protein PRUPE_ppa011218mg             134   8e-36   
gb|EMT21571.1|  Vesicle-associated membrane protein 727                 138   8e-36   
gb|KHN03622.1|  Putative vesicle-associated membrane protein 726        134   9e-36   
gb|KDO71623.1|  hypothetical protein CISIN_1g032590mg                   134   9e-36   
ref|XP_008457253.1|  PREDICTED: vesicle-associated membrane prote...    137   1e-35   
ref|XP_006659694.1|  PREDICTED: vesicle-associated membrane prote...    136   1e-35   
gb|KJB60248.1|  hypothetical protein B456_009G303300                    136   1e-35   
ref|XP_008651494.1|  PREDICTED: vesicle-associated membrane prote...    137   1e-35   
gb|KHN07197.1|  Vesicle-associated membrane protein 722                 132   2e-35   
ref|NP_001150264.1|  vesicle-associated membrane protein 724            136   2e-35   
emb|CDX73490.1|  BnaC08g25130D                                          135   2e-35   
ref|XP_006485186.1|  PREDICTED: vesicle-associated membrane prote...    135   2e-35   
ref|XP_003636885.1|  Vesicle-associated membrane protein                132   3e-35   
gb|KJB60252.1|  hypothetical protein B456_009G303300                    135   3e-35   
ref|NP_001062495.1|  Os08g0558600                                       135   4e-35   
ref|XP_002507800.1|  synaptobrevin like protein                         134   6e-35   
gb|KEH22817.1|  synaptobrevin-like protein                              133   8e-35   
gb|EYU19818.1|  hypothetical protein MIMGU_mgv1a012998mg                132   3e-34   
gb|KDD72743.1|  synaptobrevin                                           129   1e-33   
ref|XP_002442624.1|  hypothetical protein SORBIDRAFT_08g023180          130   1e-33   
ref|XP_008651495.1|  PREDICTED: vesicle-associated membrane prote...    129   1e-32   
gb|EAZ07996.1|  hypothetical protein OsI_30258                          132   3e-32   
ref|XP_005843431.1|  hypothetical protein CHLNCDRAFT_28123              127   3e-32   
gb|AAC04922.1|  putative synaptobrevin                                  126   5e-32   
ref|XP_007034428.1|  Vesicle-associated membrane 721, VAMP7B-like...    127   5e-32   
gb|KCW84470.1|  hypothetical protein EUGRSUZ_B01305                     125   6e-32   
ref|XP_005643794.1|  R-SNARE protein, VAMP72-family                     125   1e-31   
gb|EEE69144.1|  hypothetical protein OsJ_28268                          132   2e-31   
gb|KJB12631.1|  hypothetical protein B456_002G028200                    123   3e-31   
ref|XP_010098294.1|  Vesicle-associated membrane protein 724            124   4e-31   
ref|XP_009146727.1|  PREDICTED: vesicle-associated membrane prote...    121   4e-30   
ref|XP_005648444.1|  R-SNARE protein, VAMP72-family                     121   4e-30   
ref|XP_007034426.1|  Vesicle-associated membrane protein 721, VAMP7B    116   2e-29   
ref|XP_003062253.1|  predicted protein                                  119   3e-29   
ref|NP_001132174.1|  uncharacterized protein LOC100193599               115   9e-29   
ref|NP_001130551.1|  uncharacterized protein LOC100191650               115   1e-28   
ref|XP_001418265.1|  predicted protein                                  114   1e-27   
emb|CDY13199.1|  BnaC04g26360D                                          113   2e-27   



>ref|XP_006448759.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 ref|XP_006468428.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR61999.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77464.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=221

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQ+PMAFLE +KD+FV KYGGGK ATAP N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
 gb|ESW19522.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
Length=221

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YC+V +ES GRQVPMAFLE +KDDFV KYGGGK ATAP NSL+KEFGPKLR+ MQ C DH
Sbjct  65   YCIVADESIGRQVPMAFLERVKDDFVSKYGGGKAATAPANSLNKEFGPKLREHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRTSGTRIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_008225792.1| PREDICTED: vesicle-associated membrane protein 721-like [Prunus 
mume]
Length=221

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQVP+AFLE IKDDFV KYGGGK ATAP NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALIL+I+L VCHGFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
 gb|EMJ13207.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
Length=221

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQVP+AFLE IKDDFV KYGGGK ATAP NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALIL+I+L VCHGFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>ref|XP_007024899.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY27521.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=221

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE IKDDFV KYG GK ATAP N L+KEFGPKL++ MQ C +H
Sbjct  65   YCVVADESAGRQVPIAFLERIKDDFVSKYGSGKAATAPANGLNKEFGPKLKEHMQYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>gb|KHN14368.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQ+PMAFLE +KD+FV KYGGGK ATAPVNSL+KEFGPKLR+ MQ C DH
Sbjct  65   YCVVADESIGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_010242074.1| PREDICTED: vesicle-associated membrane protein 721-like [Nelumbo 
nucifera]
Length=222

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+ GRQVPMAFLE IKDDFV +YGGGK ATAP NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVADETVGRQVPMAFLERIKDDFVSRYGGGKAATAPANSLNKEFGSKLKEHMQYCIDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  126  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRNTGTKMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  186  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|NP_001236634.1| uncharacterized protein LOC100500089 [Glycine max]
 gb|ACU14879.1| unknown [Glycine max]
Length=221

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQ+PMAFLE +KD+FV KYGGGK ATAPVNSL+KEFGPKLR+ MQ C DH
Sbjct  65   YCVVADESFGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>emb|CDP18918.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQ+P+AFLE +KDDFV KYGGGK  TAP N L+KEFGPKL+D M+ C DH
Sbjct  70   YCVVAEESAGRQIPIAFLERVKDDFVSKYGGGKATTAPANGLNKEFGPKLKDHMKYCMDH  129

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G K+R
Sbjct  130  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGTKMR  189

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVL I+IALILII+L  C GFNCGK
Sbjct  190  RKMWLQNMKVKLIVLAIVIALILIIILSACKGFNCGK  226



>gb|KJB69905.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
Length=222

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE IKDDFV KY  GK ATAP NSL+KEFGPKL++ MQ C +H
Sbjct  65   YCVVADESAGRQVPIAFLERIKDDFVSKYDNGKAATAPANSLNKEFGPKLKEHMQYCMEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFRS G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRSTGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_010092659.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXB51910.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=221

 Score =   219 bits (557),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE +KDDFV KYG GK +TA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESVGRQVPLAFLERVKDDFVSKYGAGKASTAAANSLNKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTAGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW +NMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  185  RKMWLKNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_003535044.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
1 [Glycine max]
 gb|ACJ61478.1| synaptobrevin-related protein [Glycine max]
 gb|KHN22964.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   219 bits (557),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQ+PMAFLE +KD+FV KYGGGK ATAP NSL+KEFGPKLR+ MQ C DH
Sbjct  65   YCVVADESIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_011096786.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=226

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQVPMAFL+ IKDDFV KYGGGK ATAP N L+KEFGPKL++ MQ C +H
Sbjct  70   YCVVAEESVGRQVPMAFLDRIKDDFVAKYGGGKAATAPANGLNKEFGPKLKEHMQYCIEH  129

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  130  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRATGTKIR  189

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILIIVL VC GFNCGK
Sbjct  190  RKMWLQNMKIKLIVLAIVIALILIIVLSVCKGFNCGK  226



>ref|XP_009618936.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
tomentosiformis]
Length=222

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQVP+AFLE +KDDFV KYGGGK ATA  NSL+KEFGPKL++ M  C DH
Sbjct  66   YCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMHYCADH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G +IR
Sbjct  126  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILIIVL VCHGFNCGK
Sbjct  186  RKMWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_009802587.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
sylvestris]
Length=222

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQVP+AFLE +KDDFV KYGGGK ATA  NSL+KEFGPKL++ M  C DH
Sbjct  66   YCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMHYCADH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G +IR
Sbjct  126  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILIIVL VCHGFNCGK
Sbjct  186  RKMWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_008383321.1| PREDICTED: vesicle-associated membrane protein 721-like [Malus 
domestica]
 ref|XP_009353936.1| PREDICTED: vesicle-associated membrane protein 721-like [Pyrus 
x bretschneideri]
Length=221

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQVP+AFLE +KDDFV KYG GK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVADESSGRQVPIAFLERVKDDFVAKYGSGKAATAAANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILII++ VCHGFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIIMSVCHGFNCGK  221



>ref|XP_002530145.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF32237.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=221

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE IK+DF+ +YG GK ATAP NSL KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESAGRQVPMAFLERIKEDFMARYGNGKAATAPANSLDKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISK  K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G KIR
Sbjct  125  PEEISKFAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSSGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  221



>gb|KJB57020.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=169

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E  GRQVP+AFLE +K+DFV KYG GK ATAP NSL+KEFGPKL++ MQ C +H
Sbjct  12   YCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVEH  71

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K K+QVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G KIR
Sbjct  72   PEEISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIR  131

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCG
Sbjct  132  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  167



>ref|XP_009604671.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
tomentosiformis]
 ref|XP_009759428.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
sylvestris]
Length=222

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQVP+AFLE +KDDFV KYGGGK ATAP NSL+KEFGPKL++ MQ C DH
Sbjct  66   YCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATAPPNSLNKEFGPKLKEHMQYCADH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G +IR
Sbjct  126  PDEISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  186  RKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>ref|XP_002276767.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis 
vinifera]
 emb|CAN81365.1| hypothetical protein VITISV_015772 [Vitis vinifera]
 emb|CBI27181.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE I+DDFV +YGG K ATAP NSL+K+F  KL++ MQ C DH
Sbjct  65   YCVVADESVGRQVPMAFLERIRDDFVARYGGEKAATAPANSLNKDFSSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K K QVSEVKGVMMEN EKV DRGEKIEL VDKT N  +QAQDFRS G KIR
Sbjct  125  PEEISKLAKVKDQVSEVKGVMMENIEKVLDRGEKIELLVDKTHNLHEQAQDFRSAGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI++ALILIIVL VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILVALILIIVLSVCHGFNCGK  221



>ref|XP_006377004.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
 gb|ABK92923.1| unknown [Populus trichocarpa]
 gb|ABK94486.1| unknown [Populus trichocarpa]
 gb|ABK95420.1| unknown [Populus trichocarpa]
 gb|ERP54801.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
Length=221

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE +KDDFV KYGGGK ATA  N L+KEFGPKL++ M+ C DH
Sbjct  65   YCVVADESAGRQVPMAFLERVKDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFRS G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>gb|KJB57019.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=222

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E  GRQVP+AFLE +K+DFV KYG GK ATAP NSL+KEFGPKL++ MQ C +H
Sbjct  65   YCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K K+QVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G KIR
Sbjct  125  PEEISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCG
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  220



>gb|AFY26886.1| vesicle-associated membrane protein 72 [Morella rubra]
Length=219

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE IKDDF+ +YGGGK +TAP N L+KEFGPKL++ M+ C DH
Sbjct  65   YCVVADESVGRQVPMAFLERIKDDFLSRYGGGKASTAPANGLNKEFGPKLKEHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>gb|EYU43691.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
 gb|EYU43692.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
Length=226

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YC+V EES GRQ+PMAFLE IKD+FV KYGGGK AT P N L+KEFGPKL++ MQ C DH
Sbjct  70   YCIVAEESAGRQLPMAFLERIKDNFVAKYGGGKAATTPANGLNKEFGPKLKEHMQYCMDH  129

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K +AQVSEVKGVMMEN EKV DRGEKIE+ VDKTEN   QAQDF++ G KIR
Sbjct  130  PEEISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLHNQAQDFKTTGTKIR  189

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILII+L VC GFNCGK
Sbjct  190  RKMWLQNMKIKLIVLAIVIALILIIILSVCKGFNCGK  226



>ref|XP_011016724.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=221

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE ++DDFV KYGGGK ATA  N L+KEFGPKL++ M+ C DH
Sbjct  65   YCVVADESAGRQVPMAFLERVRDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFRS G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>gb|KDP29315.1| hypothetical protein JCGZ_19410 [Jatropha curcas]
Length=221

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE IK+DF+ KYG GK  TA  NSL KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESAGRQVPMAFLERIKEDFMAKYGNGKATTAVANSLDKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTSGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  221



>ref|XP_004233223.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
lycopersicum]
 ref|XP_006362607.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
tuberosum]
Length=222

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV EES GRQ+P+AFLE IKDDF+ KYG GK ATAP NSL+KEFGPKL++ MQ C +H
Sbjct  66   YCVVAEESVGRQIPIAFLERIKDDFMSKYGSGKAATAPPNSLNKEFGPKLKEHMQYCAEH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G +IR
Sbjct  126  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  186  RKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>ref|XP_008459063.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=222

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IKDDFV KYGGGK +TAP NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVATESAGRQVPIAFLERIKDDFVSKYGGGKASTAPANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G KIR
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFKTSGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCG
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>gb|ACU19359.1| unknown [Glycine max]
Length=221

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E  GRQ+PMAFLE +KD+FV KYGGGK ATAP NSL+KEFGPKLR+ MQ C DH
Sbjct  65   YCVVADEPIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV EVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR+ G +IR
Sbjct  125  PEEISKLAKVKAQVFEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_006352702.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Solanum tuberosum]
Length=220

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDF  KYGGGK ATA  NSL+KEFGPK++D MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKDQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G K+R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALIL+IVL +CHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGIILALILVIVLSICHGFNC  219



>ref|XP_002322360.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
 gb|EEF06487.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
Length=219

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDFV KYGGGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAAESAGRQVPIAFLERVKDDFVTKYGGGKAATAQANGLNKEFGPKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGI+I LILIIVL +C GFNC
Sbjct  185  RKMWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>ref|XP_004145455.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004165486.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
Length=222

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IKDDFV KY GGK +TAP NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVATESAGRQVPIAFLERIKDDFVSKYAGGKASTAPANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G KIR
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHTQAQDFKTSGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGI+IALILIIVL VC GFNCG
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>ref|XP_004242395.1| PREDICTED: vesicle-associated membrane protein 721-like [Solanum 
lycopersicum]
Length=220

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDF  KYGGGK ATA  NSL+KEFGPK+++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G K+R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII ALI++IVL +CHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGIIFALIMVIVLSICHGFNC  219



>ref|XP_011040378.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDFV K+GGGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAAESAGRQVPIAFLERVKDDFVTKFGGGKAATAQANGLNKEFGPKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGI+I LILIIVL +C GFNC
Sbjct  185  RKMWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>ref|XP_009588661.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
tomentosiformis]
Length=220

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDF  KYGGGK ATA  NSL++EFGPK+++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVL II+ALIL+IVL +CHGF C
Sbjct  185  RKMWLQNMKVKLIVLAIIVALILVIVLSICHGFKC  219



>gb|KHN08022.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE +KDDFV KYGGGK AT   NSL+KEFG KL++ MQ C +H
Sbjct  69   YCVVADESIGRQVPVAFLERVKDDFVAKYGGGKAATVAANSLNKEFGSKLKEHMQYCVEH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVK VMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  129  PEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  188

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILIIVL VC GFNCGK
Sbjct  189  RKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_004505324.1| PREDICTED: vesicle-associated membrane protein 722-like [Cicer 
arietinum]
Length=222

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE +KDDFV KYGGGK +TA  NSL+KEFGPKL++ MQ C DH
Sbjct  69   YCVVADESVGRQVPVAFLERVKDDFVVKYGGGKASTAAPNSLNKEFGPKLKEHMQYCVDH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  129  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  188

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  189  RKMWMQNMK  197



>ref|XP_010038359.1| PREDICTED: vesicle-associated membrane protein 721-like [Eucalyptus 
grandis]
 gb|KCW50175.1| hypothetical protein EUGRSUZ_K03606 [Eucalyptus grandis]
Length=222

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE IK+DF  +Y  GK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERIKEDFTHRYDAGKAATASANSLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGIIIALIL+IVL VCHGFNCG
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILVIVLSVCHGFNCG  220



>ref|XP_003594451.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES64702.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+TGRQVPMAFLE +KDDFV KYGG K +TAP NSL+KEFGPKL++ MQ C DH
Sbjct  69   YCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYCVDH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFRS G  IR
Sbjct  129  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFRSSGTSIR  188

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  189  RKMWLQNMK  197



>ref|XP_009787803.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
sylvestris]
Length=220

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDF  KYGGGK ATA  NSL++EFGPK+++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF++ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVL IIIALIL+IVL +CHGF C
Sbjct  185  RKMWLQNMKVKLIVLAIIIALILVIVLSICHGFKC  219



>ref|XP_006583934.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
 gb|KHN42974.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE  KDDFV KYGGGK  TA  NSL+KEFG KL++ MQ C +H
Sbjct  69   YCVVADESIGRQVPVAFLERAKDDFVAKYGGGKATTAAANSLNKEFGSKLKEHMQYCVEH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVK VMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  129  PEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  188

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILIIVL VC GFNCGK
Sbjct  189  RKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>gb|ACJ84389.1| unknown [Medicago truncatula]
Length=197

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+ GRQVP+AFLE +KDDFV KYGGGK +TA  NSL+KEFGPKL++ MQ C DH
Sbjct  67   YCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYCVDH  126

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  127  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  186

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  187  RKMWLQNMK  195



>ref|XP_010069066.1| PREDICTED: putative vesicle-associated membrane protein 726 [Eucalyptus 
grandis]
Length=219

 Score =   206 bits (524),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGGK  TA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF+  G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  219



>ref|XP_003607843.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|ACJ83853.1| unknown [Medicago truncatula]
 gb|AES90040.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+ GRQVP+AFLE +KDDFV KYGGGK +TA  NSL+KEFGPKL++ MQ C DH
Sbjct  67   YCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYCVDH  126

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  127  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  186

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  187  RKMWLQNMK  195



>gb|AFK40215.1| unknown [Medicago truncatula]
Length=220

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+ GRQVP+AFLE +KDDFV KYGGGK +TA  NSL+KEFGPKL++ MQ C DH
Sbjct  67   YCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYCVDH  126

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  127  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  186

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  187  RKMWLQNMK  195



>gb|KJB57021.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=216

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  598  ESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDHPEEISK  419
            E  GRQVP+AFLE +K+DFV KYG GK ATAP NSL+KEFGPKL++ MQ C +HPEEISK
Sbjct  65   ELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVEHPEEISK  124

Query  418  LXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIRXKMWXQ  239
            L K K+QVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G KIR KMW Q
Sbjct  125  LAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRKMWLQ  184

Query  238  NMKikxivlgiiialiliivlxVCHGFNCG  149
            NMKIK IVLGI+IALILIIVL VCHGFNCG
Sbjct  185  NMKIKLIVLGILIALILIIVLSVCHGFNCG  214



>ref|XP_010522416.1| PREDICTED: vesicle-associated membrane protein 725 [Tarenaya 
hassleriana]
Length=220

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIAL+LI+VL +CHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALVLIMVLSICHGFKC  219



>gb|AFK36461.1| unknown [Lotus japonicus]
Length=226

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YC+V +ES GRQVPMAFLE +KDDFV KYG GK ATAP NSL+KEFGPKL++ MQ C DH
Sbjct  72   YCIVADESVGRQVPMAFLERVKDDFVSKYGDGKAATAPANSLNKEFGPKLKEHMQYCVDH  131

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G  IR
Sbjct  132  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRTSGTSIR  191

Query  256  XKMWXQNMK  230
             KM  QNMK
Sbjct  192  RKMRLQNMK  200



>emb|CDY10053.1| BnaC08g43980D [Brassica napus]
Length=220

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+AL LIIVL VCHGF C
Sbjct  186  RKMWLQNMKIKLIVLAIIVALTLIIVLSVCHGFKC  220



>emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera]
Length=200

 Score =   203 bits (516),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KDDF  +YGGGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  46   YCVVAVESAGRQIPIAFLERVKDDFNKRYGGGKAATAVANGLNKEFGPKLKEHMQYCVDH  105

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  106  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  165

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL +CHGF C
Sbjct  166  RKMWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  200



>ref|XP_002264270.1| PREDICTED: vesicle-associated membrane protein 721 [Vitis vinifera]
 emb|CBI40837.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KDDF  +YGGGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  66   YCVVAVESAGRQIPIAFLERVKDDFNKRYGGGKAATAVANGLNKEFGPKLKEHMQYCVDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  126  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL +CHGF C
Sbjct  186  RKMWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  220



>ref|XP_010522412.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>emb|CDY19450.1| BnaC04g11490D [Brassica napus]
Length=223

 Score =   203 bits (517),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +KDDF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  67   YCVVAVDSAGRQIPMAFLERVKDDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  126

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  127  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  186

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  187  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|XP_002267063.1| PREDICTED: vesicle-associated membrane protein 722 [Vitis vinifera]
 emb|CBI37278.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQIPIAFLERVKEDFTKRYGGGKAATAVANSLNKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL +C GFNC
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSICGGFNC  219



>ref|XP_002304708.1| synptobrevin-related family protein [Populus trichocarpa]
 gb|EEE79687.1| synptobrevin-related family protein [Populus trichocarpa]
Length=219

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGIIIALILIIVL VCHGFNC
Sbjct  185  RKMWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>gb|KDP26403.1| hypothetical protein JCGZ_17561 [Jatropha curcas]
Length=219

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK+DF  KY GGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERIKEDFTKKYAGGKAATAVANGLNKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>gb|KJB37799.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=160

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF  +YGGGK ATA   SL++EFG KL++ MQ C DH
Sbjct  6    YCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYCVDH  65

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G  +R
Sbjct  66   PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNMR  125

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNC
Sbjct  126  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  160



>ref|XP_010932918.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=220

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV +RGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_011020669.1| PREDICTED: vesicle-associated membrane protein 721 isoform X1 
[Populus euphratica]
Length=219

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRKQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGIIIALILIIVL VCHGFNC
Sbjct  185  RKMWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>ref|XP_007049803.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
 gb|EOX93960.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
Length=219

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK+DF   YGGGK ATAP NSLS+EFGPKL++ MQ C DH
Sbjct  65   YCVVAIESVGRQVPIAFLERIKEDFTKIYGGGKAATAPANSLSREFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILII+L VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIILSVCGGFKC  219



>ref|XP_010542985.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLGKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_011080177.1| PREDICTED: vesicle-associated membrane protein 721 [Sesamum indicum]
Length=220

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  KYGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERVKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_010109710.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXC24180.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=219

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE IK+DF  +YGGGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQIPIAFLERIKEDFTKRYGGGKAATAVANSLNKEFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL   KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLANVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+ ALILIIVL VC GFNC
Sbjct  185  RKMWLQNMKIKLIVLGILFALILIIVLSVCGGFNC  219



>ref|XP_010556949.1| PREDICTED: vesicle-associated membrane protein 721 [Tarenaya 
hassleriana]
Length=220

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_010264069.1| PREDICTED: vesicle-associated membrane protein 722 [Nelumbo nucifera]
Length=219

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KDDF  +YGGGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPVAFLERVKDDFNKRYGGGKAATAVANSLNKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+ KL K KAQVSEVK VMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEVGKLAKVKAQVSEVKEVMMENIEKVLDRGEKIELLVDKTENLKSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL +CHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>gb|EYU46345.1| hypothetical protein MIMGU_mgv1a013442mg [Erythranthe guttata]
Length=220

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IK+DF  KYGGGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAYLERIKEDFTKKYGGGKAATAVANSLNKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALILIIVL VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGIIVALILIIVLSVCGGFKC  219



>gb|KDP20321.1| hypothetical protein JCGZ_06407 [Jatropha curcas]
Length=219

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+P+AFLE +K+DF  +YGGGK ATA  N L +EFGPKL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPIAFLERVKEDFKKRYGGGKAATAQANGLKREFGPKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KI+
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI++ALILIIVL VCHGFNC
Sbjct  185  RKMWIENMKMKLIVFGIVLALILIIVLSVCHGFNC  219



>ref|XP_010674670.1| PREDICTED: vesicle-associated membrane protein 722 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +KDDF  ++GGGK ATA   SL+K+FGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKDDFNKRFGGGKAATAQAKSLNKDFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE++KL K +AQ+SEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEMNKLAKVQAQISEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL +CHGFNCGK
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSICHGFNCGK  221



>ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=219

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_010556950.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL +CHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSICHGFKC  219



>ref|XP_009413307.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  KYG GK ATA  NSLS+EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERVKEDFNKKYGAGKAATASANSLSREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>emb|CDX79510.1| BnaC03g18460D [Brassica napus]
Length=222

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL I+IALILIIVL VC GFNCGK
Sbjct  186  RKMWFQNMKIKLIVLAIVIALILIIVLSVCGGFNCGK  222



>ref|XP_009132911.1| PREDICTED: vesicle-associated membrane protein 722-like [Brassica 
rapa]
 emb|CDX84702.1| BnaA03g15280D [Brassica napus]
Length=222

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  186  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  222



>emb|CDY18254.1| BnaC05g02770D [Brassica napus]
Length=220

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  186  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>ref|XP_009143895.1| PREDICTED: vesicle-associated membrane protein 722 [Brassica 
rapa]
 emb|CDY17139.1| BnaA05g10490D [Brassica napus]
Length=223

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  67   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  126

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  127  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  186

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  187  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|NP_001030968.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 dbj|BAD44122.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27739.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=181

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PM+FLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  27   YCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  86

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  87   PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  146

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  147  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  181



>ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006420621.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006489783.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Citrus sinensis]
 gb|ESR33860.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|ESR33861.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|KDO49379.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
 gb|KDO49380.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
Length=219

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>gb|KHG06809.1| hypothetical protein F383_08210 [Gossypium arboreum]
Length=219

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF  +YGGGK ATA   SL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>emb|CDX86608.1| BnaC08g00950D [Brassica napus]
Length=219

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>gb|KDO77465.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=143

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  574  MAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDHPEEISKLXKXKAQV  395
            MAFLE +KD+FV KYGGGK ATAP N L+KEFGPKL++ MQ C DHPEEISKL K KAQV
Sbjct  1    MAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDHPEEISKLAKVKAQV  60

Query  394  SEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIRXKMWXQNMKikxiv  215
            SEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G K+R KMW QNMKIK IV
Sbjct  61   SEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRKMWLQNMKIKLIV  120

Query  214  lgiiialiliivlxVCHGFNCGK  146
            LGI+IALILIIVL VCHGFNCGK
Sbjct  121  LGILIALILIIVLSVCHGFNCGK  143



>ref|XP_006650747.1| PREDICTED: vesicle-associated membrane protein 721-like [Oryza 
brachyantha]
Length=220

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFL+ +KDDF  +YGGGK ATA  NSL+++FG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLDRVKDDFTKRYGGGKAATAATNSLNRDFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGTQVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009119258.1| PREDICTED: vesicle-associated membrane protein 721 [Brassica 
rapa]
 emb|CDX89793.1| BnaA10g02890D [Brassica napus]
Length=220

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  66   YCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  186  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>ref|XP_006410450.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
 gb|ESQ51903.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
Length=221

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
 gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
Length=219

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_010509926.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
 ref|XP_010413909.1| PREDICTED: vesicle-associated membrane protein 722 isoform X1 
[Camelina sativa]
 ref|XP_010413910.1| PREDICTED: vesicle-associated membrane protein 722 isoform X2 
[Camelina sativa]
 ref|XP_010469516.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
Length=221

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_010241141.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nelumbo 
nucifera]
Length=219

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KDDF  +YGGGK  TA   SL+KEFGPKL+  MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKDDFSKRYGGGKGTTASAKSLNKEFGPKLKQHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K++
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKLK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGI +AL+LIIVL +CHGFNC
Sbjct  185  RKMWWENMKIKLIVLGIFVALVLIIVLSICHGFNC  219



>ref|NP_180871.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 sp|P47192.2|VA722_ARATH RecName: Full=Vesicle-associated membrane protein 722; Short=AtVAMP722; 
AltName: Full=Synaptobrevin-related protein 1 [Arabidopsis 
thaliana]
 gb|AAL31896.1|AF419564_1 At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAC04921.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL62414.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL79587.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAM48025.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM64431.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM91096.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AEC08787.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=221

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILII+L +C GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>ref|XP_008371850.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_008371869.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_009357270.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
 ref|XP_009378895.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
Length=221

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQVP+AFLE +KDDFV KYG GK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVADESSGRQVPIAFLERVKDDFVAKYGAGKAATAAANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILII+L +CHGFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIILSICHGFNCGK  221



>ref|NP_001031469.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 dbj|BAH20114.1| AT2G33120 [Arabidopsis thaliana]
 gb|AEC08788.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=229

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  73   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  132

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  133  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  192

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILII+L +C GFNCGK
Sbjct  193  RKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  229



>ref|XP_008775432.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=220

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KA+VSEVKGVMMEN EKV +RGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAEVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQHGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea]
Length=220

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ IK+DFV KY GGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRIKEDFVKKYSGGKAATAVANSLNKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRMQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GF C
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_002881263.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57522.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
Length=231

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  75   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  134

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  135  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  194

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILII+L VC GFNCGK
Sbjct  195  RKMWFQNMKIKLIVLAIIIALILIIILSVCGGFNCGK  231



>ref|XP_009627066.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
tomentosiformis]
 ref|XP_009777065.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
sylvestris]
Length=220

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE  K++F  KYGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G  +R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTTMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GFNC
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>ref|XP_008235502.1| PREDICTED: vesicle-associated membrane protein 722 [Prunus mume]
Length=219

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAIGRQIPIAFLERIKEDFTSRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC GFNC
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNC  219



>ref|XP_011083121.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=220

 Score =   201 bits (510),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  KYGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQLPIAFLERIKDDFTKKYGGGKAATAVANSLNREFGSKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             +MW QNMKIK IVL II+ALILIIVL VC GF C
Sbjct  185  RRMWLQNMKIKLIVLAIIVALILIIVLSVCGGFKC  219



>ref|XP_006294968.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
 gb|EOA27866.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
Length=221

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMA+LE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAYLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>emb|CDP03855.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KYGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQLPIAFLERIKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC G  C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCGGVKC  219



>ref|XP_002521112.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF41263.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=220

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK++F  KYGGGK ATA  NSL+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERIKEEFTKKYGGGKAATATANSLNKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_006304190.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 ref|XP_006418097.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
 ref|XP_010484183.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 ref|XP_010457533.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 gb|EOA37088.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 gb|ESQ36450.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
Length=219

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_002892239.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68498.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>gb|KFK42812.1| hypothetical protein AALP_AA1G041800 [Arabis alpina]
Length=219

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_010475139.1| PREDICTED: vesicle-associated membrane protein 721-like [Camelina 
sativa]
Length=219

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>gb|AAB80624.1| Strong similarity to Arabidopsis ATHSAR1 (gb|M90418). ESTs gb|T44122,gb|N65276,gb|AA041135 
come from this gene [Arabidopsis 
thaliana]
Length=175

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PM+FLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  21   YCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  80

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  81   PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  140

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  141  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  175



>gb|KJB37798.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=219

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF  +YGGGK ATA   SL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G  +R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>gb|KFK31144.1| hypothetical protein AALP_AA6G074500 [Arabis alpina]
Length=220

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K++F  +YGGGK  TA  NSL+KEFG KL+D MQ C DH
Sbjct  65   YCVVAIESVGRQIPMAFLERVKEEFNKRYGGGKATTAKANSLNKEFGSKLKDHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  125  PEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGI+IALILII+L VCHGF C
Sbjct  185  RKMWFENMKIKLIVLGIVIALILIIILSVCHGFKC  219



>ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 ref|XP_006479311.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR56868.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 gb|KDO65900.1| hypothetical protein CISIN_1g027720mg [Citrus sinensis]
Length=219

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +K+DF+ +YGGGK ATA  N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKEDFIKRYGGGKAATAVANGLNKEFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMM+N EKV DRGEKIEL VD+TEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMDNIEKVLDRGEKIELLVDRTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GFNC
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>ref|XP_003535217.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
 gb|KHN16316.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE  KD+F  KYGGGK ATA  NSL++EFGPKL+  MQ C DH
Sbjct  65   YCVVAIESAGRQLPIAFLERTKDEFTQKYGGGKAATASANSLNREFGPKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKVK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV GI +ALILI+ + +C GF+C
Sbjct  185  RKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>gb|KCW57284.1| hypothetical protein EUGRSUZ_H00084 [Eucalyptus grandis]
Length=378

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGGK  TA  NSL++EFGPKL++ MQ C DH
Sbjct  224  YCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQYCVDH  283

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF+  G KIR
Sbjct  284  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGTKIR  343

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALILII+L VCHGF C
Sbjct  344  RKMWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  378



>ref|XP_004134008.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004157674.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN56755.1| hypothetical protein Csa_3G132570 [Cucumis sativus]
Length=219

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE +K+DF  +YGGGK ATA  +SL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAIEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQYCLDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALILII+L VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLGIIVALILIIILSVCHGFQC  219



>ref|XP_009336053.1| PREDICTED: vesicle-associated membrane protein 722, partial [Pyrus 
x bretschneideri]
Length=182

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  28   YCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  87

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  88   PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  147

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGI+IALILIIVL VC+GF C
Sbjct  148  RKMWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  182



>emb|CDY06150.1| BnaA09g50530D [Brassica napus]
Length=220

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NS +KEFG KL++ MQ C DH
Sbjct  66   YCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  186  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>ref|XP_009118621.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=220

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NS +KEFG KL++ MQ C DH
Sbjct  66   YCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQYCMDH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  126  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  186  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>ref|NP_001280954.1| putative vesicle-associated membrane protein 726 [Malus domestica]
 gb|AGG35508.1| vesicle-associated membrance protein [Malus domestica]
Length=219

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGI+IALILIIVL VC+GF C
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_008438380.1| PREDICTED: putative vesicle-associated membrane protein 726 [Cucumis 
melo]
Length=219

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE +K+DF  +YGGGK ATA  +SL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQYCLDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|ADK78986.1| VAMP721 [Petunia integrifolia subsp. inflata]
Length=220

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGGK ATA   SL+KEFGPKL++ M+ C +H
Sbjct  65   YCVVATESAGRQIPIAFLERIKDDFTKRYGGGKAATATAKSLNKEFGPKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GFNC
Sbjct  185  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFNC  219



>ref|XP_009371395.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009371400.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=219

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC+GF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_009351028.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IKDDF  +YGGGK ATA  N L++EFGPKL+D M+ C DH
Sbjct  65   YCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV+ I++ + LII L +C GF C
Sbjct  185  RKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|NP_171967.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 sp|Q9ZTW3.1|VA721_ARATH RecName: Full=Vesicle-associated membrane protein 721; Short=AtVAMP721; 
AltName: Full=v-SNARE synaptobrevin 7B; Short=AtVAMP7B 
[Arabidopsis thaliana]
 gb|AAC98905.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 gb|AAL85003.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 gb|AAM91491.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 dbj|BAD42978.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43361.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43374.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43437.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43557.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43592.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43735.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43994.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44048.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44054.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44149.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44415.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44419.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44642.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27738.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=219

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PM+FLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>dbj|BAD43410.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
Length=219

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PM+FLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGSQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_008803805.1| PREDICTED: putative vesicle-associated membrane protein 726 [Phoenix 
dactylifera]
Length=220

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEIS L K KAQVSEVKGVMMEN EKV +RGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISNLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|EYU17981.1| hypothetical protein MIMGU_mgv1a013452mg [Erythranthe guttata]
Length=220

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            +CVV  ES GRQ+P+A+LE IKDDF  KYGGGK ATA  NSL KEFGPKL++ MQ C DH
Sbjct  65   FCVVAVESVGRQIPIAYLERIKDDFTKKYGGGKAATAVANSLKKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PEEVSKMAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGII+ALILII+L +C GF C
Sbjct  185  RKMWFQNMKIKLIVLGIIVALILIIILSICGGFKC  219



>gb|ABK22119.1| unknown [Picea sitchensis]
 gb|ABK25940.1| unknown [Picea sitchensis]
Length=222

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVPMAFLE +K+DF  +YGGG+  TA  NSL+++FG KL++ MQ C DH
Sbjct  65   YCVVADESVGRQVPMAFLERVKEDFKRRYGGGRADTAVGNSLNRDFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDF+  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRFQAQDFQKQGTQLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI++ALILIIVL VCHGFNC K
Sbjct  185  RKMWFQNMKVKLIVLGIVVALILIIVLSVCHGFNCSK  221



>ref|XP_006418096.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
 gb|ESQ36449.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
Length=220

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL+  MQ C DH
Sbjct  65   YCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKAATAKANSLNKEFGSKLKQHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQ FR+ G K+R
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQAFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW  NMKIK +V GII+ALILII L VCHGF C
Sbjct  185  RKMWLDNMKIKLVVFGIIVALILIIFLSVCHGFKC  219



>ref|XP_003556884.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
Length=221

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KD+F  KYGGGK ATA  NSL++EFGPKL+  MQ C DH
Sbjct  65   YCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKVK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV GI +ALILI+ + +C GF+C
Sbjct  185  RKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>emb|CDY15521.1| BnaA08g28050D [Brassica napus]
Length=219

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  +SL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_007200442.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
 gb|EMJ01641.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
Length=219

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAIGRQIPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC+GF C
Sbjct  185  RKMWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>gb|AAA56991.1| formerly called HAT24; synaptobrevin-related protein [Arabidopsis 
thaliana]
Length=221

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C  H
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMAH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILII+L +C GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>ref|XP_004247095.1| PREDICTED: vesicle-associated membrane protein 722 [Solanum lycopersicum]
Length=220

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE  K++F  KYGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G  +R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTTMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Erythranthe guttata]
Length=219

 Score =   198 bits (503),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK  TA  N L KEFGPKL+D MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAGTAGPNGLKKEFGPKLKDQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISK+ K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKIAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK  V GI +AL L++ L +CHGF C
Sbjct  185  RKMWVQNMKIKLAVFGIFVALGLVVFLSICHGFKC  219



>ref|XP_009111083.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=219

 Score =   198 bits (503),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  +SL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL II+ALILIIVL VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>emb|CDX79466.1| BnaC03g18020D [Brassica napus]
Length=176

 Score =   196 bits (499),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL++ MQ C DH
Sbjct  21   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKEQMQYCVDH  80

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDFR+ G KIR
Sbjct  81   PEEINKLVKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKIR  140

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GIIIALILII+L VCHGF C
Sbjct  141  RKMWFENMKIKLIVAGIIIALILIIILSVCHGFKC  175



>gb|KJB10140.1| hypothetical protein B456_001G186000 [Gossypium raimondii]
Length=219

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK+DF  +YGGGK ATA  NSLSKEFGPKL++ M+ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERIKEDFTKRYGGGKAATASANSLSKEFGPKLKEHMEYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISK+ K KAQVSEVKGVMMEN EKV DRG KIE+ VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKIAKVKAQVSEVKGVMMENIEKVLDRGGKIEILVDKTENLRSQAQDFRQQGTRMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGI+IALILIIVL +C GF+C
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIVLSICGGFHC  219



>ref|XP_009370116.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IKDDF  +YGGGK ATA  N L+ EFGPKL+D M+ C DH
Sbjct  65   YCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV+ I++ + LII L +C GF C
Sbjct  185  RKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_008380599.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
 ref|XP_009376355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IKDDF  +YGGGK ATA  N L++EFGPKL+D M+ C DH
Sbjct  65   YCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV+GI+I + L+I L +C GF C
Sbjct  185  RKMWFQNMKMKLIVVGILILIALMIYLTICRGFKC  219



>gb|AAQ15287.1| synptobrevin-related protein [Pyrus pyrifolia]
Length=194

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  185  RKMWLQNMK  193



>ref|XP_004290222.1| PREDICTED: vesicle-associated membrane protein 722 [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEALGRQVPIAFLERIKEDFTNRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC+GF C
Sbjct  185  RKMWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_008372458.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
Length=219

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQVP+AFLE IK+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQVPIAFLERIKEDFXGRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILIIVL VC+GF C
Sbjct  185  RKMWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_002889523.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65782.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IV GII+ALILII+L VCHGF C
Sbjct  185  RKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|XP_006364264.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=220

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE  K++F  KYGGGK ATA  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G  +R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRLQAQDFRTQGTTMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VC GF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_009335952.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
Length=220

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IKDDF  +YGGGK ATA  N L  EFGPKL+D M+ C DH
Sbjct  65   YCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLPSEFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV+ I++ + LII L +C GF C
Sbjct  185  RKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_010910152.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=220

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE +K+DF  +YGGGK ATA  N L++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVEAAGRQIPIAFLERVKEDFKKRYGGGKAATASANGLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI KL K KAQVSEVKGVMMEN EKV +RGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEIGKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IALILII+L VCHGF C
Sbjct  185  RKMWWQNMKIKLIVLGILIALILIIILSVCHGFKC  219



>ref|XP_002518125.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF44258.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=219

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  + L++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAQAHGLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL VCHGF C
Sbjct  185  RKMWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|NP_171968.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
 sp|Q9MAS5.2|VA726_ARATH RecName: Full=Putative vesicle-associated membrane protein 726; 
Short=AtVAMP726 [Arabidopsis thaliana]
 gb|AEE27740.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
Length=220

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IV GII+ALILII+L VCHGF C
Sbjct  185  RKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|XP_009417150.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+ FL+ +K+DF  +YGGGK ATA  NSLS+EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIGFLDRVKEDFNKRYGGGKAATASANSLSREFGSKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
             EEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  SEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGIIIALILIIVL +CHGF C
Sbjct  185  RKMWLQNMKVKLIVLGIIIALILIIVLSICHGFKC  219



>ref|XP_009398406.1| PREDICTED: putative vesicle-associated membrane protein 726 [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ IK+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRIKEDFNKRYGGGKAATARANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV +RGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWMKNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|KFK42811.1| hypothetical protein AALP_AA1G041700 [Arabis alpina]
Length=220

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVVIESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW  NMKIK +V GI++ALILII+L VCHGF C
Sbjct  185  RKMWLDNMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_003604990.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES87187.1| synaptobrevin-like protein [Medicago truncatula]
 gb|AFK36407.1| unknown [Medicago truncatula]
Length=219

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGG+  TA   SL+KEFGPKL++ MQ C +H
Sbjct  65   YCVVAVESVGRQIPIAFLERIKDDFNKRYGGGRATTATAKSLNKEFGPKLKEQMQYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN +KV DRGEKIE+ VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIDKVIDRGEKIEVLVDKTENLRSQAQDFRQQGTQLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF+C
Sbjct  185  RKMWYQNMKIKLIVLAIIIALILIIVLSVCHGFSC  219



>ref|XP_010069661.1| PREDICTED: vesicle-associated membrane protein 722 [Eucalyptus 
grandis]
 gb|KCW58076.1| hypothetical protein EUGRSUZ_H00803 [Eucalyptus grandis]
Length=220

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE +KDDF  +YGGGK ATA   SL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLERVKDDFTKRYGGGKAATAVAKSLNKEFGSKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G +IR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQIR  184

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  185  RKMWLQNMK  193



>ref|XP_009132860.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDX84731.1| BnaA03g14990D [Brassica napus]
Length=220

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDFR+ G KIR
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GIIIALILII+L VCHGF C
Sbjct  185  RKMWFENMKIKLIVAGIIIALILIIILSVCHGFKC  219



>ref|XP_010475140.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK +V GI++ALILII+L VCHGF C
Sbjct  185  RKLWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_010457534.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK +V GI++ALILII+L VCHGF C
Sbjct  185  RKLWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_006857408.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
 gb|ERN18875.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
Length=217

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ PMAFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQAPMAFLERVKEDFNKRYGGGKAATAVANSLNREFGTKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFRS G K+R
Sbjct  125  PEEMSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRSQGTKMR  184

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  185  RKMWLQNMK  193



>ref|XP_004293741.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE +KDDFV KYGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVADESAGRQVPIAFLERVKDDFVAKYGGGKAATAAANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE    QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTETLHHQAQDFRNVGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVLGI+IALILII+L VCHGFNCGK
Sbjct  185  RKMWLQNMKVKLIVLGILIALILIIILSVCHGFNCGK  221



>ref|XP_004152023.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004169386.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN58350.1| hypothetical protein Csa_3G625650 [Cucumis sativus]
Length=219

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE + +DFV +YGGGK  TA  NSL+KEFG KL++ M+ C +H
Sbjct  65   YCVVAVETAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVL II+ALILII+L VC GFNC
Sbjct  185  RKMWYQNMKMKLIVLAIILALILIIILSVCGGFNC  219



>ref|XP_006293513.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
 gb|EOA26411.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
Length=220

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA   SL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQAKSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GI++ALILII+L VCHGF C
Sbjct  185  RKMWFENMKIKLIVFGIVVALILIIILSVCHGFKC  219



>emb|CDY59642.1| BnaAnng16140D [Brassica napus]
Length=178

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+ MAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL+  MQ C DH
Sbjct  23   YCVVAVESAGRQITMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKGHMQYCVDH  82

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  83   PEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  142

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGIIIALILII+L VCHGF C
Sbjct  143  RKMWWENMKIKLIVLGIIIALILIIILSVCHGFKC  177



>ref|XP_008465086.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=219

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE + +DFV +YGGGK  TA  NSL+KEFG KL++ M+ C +H
Sbjct  65   YCVVAVEAAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL I++ALILII+L VC GFNC
Sbjct  185  RKMWYQNMKIKLIVLAIVLALILIIILSVCGGFNC  219



>ref|XP_006306317.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
 gb|EOA39215.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
Length=220

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IV GI++ALILIIVL VC GF C
Sbjct  185  RKLWFENMKIKLIVFGIVVALILIIVLSVCPGFKC  219



>gb|KFK31080.1| hypothetical protein AALP_AA6G065800 [Arabis alpina]
Length=221

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW +NMKIK IVL IIIALILIIVL VC GF C K
Sbjct  185  RKMWFKNMKIKLIVLAIIIALILIIVLSVCGGFKCTK  221



>emb|CDO99425.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFLE IK+DF  +YGGGK +TA   SL+KEFGPKL++ M+ C DH
Sbjct  27   YCVVAAEAAGRQLPIAFLERIKEDFHKRYGGGKASTASAKSLNKEFGPKLKEHMKYCVDH  86

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K++
Sbjct  87   PEEINKLAKIKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMK  146

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IV GII+A++LII+L VC GF C
Sbjct  147  RKMWVQNMKIKLIVAGIILAILLIIILSVCPGFKC  181



>gb|AAC04496.1| putative synaptobrevin [Arabidopsis thaliana]
Length=220

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  125  PDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGIII LILII+L VC GF C
Sbjct  185  RKMWFENMKIKLIVLGIIITLILIIILSVCGGFKC  219



>ref|XP_011034474.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
 ref|XP_011034475.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +Y GGK ATA   SL+ EFG KL+  MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL +CHGFNC
Sbjct  185  RKMWIQNMKIKLIVLAIIIALILIIVLSICHGFNC  219



>gb|KEH41273.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  KYGGGK ATA   SL+KE+GPKL+  MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEEFSKKYGGGKAATASARSLNKEYGPKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK I +GII  ++L+I + +C GF+C
Sbjct  185  RKMWIQNMKIKLIAVGIIFVIVLMIFMSICRGFSC  219



>dbj|BAJ88124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES G+Q+P+AFL  +KDDF  +Y GGK ATA  +SL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGQQMPIAFLVRVKDDFSKRYAGGKAATAAPSSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K +AQVSEVK VMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEINKLAKVQAQVSEVKNVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGII+ALILII+L VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGIIVALILIIILSVCHGFNCGK  221



>ref|XP_010326818.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X3 [Solanum lycopersicum]
Length=183

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  KYGGGK  TA   SLSKEFGPK+++ M+ C D+
Sbjct  27   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYCVDN  86

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  87   PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  146

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF C
Sbjct  147  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  181



>ref|XP_009143949.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDY12188.1| BnaC04g12180D [Brassica napus]
Length=220

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+ MAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL+  MQ C DH
Sbjct  65   YCVVAVESAGRQITMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKGHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  125  PEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWWENMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009408466.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+P+AFL+ IK+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVEALGRQIPIAFLDRIKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEIS+L K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDFR  G ++R
Sbjct  125  PEEISRLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTESLHSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILII+L VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIILSVCHGFKC  219



>ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
 gb|EEE82621.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
Length=219

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +Y GGK ATA   SL+ EFG KL+  MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRG+KIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILIIVL +CHGFNC
Sbjct  185  RKMWIQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
 gb|ESW29795.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
Length=226

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES GRQVP+AFLE +KDDF+ KYGGGK ATA  NSL+KEFG KL++ MQ C +H
Sbjct  69   YCVVADESIGRQVPVAFLERVKDDFLAKYGGGKAATAAANSLNKEFGSKLKEHMQYCVEH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  129  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIR  188

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMK+K IVL I+IALILIIVL VC GFNCGK
Sbjct  189  RKMWLQNMKVKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_011016158.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IK+DF  +YGGGK A A  NSL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANSLNREFGPKLKEQMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRG KIEL VDKT+N   QAQDFR  G +IR
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGVKIELLVDKTDNLHSQAQDFRQHGTQIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL I+IALI+IIVL +C GF C
Sbjct  185  RKMWWQNMKIKLIVLAILIALIIIIVLSICGGFKC  219



>ref|XP_009621355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGGK  TA   SL+KEFGPKL++ M+ C +H
Sbjct  65   YCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF+C
Sbjct  185  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>ref|XP_008224587.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=220

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE +KDDF  +Y GGK  TA  N L++EFGPKL+D M+ C DH
Sbjct  65   YCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYCLDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IV+GIII +  +I L +CHGF C
Sbjct  185  RKMWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>ref|XP_007226125.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
 gb|EMJ27324.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
Length=220

 Score =   193 bits (490),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE +KDDF  +Y GGK  TA  N L++EFGPKL+D M+ C DH
Sbjct  65   YCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IV+GIII +  +I L +CHGF C
Sbjct  185  RKMWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>ref|XP_010469563.1| PREDICTED: vesicle-associated membrane protein 725-like [Camelina 
sativa]
Length=220

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDFR+ G K++
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKLK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW  NMKIK IV GII+AL+LII+L VC GF C
Sbjct  185  RKMWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_009767969.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  +YGGGK  TA   SL+KEFGPKL++ M+ C +H
Sbjct  65   YCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGIKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF+C
Sbjct  185  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>ref|XP_010413966.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=220

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDFR+ G K++
Sbjct  125  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKLK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW  NMKIK IV GII+AL+LII+L VC GF C
Sbjct  185  RKMWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_010413912.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X1 [Camelina sativa]
Length=221

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DR   IE+ VDKTEN   QAQDF++ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_010413913.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Camelina sativa]
Length=221

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  +S GRQ+PMAFLE +K+DF  +YGGGK ATA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQVSEVKGVMMEN EKV DR   IE+ VDKTEN   QAQDF++ G ++R
Sbjct  125  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVL IIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_006360344.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=221

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  KYGGGK  TA   SLSKEFGPKL++ M+ C D+
Sbjct  65   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTAAPKSLSKEFGPKLKEHMKYCVDN  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF C
Sbjct  185  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>ref|XP_010524695.1| PREDICTED: putative vesicle-associated membrane protein 726 [Tarenaya 
hassleriana]
Length=219

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  +YGGGK +TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVESIGRQLPIAFLERVKEEFTKRYGGGKASTATANSLNKEFGSKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
              MW QNMKIK IVLGI+IALILIIVL VC GF C
Sbjct  185  RNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|NP_180826.2| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
 sp|O48850.2|VA725_ARATH RecName: Full=Vesicle-associated membrane protein 725; Short=AtVAMP725 
[Arabidopsis thaliana]
 dbj|BAC42934.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAP06822.1| putative synaptobrevin protein [Arabidopsis thaliana]
 gb|AEC08714.1| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
Length=285

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  130  YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDH  189

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  190  PDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  249

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVLGIII LILII+L VC GF C
Sbjct  250  RKMWFENMKIKLIVLGIIITLILIIILSVCGGFKC  284



>emb|CDY19154.1| BnaA04g18940D [Brassica napus]
Length=220

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTE+    AQDFR+ G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GII ALILII++ VC GF C
Sbjct  185  RKMWWENMKIKLIVAGIITALILIIIISVCPGFKC  219



>ref|XP_003622969.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES79187.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KY GGK   A   SL+KEFG KL++ MQ C +H
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFSKKYAGGKAENAAAKSLNKEFGSKLKEQMQYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K +AQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLSKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTKLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL +C GFNC K
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSICGGFNCSK  221



>gb|EPS61521.1| hypothetical protein M569_13274 [Genlisea aurea]
Length=220

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            Y VV  ES GRQ+P+AFLE IKDDF+ KY GGK ATA  NSL+K+FGPKL++ MQ C +H
Sbjct  65   YGVVAVESLGRQIPIAFLERIKDDFIKKYSGGKAATAVANSLNKDFGPKLKEQMQFCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VD+TEN   QAQDFR  G  +R
Sbjct  125  PDEISKISKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDRTENLRSQAQDFRMQGTSMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK  VLG I+A ILI+VL VC GF C
Sbjct  185  RKMWLQNMKIKLFVLGFIVAFILILVLSVCGGFKC  219



>ref|XP_004247839.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=221

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  KYGGGK  TA   SLSKEFGPK+++ M+ C D+
Sbjct  65   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYCVDN  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF C
Sbjct  185  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>gb|KJB42279.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=219

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK+DF  +YGGGK A AP NSLSKEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VDK+EN   QAQDFR  G ++R
Sbjct  125  PEEVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IAL+LIIVL VCHGFNC
Sbjct  185  RKMWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  219



>ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55665.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G K+R
Sbjct  125  PDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRAQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW  NMKIK IVLGIII LILII+L VC G+ C
Sbjct  185  RKMWFDNMKIKLIVLGIIITLILIIILSVCGGYKC  219



>ref|XP_010314763.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=183

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +K+DF  KY GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  27   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  86

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR  G KIR
Sbjct  87   PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  146

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK +V  II+ LILII+L VC GF C
Sbjct  147  RKMWYENMKIKLVVFAIILVLILIIILSVCPGFKC  181



>ref|XP_010326817.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=232

 Score =   191 bits (486),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKDDF  KYGGGK  TA   SLSKEFGPK+++ M+ C D+
Sbjct  76   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYCVDN  135

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  136  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  195

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             K+W +NMKIK IVLGIIIALILII+L VC GF C
Sbjct  196  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  230



>ref|XP_006410397.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
 gb|ESQ51850.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
Length=248

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL++EFG KL++ MQ C DH
Sbjct  114  YCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQPNSLNREFGSKLKEHMQYCVDH  173

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  174  PEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  233

Query  256  XKMWXQNMK  230
             KMW +NMK
Sbjct  234  RKMWFENMK  242



>ref|XP_007140570.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|ESW12564.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=164

 Score =   189 bits (479),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KY GGK ATA   SL++EFGPKL++ MQ C DH
Sbjct  8    YCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYCVDH  67

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  68   PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  127

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL VC GFNCGK
Sbjct  128  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  164



>ref|XP_004955737.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=222

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFL+ +K+DF  KYGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILII+L VCHGFNCGK
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFNCGK  221



>ref|XP_009608699.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +KDDF  +Y GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  65   YCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVL III +ILII+L VC GF C
Sbjct  185  RKMWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>ref|XP_004514024.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X1 [Cicer arietinum]
Length=221

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE +K++F  KYGGGK ATA  +SL+KEFG KL+  MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAYLERVKEEFSKKYGGGKAATATTHSLNKEFGSKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK I  GII+A+IL+I + +C GF+C
Sbjct  185  RKMWIENMKIKLIAFGIILAIILMIFMSLCRGFSC  219



>ref|XP_009757440.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   190 bits (483),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +KDDF  +Y GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  65   YCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IVL III +ILII+L VC GF C
Sbjct  185  RKMWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>gb|KHM99990.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=232

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 124/166 (75%), Gaps = 11/166 (7%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KD+F  KYGGGK ATA  NSL++EFGPKL+  MQ C DH
Sbjct  65   YCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEK-----------VFDRGEKIELFVDKTENFXQQA  290
            PEEI+KL K KAQVSEVKGVMMEN EK           V DRGEKIE+ VDKT+N   QA
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKARLIYKMALLRVLDRGEKIEMLVDKTDNLRSQA  184

Query  289  QDFRSXGXKIRXKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
            QDFR+ G K++ KMW QNMK+K IV GI +ALILI+ + +C GF+C
Sbjct  185  QDFRTQGTKVKRKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  230



>gb|KJB22568.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=220

 Score =   190 bits (483),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVPMAFLE IK+DF  +YGGGK A AP NSLSKEFGPKL++ MQ C DH
Sbjct  65   YCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISK+ K KAQVSEVKGVMMEN EKV DRGE+IEL VD+TEN   QAQDFR  G ++R
Sbjct  125  PEEISKIAKVKAQVSEVKGVMMENIEKVLDRGERIELLVDRTENLRSQAQDFRQQGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMK+K IVLGI++ALILIIVL VCHGF C 
Sbjct  185  RKMWLQNMKVKLIVLGILVALILIIVLSVCHGFKCS  220



>ref|XP_006349937.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X2 [Solanum tuberosum]
Length=183

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +K+DF  KY GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  27   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  86

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR  G KIR
Sbjct  87   PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  146

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK +V  II+ LILII+L VC GF C
Sbjct  147  RKMWYENMKIKLVVFSIILVLILIIILSVCPGFKC  181



>ref|XP_007145403.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
 gb|ESW17397.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
Length=221

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  KYG GK ATA   SL++EFGPKL+  MQ C DH
Sbjct  65   YCVVAVESAGRQLPIAFLERVKEEFSKKYGAGKAATASAKSLNREFGPKLKQQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKVK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IV GI++AL LI+ + +C G +C
Sbjct  185  RKMWVQNMKIKLIVFGIVVALFLIMFMSICRGISC  219



>ref|XP_004296647.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+A+LE IKDDF  +Y GGK  TA  N L++EFGPKL++ M+ C +H
Sbjct  65   YCVVAAESAGRQVPIAYLERIKDDFNKRYAGGKAGTATANGLNREFGPKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDF+  G K+R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFKQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV GI++AL LI+ L +C GF C
Sbjct  185  RKMWFQNMKMKLIVAGIVVALGLILFLSICGGFKC  219



>ref|XP_002303031.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
 gb|EEE82304.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
Length=219

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE IK+DF  +YGGGK A A  N L KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANGLKKEFGPKLKEQMQFCMDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQ FR  G +I+
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQVFRQQGGQIK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL I+I LILIIVL +C GF C
Sbjct  185  RKMWWQNMKIKLIVLAILIVLILIIVLSICGGFKC  219



>ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycine max]
 gb|ACU24640.1| unknown [Glycine max]
 gb|KHN36363.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KY GGK ATA  +SL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAHSLNREFGPKLKEEMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>tpg|DAA59924.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=161

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  KYGGGK ATA  NSL +EFGPKL++ MQ C DH
Sbjct  4    YCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLKREFGPKLKEHMQYCVDH  63

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G  +R
Sbjct  64   PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVR  123

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGIIIALILII+L VCHGF CG
Sbjct  124  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  159



>ref|XP_009141263.1| PREDICTED: vesicle-associated membrane protein 725-like [Brassica 
rapa]
Length=220

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+PMAFLE +K+DF  +YGGGK  TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKPNSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+    AQDFR+ G KIR
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GIIIALILII++ VC GF C
Sbjct  185  RKMWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>gb|KJB71677.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71678.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71679.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
Length=219

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  +YGGGK ATA   SL++EF  KL++ M+ C +H
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFSRRYGGGKAATATAKSLNREFKSKLKEHMKYCVEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KI+
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI++AL+LIIVL +C GF C
Sbjct  185  RKMWIENMKMKLIVFGIVLALVLIIVLSICPGFKC  219



>ref|XP_003532299.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
Length=221

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KY GGK ATA   SL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin homolog F25I18.14 gi|2924792 
from A. thaliana on BAC gb|AC002334 [Arabidopsis thaliana]
Length=229

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 126/164 (77%), Gaps = 9/164 (5%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +K+DF  +YGGGK +TA  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQ---------AQD  284
            PEEISKL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTEN   Q         AQD
Sbjct  125  PEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQVNNNHISNTAQD  184

Query  283  FRSXGXKIRXKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
            FR+ G K++ K+W +NMKIK IV GII+ALILII+L VCHGF C
Sbjct  185  FRTQGTKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  228



>gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlisea aurea]
Length=219

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK A A  N+L KE+GPKL + MQ C DH
Sbjct  65   YCVVVVESAGRQLPIAFLERVKEDFNKRYGGGKAANAGPNALKKEYGPKLMEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKTEN   QAQDFR  G +++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGTRMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GI +AL L++ L VCHGF C
Sbjct  185  RKMWVKNMKIKLIVFGIFVALALVVFLSVCHGFKC  219



>tpg|DAA42468.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=168

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  KYGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  11   YCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  70

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  71   PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  130

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGIIIALILII+L VCHGF CG
Sbjct  131  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  166



>ref|XP_004253005.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=221

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +K+DF  KY GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  65   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR  G KIR
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK +V  II+ LILII+L VC GF C
Sbjct  185  RKMWYENMKIKLVVFAIILVLILIIILSVCPGFKC  219



>ref|XP_008234811.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=221

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+A+LE +KDDF  +Y GGK  TA  N L++EFGPKL+D M+ C DH
Sbjct  65   YCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYCLDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMK  230
             KMW QNMK
Sbjct  185  RKMWFQNMK  193



>ref|XP_004506588.1| PREDICTED: vesicle-associated membrane protein 721-like [Cicer 
arietinum]
Length=219

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            +CVV  ES GRQ+P+AFLE IK+DF+ +YGGGK  TA   SL+KEFGPKL++ MQ C DH
Sbjct  65   FCVVAVESVGRQIPIAFLERIKEDFITRYGGGKATTATAKSLNKEFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SK  K KAQVSEVKGVM+EN +KV DRG K+E  VDKT+N   QAQDFR  G ++R
Sbjct  125  PEEVSKFAKVKAQVSEVKGVMLENIDKVLDRGVKMEDLVDKTDNLRSQAQDFRHNGTQLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVL IIIALILIIVL VCHGF+C
Sbjct  185  RKMWYQNMKIKLIVLAIIIALILIIVLSVCHGFSC  219



>ref|XP_009335953.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=220

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ++    +P+A+LE IKDDF  +YGGGK ATA  N L+ EFGPKL+D M+ C DH
Sbjct  65   YCVVAADAVANGLPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMKYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR+ G K++
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IV+ I++ + LII L +C GF C
Sbjct  185  RKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>gb|KCW62998.1| hypothetical protein EUGRSUZ_G00599, partial [Eucalyptus grandis]
Length=209

 Score =   187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE IKD+F  +YGGGK ATA  +SL +EFGPKL++ M+ C DH
Sbjct  51   YCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCADH  110

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQ SEVKGVMME  EKV DRGEK+EL +DKTEN   QAQDFR    +IR
Sbjct  111  PEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFRQQATQIR  170

Query  256  XKMWXQNMK  230
             +MW QNMK
Sbjct  171  RRMWLQNMK  179



>emb|CDY48531.1| BnaC04g43180D [Brassica napus]
Length=220

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  E+ GRQ+PMAFLE IK+DF  +YGGGK   A  NSL+KEFG KL++ MQ C DH
Sbjct  65   YCVVAVEAVGRQIPMAFLERIKEDFSNRYGGGKATNAKPNSLNKEFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQV+EVKGVMMEN EKV DRGEKIEL VDKTE+    AQDFR+ G KIR
Sbjct  125  PEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK IV GIIIALILII++ VC GF C
Sbjct  185  RKMWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|AGV54239.1| vesicle-associated membrane protein [Phaseolus vulgaris]
 gb|ESW12565.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=221

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  KY GGK ATA   SL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G KIR
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILIIVL VC GFNCGK
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|XP_010068178.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
Length=214

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE IKD+F  +YGGGK ATA  +SL +EFGPKL++ M+ C DH
Sbjct  56   YCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCADH  115

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQ SEVKGVMME  EKV DRGEK+EL +DKTEN   QAQDFR    +IR
Sbjct  116  PEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFRQQATQIR  175

Query  256  XKMWXQNMK  230
             +MW QNMK
Sbjct  176  RRMWLQNMK  184



>ref|XP_011091409.1| PREDICTED: vesicle-associated membrane protein 722-like [Sesamum 
indicum]
Length=220

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKD+F  KY GGK AT   NSL KEFGPKLR+ MQ C D+
Sbjct  65   YCVVATESAGRQLPIAFLERIKDEFNKKYSGGKKATGGANSLKKEFGPKLREQMQYCSDN  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTE+   QAQDF++ G ++R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFKAKGTQVR  184

Query  256  XKMWXQNMK  230
             K+W QNMK
Sbjct  185  KKLWIQNMK  193



>ref|XP_006349936.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Solanum tuberosum]
Length=221

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GR++P+AFL+ +K+DF  KY GGK ATA   SL++EFG KL++ M+ C DH
Sbjct  65   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR  G KIR
Sbjct  125  PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK +V  II+ LILII+L VC GF C
Sbjct  185  RKMWYENMKIKLVVFSIILVLILIIILSVCPGFKC  219



>ref|NP_001148792.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACG32929.1| vesicle-associated membrane protein 725 [Zea mays]
Length=222

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  KYGGGK ATA  NSL +EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLKREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G  +R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGIIIALILII+L VCHGF CG
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>ref|XP_002459506.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 ref|XP_008667049.1| PREDICTED: uncharacterized protein LOC100191650 isoform X1 [Zea 
mays]
 gb|ACF84519.1| unknown [Zea mays]
 gb|ACF84742.1| unknown [Zea mays]
 gb|ACG28427.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACN28437.1| unknown [Zea mays]
 gb|EER96027.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 tpg|DAA42472.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=222

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  KYGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             KMW QNMKIK IVLGIIIALILII+L VCHGF CG
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>ref|XP_010547078.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X2 [Tarenaya hassleriana]
Length=227

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  +YGGGK  TA  NSL+KEF  K+++ MQ C DH
Sbjct  73   YCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFASKMKEQMQYCVDH  132

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKTEN   QAQDFR  G K+R
Sbjct  133  PDEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLR  192

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
              MW QNMKIK IVLGI+IALILIIVL VC GF C
Sbjct  193  RNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  227



>ref|XP_010065488.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
 gb|KCW62996.1| hypothetical protein EUGRSUZ_G00596 [Eucalyptus grandis]
Length=222

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE IKD+F  +YGGGK ATA  +SL +EFGPKL++ M+ C DH
Sbjct  64   YCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCADH  123

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQ SEVKGVMME  EKV DRGEK+EL +DKTEN   QAQDF+    +IR
Sbjct  124  PEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFQQQAIRIR  183

Query  256  XKMWXQNMK  230
             +MW QNMK
Sbjct  184  RRMWLQNMK  192



>ref|XP_011073775.1| PREDICTED: putative vesicle-associated membrane protein 726 [Sesamum 
indicum]
Length=219

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE +KDDF  KY GGK + A  N L KEFGPKL++ M+ C +H
Sbjct  65   YCVVAIESAGRQIPMAFLERVKDDFNKKYSGGKASAAKSNGLKKEFGPKLKEHMKYCTEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEIS+L K KAQVSEVKGVM+EN EKV DRGEKIEL VDKTEN   QAQDFR+ G K++
Sbjct  125  PEEISQLAKVKAQVSEVKGVMLENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKLK  184

Query  256  XKMWXQNMK  230
             KMW +NMK
Sbjct  185  RKMWYENMK  193



>ref|XP_010547077.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Tarenaya hassleriana]
Length=219

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  +YGGGK  TA  NSL+KEF  K+++ MQ C DH
Sbjct  65   YCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFASKMKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            P+EI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKTEN   QAQDFR  G K+R
Sbjct  125  PDEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
              MW QNMKIK IVLGI+IALILIIVL VC GF C
Sbjct  185  RNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>gb|KJB33092.1| hypothetical protein B456_006G056000 [Gossypium raimondii]
Length=219

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK A A   SL++EFG KL+  M+ C +H
Sbjct  65   YCVVATESAGRQIPIAFLERVKEDFSKRYGGGKAANAKAKSLNREFGSKLKAHMKYCAEH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKTEN   QAQDFR  G KI+
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQQGTKIK  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI+  +I++I++ VC   NC
Sbjct  185  RKMWIENMKMKLIVFGIVAVIIIVIIISVCRNLNC  219



>ref|XP_010923320.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=219

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  +YGGGK ATA  NSL+++FGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFGKRYGGGKAATAAANSLNRDFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_010065491.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62992.1| hypothetical protein EUGRSUZ_G00592 [Eucalyptus grandis]
Length=223

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IKD+F  +YGGGK ATA  +SL++EFGPKL++ MQ C DH
Sbjct  65   YCVVAVESIGRQIPLAFLERIKDEFTNRYGGGKAATAVAHSLNREFGPKLKEQMQYCADH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K  AQ+SEVKGVMME  EKV DRG+++EL +DKTEN   QAQDFR    ++R
Sbjct  125  PEEISKLAKLTAQISEVKGVMMEYIEKVLDRGQEVELLLDKTENLRSQAQDFRQQATRMR  184

Query  256  XKMWXQNMKikxivl-giiialiliivlxVCHGFNCG  149
             KMW QN+KIK IVL  ++  +++I++  +C GF CG
Sbjct  185  RKMWLQNIKIKRIVLGIVVALILIIVLSIICGGFRCG  221



>ref|NP_001059109.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAD30158.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 emb|CAD70274.1| synaptobrevin 1 [Oryza sativa Japonica Group]
 dbj|BAF21023.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAG87612.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96866.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|KDO77463.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=203

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 120/157 (76%), Gaps = 18/157 (11%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQ+PMAFLE +KD+FV KYGGGK ATAP N L+KEFG             
Sbjct  65   YCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFG-------------  111

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
                 KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQAQDFRS G K+R
Sbjct  112  -----KLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMR  166

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGI+IALILIIVL VCHGFNCGK
Sbjct  167  RKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  203



>gb|AFK47779.1| unknown [Medicago truncatula]
Length=219

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +E+TGRQVPMAFLE +KDDFV KYGG K +TAP NSL+KEFGPKL++ MQ C DH
Sbjct  69   YCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYCVDH  128

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFR  278
            P+EISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKT+N   QAQDFR
Sbjct  129  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFR  181



>gb|KJB22567.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=226

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVPMAFLE IK+DF  +YGGGK A AP NSLSKEFGPKL++ MQ C DH
Sbjct  65   YCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYCIDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEK------VFDRGEKIELFVDKTENFXQQAQDFRS  275
            PEEISK+ K KAQVSEVKGVMMEN EK      V DRGE+IEL VD+TEN   QAQDFR 
Sbjct  125  PEEISKIAKVKAQVSEVKGVMMENIEKLTNFFQVLDRGERIELLVDRTENLRSQAQDFRQ  184

Query  274  XGXKIRXKMWXQNMKikxivlgiiialiliivlxVCHGFNCG  149
             G ++R KMW QNMK+K IVLGI++ALILIIVL VCHGF C 
Sbjct  185  QGTQMRRKMWLQNMKVKLIVLGILVALILIIVLSVCHGFKCS  226



>ref|NP_001051606.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|AAO72389.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 gb|ABF99408.1| Vesicle-associated membrane protein 724, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13520.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|EEC76360.1| hypothetical protein OsI_13946 [Oryza sativa Indica Group]
 gb|EEE60123.1| hypothetical protein OsJ_13000 [Oryza sativa Japonica Group]
Length=220

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +KDDF  +Y GGK ATA  NSL+++FG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRVKDDFTKRYAGGKAATAAANSLNRDFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGTQVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006657530.1| PREDICTED: vesicle-associated membrane protein 725-like [Oryza 
brachyantha]
Length=220

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFL+ +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEITKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_004981381.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=220

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFL+ +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQVPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K +AQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009418833.1| PREDICTED: vesicle-associated membrane protein 721 [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K+DF  +YGGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESVGRQIPIAFLERVKEDFNKRYGGGKAATAAANSLTREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G ++R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTQMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMK+K IVLGIIIAL+LIIVL VCHGF C
Sbjct  185  RKMWLQNMKVKLIVLGIIIALVLIIVLSVCHGFKC  219



>ref|XP_004514025.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X2 [Cicer arietinum]
Length=215

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -2

Query  598  ESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDHPEEISK  419
            ES GRQ+P+A+LE +K++F  KYGGGK ATA  +SL+KEFG KL+  MQ C DHPEEI+K
Sbjct  65   ESAGRQIPIAYLERVKEEFSKKYGGGKAATATTHSLNKEFGSKLKQQMQYCVDHPEEINK  124

Query  418  LXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIRXKMWXQ  239
            L K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ KMW +
Sbjct  125  LAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMKRKMWIE  184

Query  238  NMKikxivlgiiialiliivlxVCHGFNC  152
            NMKIK I  GII+A+IL+I + +C GF+C
Sbjct  185  NMKIKLIAFGIILAIILMIFMSLCRGFSC  213



>gb|KJB42280.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=217

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQVP+AFLE IK+DF  +YGGGK A AP NSLSKE  PKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKE--PKLKEHMQYCIDH  122

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEE+SK+ K KAQVSEVKGVMMEN EKV DRGEKIEL VDK+EN   QAQDFR  G ++R
Sbjct  123  PEEVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGTQMR  182

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGI+IAL+LIIVL VCHGFNC
Sbjct  183  RKMWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  217



>ref|XP_010934067.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=219

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  ++GGGK ATA  NSL++EFG KL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERIKEDFNKRFGGGKAATAAANSLNREFGSKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_010065492.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
 gb|KCW63000.1| hypothetical protein EUGRSUZ_G00601 [Eucalyptus grandis]
Length=222

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+PMAFLE IKD+F  +YGGGK ATA  +SL +EFGPKL++ MQ C DH
Sbjct  64   YCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMQYCADH  123

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PE+ISKL + KAQ SEVKGVMME  EKV DRGE+++L +DKTEN   QAQDFR     IR
Sbjct  124  PEDISKLAQVKAQASEVKGVMMEYVEKVLDRGEEVKLLLDKTENLRSQAQDFRQQVTGIR  183

Query  256  XKMWXQNMK  230
             +MW QNMK
Sbjct  184  RRMWLQNMK  192



>gb|EAZ25708.1| hypothetical protein OsJ_09541 [Oryza sativa Japonica Group]
Length=183

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+ F+E +K+DF  KY GGK   A  NSL +E+GPKL++ M+ C  H
Sbjct  28   YCVVATESAGRQLPVGFIERVKEDFSKKYSGGKAKNATANSLKREYGPKLKEHMKYCDAH  87

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKTE+   QAQDFR  G KIR
Sbjct  88   PEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRKAGTKIR  147

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI++ALIL+I+L VC   NC
Sbjct  148  RKMWWENMKMKLIVFGIVVALILVIILTVCRDLNC  182



>ref|XP_008808719.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=219

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE IK+DF  +YGGGK ATA  N L++EFGPKL++ MQ C DH
Sbjct  65   YCVVAGESAGRQIPIAFLERIKEDFNKRYGGGKAATAAANGLNREFGPKLKEHMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             +MW QNMKIK IVLGIIIALILII+L VCHGF C
Sbjct  185  RRMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|KEH41272.1| synaptobrevin-like protein [Medicago truncatula]
Length=137

 Score =   177 bits (450),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +K++F  KYGGG+ ATA   SL+KE+GPKL+  MQ C DH
Sbjct  13   YCVVAVESAGRQIPIAFLERVKEEFSKKYGGGEAATASARSLNKEYGPKLKQQMQYCVDH  72

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIE+ VDKT+N   QAQDFR+ G K++
Sbjct  73   PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMK  132

Query  256  XKMW  245
             K+ 
Sbjct  133  RKIL  136



>gb|KDO77468.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=186

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQ+PMAFLE +KD+FV KYGGGK ATAP N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQ-DFR  278
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQ    FR
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQVSVSFR  178



>ref|XP_003557429.1| PREDICTED: vesicle-associated membrane protein 721 [Brachypodium 
distachyon]
Length=221

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ P+AFL+ +KDDF  +YGGGK ATA  +SL++EFG KL++ MQ C D+
Sbjct  65   YCVVAVESVGRQTPIAFLDRVKDDFTKRYGGGKAATAGASSLNREFGSKLKEHMQYCVDN  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR  G K+R
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNCGK  146
             KMW QNMKIK IVLGIIIALILII+L VCHGF C K
Sbjct  185  RKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCNK  221



>ref|XP_006649451.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Oryza brachyantha]
Length=223

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ESTGRQ+P+ F+E +K+DF  KY GGK  +A  NSL +E+G KL++ M+ C  H
Sbjct  68   YCVVATESTGRQLPVGFIERVKEDFSKKYSGGKARSATANSLKREYGSKLKEHMRYCDQH  127

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKTE+   QAQDFR  G KIR
Sbjct  128  PEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGTKIR  187

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI++ALIL+IVL +C  FNC
Sbjct  188  RKMWWENMKMKLIVFGIVVALILLIVLTICRDFNC  222



>ref|XP_006448758.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|ESR61998.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77467.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=175

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV +ES+GRQ+PMAFLE +KD+FV KYGGGK ATAP N L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQ  293
            PEEISKL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN  QQ
Sbjct  125  PEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQ  172



>ref|XP_010684935.1| PREDICTED: vesicle-associated membrane protein 722-like [Beta 
vulgaris subsp. vulgaris]
Length=221

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+AFLE +KD+F  KYGGGK ATA    L+KEFGPKL++ MQ C DH
Sbjct  65   YCVVAVESAGRQIPIAFLERVKDEFTKKYGGGKAATAAAKGLNKEFGPKLKEQMQYCVDH  124

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI+KL K KAQVSEVKGVMMEN EKV DRGEKIEL VDKTEN   QAQDFR+ G KIR
Sbjct  125  PEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIR  184

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMKIK +V+ II+ALI+I++L +C GF C
Sbjct  185  RKMWWENMKIKLVVIAIIVALIIILILSICGGFKC  219



>ref|XP_008651398.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Zea mays]
Length=220

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFGPKLRDXMQXCXDH  437
            YCVV  ES GRQ+P+ F+E +KDDF  KY GGK  TA  N L +E+GPKL++ M+ C  H
Sbjct  66   YCVVATESAGRQLPVGFIERVKDDFSKKYSGGKAKTANANGLKREYGPKLKEHMKYCDQH  125

Query  436  PEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXKIR  257
            PEEI KL K KAQV+EVKGVMM+N EKV DRGEKIEL VDKTE+   QAQDFR  G KIR
Sbjct  126  PEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRAQAQDFRQQGTKIR  185

Query  256  XKMWXQNMKikxivlgiiialiliivlxVCHGFNC  152
             KMW +NMK+K IV GI++ALIL+IVL VC  F+C
Sbjct  186  RKMWWENMKMKLIVFGIVVALILLIVLTVCKDFDC  220



>ref|XP_010065490.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X1 [Eucalyptus grandis]
Length=225

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 120/159 (75%), Gaps = 3/159 (2%)
 Frame = -2

Query  616  YCVVXEESTGRQVPMAFLEXIKDDFVFKYGGGKXATAPVNSLSKEFG--PKLRDXMQXCX  443
            YCVV  ES GRQ+P+AFLE IKD+F  +YGGGK ATA  +SL++EFG  PKL++ MQ C 
Sbjct  65   YCVVAVESIGRQIPLAFLERIKDEFTNRYGGGKAATAVAHSLNREFGHRPKLKEQMQYCA  124

Query  442  DHPEEISKLXKXKAQVSEVKGVMMENXEKVFDRGEKIELFVDKTENFXQQAQDFRSXGXK  263
            DHPEEISKL K  AQ+SEVKGVMME  EKV DRG+++EL +DKTEN   QAQDFR    +
Sbjct  125  DHPEEISKLAKLTAQISEVKGVMMEYIEKVLDRGQEVELLLDKTENLRSQAQDFRQQATR  184

Query  262  IRXKMWXQNMKikxivl-giiialiliivlxVCHGFNCG  149
            +R KMW QN+KIK IVL  ++  +++I++  +C GF CG
Sbjct  185  MRRKMWLQNIKIKRIVLGIVVALILIIVLSIICGGFRCG  223



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090