BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040L11

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    266   2e-85   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    263   3e-84   Nicotiana tomentosiformis
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    257   3e-82   Sesamum indicum [beniseed]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    253   2e-80   Sesamum indicum [beniseed]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    243   1e-76   Nicotiana tomentosiformis
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                239   3e-75   Erythranthe guttata [common monkey flower]
emb|CDP14208.1|  unnamed protein product                                238   2e-74   Coffea canephora [robusta coffee]
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                237   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    237   3e-74   Nicotiana sylvestris
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    236   5e-74   Solanum lycopersicum
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...    234   4e-73   Solanum tuberosum [potatoes]
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    225   1e-69   Vitis vinifera
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...    224   4e-69   Solanum lycopersicum
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    223   1e-68   Nicotiana tomentosiformis
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    223   1e-68   Nicotiana sylvestris
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...    221   3e-68   Solanum tuberosum [potatoes]
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...    209   2e-63   Prunus mume [ume]
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    209   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg             207   2e-62   Prunus persica
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         204   3e-61   Jatropha curcas
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...    197   8e-59   Solanum tuberosum [potatoes]
emb|CBI30075.3|  unnamed protein product                                195   2e-58   Vitis vinifera
emb|CDY14768.1|  BnaC04g47650D                                          196   2e-58   Brassica napus [oilseed rape]
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...    195   8e-58   Brassica rapa
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...    192   4e-57   Fragaria vesca subsp. vesca
ref|NP_001265939.1|  Hop-interacting protein THI026                     192   6e-57   Solanum lycopersicum
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    191   2e-56   
emb|CDY06925.1|  BnaA04g23900D                                          191   4e-56   
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    191   1e-55   
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative           188   2e-55   Ricinus communis
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...    190   3e-55   
gb|KJB35924.1|  hypothetical protein B456_006G133800                    188   4e-55   Gossypium raimondii
gb|KJB16379.1|  hypothetical protein B456_002G227200                    186   2e-54   Gossypium raimondii
ref|XP_002308908.1|  Calmodulin-like family protein                     185   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                  185   5e-54   Medicago truncatula
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...    183   7e-54   
ref|XP_002323262.1|  Calmodulin-like family protein                     183   2e-53   Populus trichocarpa [western balsam poplar]
gb|AFK42347.1|  unknown                                                 183   2e-53   Medicago truncatula
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...    181   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg             181   3e-52   Citrus clementina [clementine]
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...    180   3e-52   Cicer arietinum [garbanzo]
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...    180   4e-52   Citrus sinensis [apfelsine]
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...    179   1e-51   Populus euphratica
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...    179   1e-51   Populus euphratica
emb|CDY23852.1|  BnaC04g01850D                                          178   2e-51   Brassica napus [oilseed rape]
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...    177   4e-51   
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...    177   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...    177   7e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...    177   7e-51   Tarenaya hassleriana [spider flower]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg             176   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...    175   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457             175   3e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010102734.1|  putative calcium-binding protein CML36             174   8e-50   
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg             174   9e-50   Capsella rubella
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194             174   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...    173   1e-49   Elaeis guineensis
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                   173   2e-49   Citrus sinensis [apfelsine]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...    173   3e-49   Phoenix dactylifera
gb|AAM61257.1|  calmodulin-like protein                                 171   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181672.1|  putative calcium-binding protein CML35                171   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...    171   2e-48   Camelina sativa [gold-of-pleasure]
emb|CDX79938.1|  BnaA05g02180D                                          170   3e-48   
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...    170   3e-48   Brassica rapa
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                   170   3e-48   Citrus sinensis [apfelsine]
emb|CDY00910.1|  BnaC05g42900D                                          170   4e-48   
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                    169   6e-48   Arabis alpina [alpine rockcress]
ref|NP_187630.1|  putative calcium-binding protein CML36                169   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...    169   1e-47   Glycine max [soybeans]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...    169   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008800223.1|  PREDICTED: calmodulin-like                         169   1e-47   Phoenix dactylifera
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg             168   2e-47   Eutrema salsugineum [saltwater cress]
emb|CAA48190.1|  calmodulin like protein                                167   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3               167   4e-47   Elaeis guineensis
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...    167   4e-47   Tarenaya hassleriana [spider flower]
gb|AGV22098.1|  calmodulin-like protein                                 167   5e-47   Brassica juncea [brown mustard]
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg             166   9e-47   Capsella rubella
emb|CDY60169.1|  BnaAnng16630D                                          166   1e-46   Brassica napus [oilseed rape]
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...    166   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                    164   7e-46   Arabis alpina [alpine rockcress]
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...    163   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...    163   2e-45   Brassica rapa
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g             162   3e-45   Phaseolus vulgaris [French bean]
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...    161   7e-45   Glycine max [soybeans]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...    161   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...    160   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...    157   2e-43   Eucalyptus grandis [rose gum]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...    155   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...    153   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...    150   9e-41   Elaeis guineensis
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...    148   7e-40   Elaeis guineensis
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...    146   3e-39   Phoenix dactylifera
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...    146   4e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...    145   6e-39   Phoenix dactylifera
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...    142   3e-38   
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...    142   3e-38   
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...    143   7e-38   
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg             141   3e-37   
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...    137   6e-36   Cucumis melo [Oriental melon]
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...    132   3e-34   Cucumis sativus [cucumbers]
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292              124   2e-31   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501              124   3e-31   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like      122   4e-30   Eucalyptus grandis [rose gum]
gb|ABK24059.1|  unknown                                                 123   7e-30   Picea sitchensis
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...    120   8e-30   Nicotiana tomentosiformis
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...    120   2e-29   Malus domestica [apple tree]
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...    118   7e-29   Fragaria vesca subsp. vesca
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...    117   1e-28   Solanum lycopersicum
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...    118   1e-28   Cicer arietinum [garbanzo]
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg                118   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...    120   1e-28   
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...    118   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...    118   2e-28   Sesamum indicum [beniseed]
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...    116   2e-28   Nicotiana sylvestris
gb|EPS62655.1|  hypothetical protein M569_12136                         116   5e-28   Genlisea aurea
ref|XP_009411743.1|  PREDICTED: probable calcium-binding protein ...    116   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...    115   6e-28   Sesamum indicum [beniseed]
gb|KHN40730.1|  Putative calcium-binding protein CML25                  114   7e-28   Glycine soja [wild soybean]
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...    114   8e-28   Solanum tuberosum [potatoes]
ref|XP_006843397.1|  hypothetical protein AMTR_s00053p00122010          117   9e-28   Amborella trichopoda
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                     114   9e-28   Eucalyptus grandis [rose gum]
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Glycine max [soybeans]
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...    115   1e-27   Glycine max [soybeans]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like      114   1e-27   Solanum tuberosum [potatoes]
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...    115   1e-27   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...    115   2e-27   Cucumis melo [Oriental melon]
ref|XP_010104706.1|  putative calcium-binding protein CML25             114   2e-27   Morus notabilis
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3               115   2e-27   Eucalyptus grandis [rose gum]
ref|XP_003637661.1|  Calcium-binding pollen allergen                    114   3e-27   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...    114   3e-27   
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...    114   3e-27   Elaeis guineensis
ref|XP_007033045.1|  Calmodulin like 23, putative                       113   3e-27   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...    114   4e-27   Solanum lycopersicum
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...    114   4e-27   Cicer arietinum [garbanzo]
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...    113   5e-27   Phoenix dactylifera
gb|AFK34900.1|  unknown                                                 114   5e-27   Lotus japonicus
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...    113   5e-27   Sesamum indicum [beniseed]
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like      112   6e-27   Nicotiana sylvestris
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg             113   7e-27   Prunus persica
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...    112   7e-27   Glycine max [soybeans]
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...    112   9e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63975.1|  hypothetical protein M569_10810                         112   9e-27   Genlisea aurea
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24           112   1e-26   Solanum lycopersicum
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...    112   1e-26   Solanum tuberosum [potatoes]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg                111   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...    112   1e-26   Cucumis melo [Oriental melon]
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g             111   2e-26   Phaseolus vulgaris [French bean]
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...    112   2e-26   Prunus mume [ume]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...    111   2e-26   Nicotiana tomentosiformis
gb|KJB50384.1|  hypothetical protein B456_008G168100                    112   2e-26   Gossypium raimondii
gb|KJB08532.1|  hypothetical protein B456_001G087100                    111   2e-26   Gossypium raimondii
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...    110   2e-26   Sesamum indicum [beniseed]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770          112   2e-26   Sorghum bicolor [broomcorn]
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...    111   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...    110   3e-26   Vitis vinifera
emb|CDP16307.1|  unnamed protein product                                111   3e-26   Coffea canephora [robusta coffee]
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...    111   4e-26   Eucalyptus grandis [rose gum]
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...    112   6e-26   
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...    109   8e-26   
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...    110   9e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...    109   9e-26   Malus domestica [apple tree]
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...    110   1e-25   Vitis vinifera
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...    109   1e-25   Pyrus x bretschneideri [bai li]
emb|CDY40786.1|  BnaAnng06490D                                          110   1e-25   Brassica napus [oilseed rape]
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...    108   2e-25   Cucumis sativus [cucumbers]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                         108   2e-25   Nicotiana sylvestris
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...    109   2e-25   Solanum tuberosum [potatoes]
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg                108   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...    108   2e-25   Cucumis melo [Oriental melon]
ref|XP_003616365.1|  Polcalcin Nic t                                    108   2e-25   Medicago truncatula
ref|XP_004230637.1|  PREDICTED: calmodulin-like                         108   2e-25   Solanum lycopersicum
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...    109   3e-25   Cucumis sativus [cucumbers]
gb|KHM99973.1|  Putative calcium-binding protein CML25                  108   3e-25   Glycine soja [wild soybean]
ref|NP_173866.1|  putative calcium-binding protein CML25                108   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135              107   4e-25   
ref|NP_001045400.1|  Os01g0949500                                       108   4e-25   
gb|AAZ20284.1|  calcium-binding pollen allergen                         108   4e-25   Arachis hypogaea [goober]
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...    108   4e-25   
ref|XP_002525994.1|  Polcalcin Jun o, putative                          108   4e-25   Ricinus communis
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...    108   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g             108   4e-25   Phaseolus vulgaris [French bean]
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...    109   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg             108   4e-25   Eutrema salsugineum [saltwater cress]
ref|XP_007045260.1|  Polcalcin Jun o, putative                          108   4e-25   
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...    107   5e-25   Malus domestica [apple tree]
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...    108   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g             107   6e-25   
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...    108   6e-25   
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg             107   7e-25   Citrus clementina [clementine]
ref|XP_011079925.1|  PREDICTED: calmodulin-like                         107   7e-25   Sesamum indicum [beniseed]
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836             108   7e-25   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...    108   7e-25   Populus euphratica
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198              106   8e-25   
ref|XP_011467223.1|  PREDICTED: calcium-binding protein CML24-like      106   8e-25   Fragaria vesca subsp. vesca
emb|CDM86427.1|  unnamed protein product                                107   9e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like                 106   9e-25   Solanum tuberosum [potatoes]
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...    106   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg             107   1e-24   Capsella rubella
gb|KJB15360.1|  hypothetical protein B456_002G172400                    107   1e-24   Gossypium raimondii
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711             107   1e-24   
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g             105   1e-24   Phaseolus vulgaris [French bean]
emb|CDM86445.1|  unnamed protein product                                107   1e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...    107   2e-24   Malus domestica [apple tree]
ref|XP_003630938.1|  Calcium-binding pollen allergen                    107   2e-24   
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...    107   2e-24   Elaeis guineensis
gb|KDP23917.1|  hypothetical protein JCGZ_27077                         106   2e-24   Jatropha curcas
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...    106   2e-24   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...    107   2e-24   Phoenix dactylifera
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4               107   2e-24   Tarenaya hassleriana [spider flower]
gb|AET05414.2|  EF hand calcium-binding family protein                  107   2e-24   Medicago truncatula
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...    106   2e-24   Setaria italica
gb|KEH26932.1|  EF hand calcium-binding family protein                  106   2e-24   Medicago truncatula
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...    106   2e-24   Elaeis guineensis
ref|XP_011082591.1|  PREDICTED: calmodulin-like                         105   3e-24   Sesamum indicum [beniseed]
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...    106   3e-24   Glycine max [soybeans]
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...    107   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_009617304.1|  PREDICTED: calmodulin-like                         105   3e-24   Nicotiana tomentosiformis
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...    107   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010109033.1|  putative calcium-binding protein CML23             105   3e-24   Morus notabilis
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg             105   3e-24   Prunus persica
gb|AAM67124.1|  calmodulin-related protein                              105   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like      104   4e-24   Cicer arietinum [garbanzo]
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...    105   4e-24   Elaeis guineensis
ref|NP_001152603.1|  polcalcin Jun o 2                                  106   5e-24   
gb|ACG44451.1|  polcalcin Jun o 2                                       105   5e-24   Zea mays [maize]
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Brassica rapa
gb|EAY97018.1|  hypothetical protein OsI_18939                          105   5e-24   Oryza sativa Indica Group [Indian rice]
gb|ABK26821.1|  unknown                                                 105   5e-24   Picea sitchensis
ref|NP_564874.1|  calmodulin like 23                                    105   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...    106   5e-24   Setaria italica
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1            105   6e-24   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...    105   6e-24   Eucalyptus grandis [rose gum]
emb|CDX84967.1|  BnaC05g20880D                                          105   6e-24   
gb|AFK37714.1|  unknown                                                 104   6e-24   Medicago truncatula
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11              104   6e-24   Pyrus x bretschneideri [bai li]
gb|ABK26031.1|  unknown                                                 105   6e-24   Picea sitchensis
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...    106   7e-24   Citrus sinensis [apfelsine]
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...    105   7e-24   Nicotiana sylvestris
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...    105   7e-24   Brassica rapa
ref|XP_001768532.1|  predicted protein                                  105   7e-24   
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                   105   7e-24   Citrus sinensis [apfelsine]
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...    103   7e-24   Glycine max [soybeans]
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...    103   7e-24   
dbj|BAJ88405.1|  predicted protein                                      105   8e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991              103   8e-24   
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...    105   9e-24   Sesamum indicum [beniseed]
gb|KJB60897.1|  hypothetical protein B456_009G330300                    104   1e-23   Gossypium raimondii
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...    104   1e-23   Elaeis guineensis
emb|CDP19328.1|  unnamed protein product                                103   1e-23   Coffea canephora [robusta coffee]
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...    103   1e-23   Prunus mume [ume]
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                    104   2e-23   Arabis alpina [alpine rockcress]
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like         103   2e-23   Glycine max [soybeans]
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11              102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8        103   2e-23   Vitis vinifera
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg                102   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742             102   3e-23   
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   Elaeis guineensis
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                     103   3e-23   Eucalyptus grandis [rose gum]
ref|XP_011034524.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   Populus euphratica
gb|EPS69688.1|  hypothetical protein M569_05080                         102   3e-23   Genlisea aurea
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg             103   3e-23   
ref|XP_001779680.1|  predicted protein                                  103   3e-23   
ref|XP_002322096.1|  calcium binding family protein                     103   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...    103   4e-23   Phoenix dactylifera
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...    103   4e-23   Sesamum indicum [beniseed]
emb|CDY24421.1|  BnaCnng04880D                                          105   4e-23   Brassica napus [oilseed rape]
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...    105   4e-23   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                       102   4e-23   Glycine max [soybeans]
gb|AFK83800.1|  calmodulin                                              102   5e-23   Mnemiopsis leidyi [American comb jelly]
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...    102   5e-23   Nicotiana tomentosiformis
ref|NP_001241810.1|  polcalcin Jun o 2                                  103   5e-23   
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11              102   5e-23   
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...    102   5e-23   Nicotiana sylvestris
ref|NP_001150713.1|  LOC100284346                                       103   5e-23   Zea mays [maize]
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...    102   5e-23   Brachypodium distachyon [annual false brome]
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg             102   6e-23   Citrus clementina [clementine]
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...    102   6e-23   Nicotiana tomentosiformis
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...    102   6e-23   
ref|XP_004492663.1|  PREDICTED: probable calcium-binding protein ...    102   7e-23   
ref|XP_001765534.1|  predicted protein                                  102   7e-23   
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3               101   8e-23   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...    102   8e-23   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234             102   8e-23   
gb|KEH41241.1|  EF hand calcium-binding family protein                  101   9e-23   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                    102   9e-23   
gb|ADD38579.1|  Calmodulin                                              101   1e-22   
emb|CBX25281.1|  hypothetical_protein                                   102   1e-22   
ref|XP_001785090.1|  predicted protein                                  102   1e-22   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...    102   1e-22   
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg             101   1e-22   
ref|XP_010097572.1|  putative calcium-binding protein CML27             101   1e-22   
gb|ACO12252.1|  Calmodulin                                              101   1e-22   
ref|XP_001751654.1|  predicted protein                                  101   1e-22   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg             101   1e-22   
gb|EMS57491.1|  putative calcium-binding protein CML18                  103   1e-22   
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...    100   1e-22   
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg             102   1e-22   
sp|Q0DJV6.1|CML18_ORYSJ  RecName: Full=Probable calcium-binding p...    100   1e-22   
emb|CBX25368.1|  hypothetical_protein                                   100   2e-22   
ref|XP_003565059.1|  PREDICTED: probable calcium-binding protein ...    102   2e-22   
gb|EEE62792.1|  hypothetical protein OsJ_17595                          101   2e-22   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...    101   2e-22   
ref|XP_009604908.1|  PREDICTED: probable calcium-binding protein ...    102   2e-22   
gb|KEH41232.1|  EF hand calcium-binding family protein                  100   2e-22   
gb|KJB30167.1|  hypothetical protein B456_005G131800                    101   2e-22   
ref|XP_006301789.1|  hypothetical protein CARUB_v10022253mg             100   2e-22   
ref|NP_173259.1|  putative calcium-binding protein CML27                101   2e-22   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...    100   2e-22   
gb|KCW52116.1|  hypothetical protein EUGRSUZ_J01551                     100   2e-22   
gb|AAV59327.1|  unknown protein                                         100   2e-22   
ref|XP_003623726.1|  Calcium-binding protein CML24                      101   2e-22   
dbj|BAK01430.1|  predicted protein                                      100   2e-22   
ref|XP_002520954.1|  calmodulin, putative                               100   2e-22   
gb|KHN04934.1|  Calmodulin-like protein 8                               100   2e-22   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg                100   2e-22   
ref|XP_010511464.1|  PREDICTED: probable calcium-binding protein ...    100   2e-22   
ref|XP_003631098.1|  SLR1/LCR-like protein                              100   2e-22   
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...    101   2e-22   
gb|AHA51383.1|  EF-hand_1 domain-containing protein                     100   2e-22   
ref|XP_006372871.1|  hypothetical protein POPTR_0017s05860g             102   3e-22   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g             101   3e-22   
emb|CDO98355.1|  unnamed protein product                                101   3e-22   
gb|EMT07142.1|  Putative calcium-binding protein CML10                  100   3e-22   
ref|XP_010032678.1|  PREDICTED: calcium-binding protein CML24         99.8    3e-22   
gb|KJB24793.1|  hypothetical protein B456_004G160800                    101   3e-22   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                         100   3e-22   
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360          100   3e-22   
emb|CDX98375.1|  BnaC06g17360D                                          101   3e-22   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...    100   4e-22   
gb|KHN17940.1|  Putative calcium-binding protein CML27                99.8    4e-22   
emb|CDX67796.1|  BnaA07g18360D                                          100   4e-22   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...    100   4e-22   
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  99.8    4e-22   
gb|ABK21927.1|  unknown                                               99.8    4e-22   
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4               100   4e-22   
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 99.8    4e-22   
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...    102   5e-22   
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1               100   5e-22   
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       99.8    5e-22   
ref|XP_006409534.1|  hypothetical protein EUTSA_v10022869mg             100   5e-22   
ref|XP_005717351.1|  Calmodulin                                       99.4    5e-22   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   99.4    5e-22   
ref|XP_011037098.1|  PREDICTED: calmodulin-like protein 3               101   5e-22   
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...    100   5e-22   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  99.8    5e-22   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  99.8    5e-22   
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g           99.8    5e-22   
gb|EYU40667.1|  hypothetical protein MIMGU_mgv1a015381mg              99.8    5e-22   
emb|CDY19196.1|  BnaC05g13970D                                          100   6e-22   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  99.8    6e-22   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       99.4    6e-22   
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...  99.8    6e-22   
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  99.8    6e-22   
ref|XP_002532464.1|  Calcium-binding allergen Ole e, putative         99.4    6e-22   
ref|XP_006663807.1|  PREDICTED: probable calcium-binding protein ...  99.8    7e-22   
gb|EAY97840.1|  hypothetical protein OsI_19761                          100   7e-22   
emb|CDX96729.1|  BnaA08g22720D                                        99.8    7e-22   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  99.4    7e-22   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  99.4    8e-22   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  99.4    8e-22   
gb|KEQ79382.1|  putative calmodulin                                   99.0    8e-22   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  99.4    9e-22   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  99.4    9e-22   
gb|KFK40244.1|  hypothetical protein AALP_AA3G348900                    100   9e-22   
ref|XP_006851533.1|  hypothetical protein AMTR_s00040p00172050        99.8    9e-22   
gb|KEQ67258.1|  putative calmodulin                                   99.0    1e-21   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           99.4    1e-21   
ref|NP_001055397.1|  Os05g0380900                                     99.8    1e-21   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  99.4    1e-21   
ref|XP_002320065.2|  hypothetical protein POPTR_0014s06640g             100   1e-21   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  99.0    1e-21   
ref|XP_001785095.1|  predicted protein                                98.2    1e-21   
ref|XP_007134898.1|  hypothetical protein PHAVU_010G085100g             100   1e-21   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  99.0    1e-21   
gb|AFW81600.1|  polcalcin Jun o 2                                     99.4    1e-21   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  99.0    1e-21   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             98.2    1e-21   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     99.0    1e-21   
ref|XP_011012929.1|  PREDICTED: calmodulin-like protein 3             99.8    1e-21   
gb|KEQ77625.1|  calmodulin-like protein                               98.6    1e-21   
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   98.2    1e-21   
emb|CDY70127.1|  BnaA06g38470D                                        98.6    1e-21   
gb|KEH30330.1|  EF hand calcium-binding family protein                98.2    1e-21   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  98.6    2e-21   
ref|XP_007163958.1|  hypothetical protein PHAVU_L002000g              98.6    2e-21   
gb|KJB30717.1|  hypothetical protein B456_005G156600                  98.6    2e-21   
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             97.8    2e-21   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  98.6    2e-21   
ref|NP_001041950.2|  Os01g0135700                                     98.6    2e-21   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  98.2    2e-21   
gb|ACN35459.1|  unknown                                               99.8    2e-21   
gb|ACG37753.1|  calmodulin                                            99.8    2e-21   
gb|EAY86614.1|  hypothetical protein OsI_07995                        98.2    2e-21   
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            97.8    2e-21   
ref|XP_006851809.1|  hypothetical protein AMTR_s00041p00030040        99.4    2e-21   
emb|CAC43238.1|  calcium binding protein                              98.6    2e-21   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  98.2    2e-21   
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     97.8    2e-21   
emb|CAD41532.1|  OSJNBb0091E11.1                                      99.0    2e-21   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       97.8    2e-21   
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     99.0    2e-21   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            97.8    2e-21   
ref|XP_006120374.1|  PREDICTED: calmodulin, striated muscle-like      97.8    2e-21   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  97.8    2e-21   
gb|EMT17394.1|  Putative calcium-binding protein CML18                98.2    2e-21   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      98.6    2e-21   
emb|CAH67730.1|  H0522A01.1                                           99.0    2e-21   
ref|XP_010517286.1|  PREDICTED: calmodulin-like protein 1             98.6    2e-21   
emb|CAC34625.1|  putative calmodulin-related protein                  98.2    2e-21   
ref|XP_010520850.1|  PREDICTED: calmodulin-like protein 2             97.8    2e-21   
ref|XP_008673745.1|  PREDICTED: probable calcium-binding protein ...  98.6    2e-21   
ref|XP_010467315.1|  PREDICTED: calmodulin-like protein 1 isoform X1  98.6    2e-21   
gb|KJB43703.1|  hypothetical protein B456_007G212400                  98.6    2e-21   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             97.4    3e-21   
gb|KFO18269.1|  Calmodulin                                            98.2    3e-21   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  98.2    3e-21   
ref|XP_007139465.1|  hypothetical protein PHAVU_008G031800g           98.2    3e-21   
ref|XP_006646679.1|  PREDICTED: probable calcium-binding protein ...  96.7    3e-21   
ref|XP_010528534.1|  PREDICTED: calcium-binding protein CML24-like    97.8    3e-21   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           97.4    3e-21   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    97.1    3e-21   
gb|EYU46104.1|  hypothetical protein MIMGU_mgv1a022077mg              97.4    3e-21   
ref|XP_002317881.2|  calcium binding family protein                   97.8    3e-21   
ref|XP_009386769.1|  PREDICTED: calmodulin-like                       97.4    3e-21   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  97.4    3e-21   
sp|P14533.1|CABO_DORPE  RecName: Full=Squidulin; AltName: Full=Op...  97.1    3e-21   
ref|XP_006366822.1|  PREDICTED: calmodulin-like protein 3-like        97.1    3e-21   
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           97.1    3e-21   
ref|XP_002310432.2|  hypothetical protein POPTR_0007s01960g           98.6    3e-21   
ref|XP_006095104.1|  PREDICTED: calmodulin-like                       97.1    3e-21   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      97.4    3e-21   
ref|XP_010506196.1|  PREDICTED: calmodulin-like protein 5             98.6    4e-21   
ref|XP_007036791.1|  Calcium-binding EF-hand family protein           97.4    4e-21   
ref|XP_007295339.1|  calmodulin                                       97.4    4e-21   
ref|XP_010098458.1|  Calmodulin-like protein 1                        97.1    4e-21   
gb|AAB03218.1|  calmodulin-like myosin-light chain                    97.1    4e-21   
ref|NP_565996.1|  calmodulin-like protein MSS3                        98.6    4e-21   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  97.8    4e-21   
gb|KJB17907.1|  hypothetical protein B456_003G023100                  97.8    4e-21   
ref|XP_009607745.1|  PREDICTED: calmodulin-like protein 3             97.1    4e-21   
gb|KJB42986.1|  hypothetical protein B456_007G178400                  97.1    4e-21   
ref|XP_011026425.1|  PREDICTED: calmodulin-like protein 3             98.6    4e-21   
ref|XP_006299618.1|  hypothetical protein CARUB_v10015796mg           98.2    4e-21   
ref|XP_007200520.1|  hypothetical protein PRUPE_ppa012929mg           96.7    4e-21   
ref|XP_008232680.1|  PREDICTED: calmodulin-like                       98.2    5e-21   
ref|XP_001768906.1|  predicted protein                                96.3    5e-21   
ref|XP_009123945.1|  PREDICTED: calmodulin-like protein 5             97.4    5e-21   
ref|XP_006643684.1|  PREDICTED: probable calcium-binding protein ...  97.4    5e-21   
emb|CDP17785.1|  unnamed protein product                              97.1    5e-21   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  97.8    5e-21   
ref|XP_001779716.1|  predicted protein                                96.3    5e-21   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             96.7    5e-21   
ref|NP_191503.1|  calmodulin-like protein 4                           97.8    5e-21   
ref|XP_001766863.1|  predicted protein                                96.3    5e-21   
ref|NP_001147205.1|  calmodulin                                       98.6    5e-21   
ref|NP_001053179.1|  Os04g0492800                                     99.0    6e-21   
ref|XP_003372739.1|  EF hand domain containing protein                98.6    6e-21   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11            96.3    6e-21   
ref|XP_002305867.1|  putative calmodulin-related family protein       96.7    6e-21   
ref|XP_006662725.1|  PREDICTED: probable calcium-binding protein ...  97.4    6e-21   
prf||0608335A  calmodulin                                             96.3    6e-21
gb|AHA51313.1|  EF-hand_1 domain-containing protein                   96.7    7e-21   
ref|XP_008359373.1|  PREDICTED: calmodulin-like protein 8             96.3    7e-21   
ref|XP_005704341.1|  calmodulin isoform 1                             96.7    7e-21   
gb|KEQ93845.1|  hypothetical protein AUEXF2481DRAFT_6419              96.3    7e-21   
ref|XP_006445234.1|  hypothetical protein CICLE_v10022392mg           97.4    7e-21   
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                 96.3    8e-21   
emb|CDO97169.1|  unnamed protein product                              97.1    8e-21   
ref|XP_002441014.1|  hypothetical protein SORBIDRAFT_09g018860        97.4    8e-21   
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           95.9    9e-21   
ref|XP_011032625.1|  PREDICTED: calmodulin-like protein 11            95.9    9e-21   
ref|XP_004290639.1|  PREDICTED: calmodulin-like protein 8             95.9    9e-21   
ref|XP_008235348.1|  PREDICTED: calmodulin-like protein 11            95.9    9e-21   
emb|CEL63589.1|  Calmodulin OS=Agaricus bisporus PE=1 SV=2            95.9    9e-21   
ref|XP_007162475.1|  hypothetical protein PHAVU_001G155400g           95.9    1e-20   
ref|XP_001768907.1|  predicted protein                                96.3    1e-20   
ref|XP_010671432.1|  PREDICTED: calcium-binding allergen Ole e 8-...  96.3    1e-20   
ref|XP_010498205.1|  PREDICTED: probable calcium-binding protein ...  96.3    1e-20   
ref|XP_004968030.1|  PREDICTED: probable calcium-binding protein ...  97.1    1e-20   
ref|XP_011084127.1|  PREDICTED: calmodulin-like protein 3             97.4    1e-20   
ref|XP_004486916.1|  PREDICTED: calmodulin-like protein 5-like        96.7    1e-20   
gb|KJB53034.1|  hypothetical protein B456_008G289600                  95.9    1e-20   
gb|KDO85857.1|  hypothetical protein CISIN_1g047502mg                 95.5    1e-20   
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2            95.9    1e-20   
ref|XP_002881895.1|  hypothetical protein ARALYDRAFT_903714           97.4    1e-20   
ref|NP_001173067.1|  Os02g0606501                                     95.9    1e-20   
ref|XP_009142186.1|  PREDICTED: calmodulin-like protein 5             97.1    1e-20   
ref|XP_010277405.1|  PREDICTED: probable calcium-binding protein ...  97.1    1e-20   
gb|ABR17206.1|  unknown                                               97.8    1e-20   
gb|EHH17309.1|  hypothetical protein EGK_13688                        95.5    1e-20   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            95.5    1e-20   
dbj|BAJ92507.1|  predicted protein                                    96.3    1e-20   
ref|XP_009799079.1|  PREDICTED: probable calcium-binding protein ...  95.9    1e-20   
ref|XP_009147069.1|  PREDICTED: calmodulin-like protein 3             95.5    1e-20   
gb|KDP23657.1|  hypothetical protein JCGZ_23490                       95.5    1e-20   
ref|XP_010467316.1|  PREDICTED: calmodulin-like protein 1 isoform X2  96.7    1e-20   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11            95.5    1e-20   
gb|EPX74846.1|  calmodulin Cam1                                       95.5    1e-20   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEALL  591
            KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA+L
Sbjct  46   KKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEAIL  105

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  411
            S+VG EPPS+EEL L+L EVDRDGDGCISLEEF  + SAF PPSCD ELRDAFDFFD DH
Sbjct  106  SRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAIRSAFGPPSCDGELRDAFDFFDADH  165

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DG I+AEELFNVF+TIGD RCTLEDCRRMI GVD NGDGFVCFEDFC MME
Sbjct  166  DGMITAEELFNVFRTIGDGRCTLEDCRRMIRGVDKNGDGFVCFEDFCFMME  216



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEALL  591
            KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA+L
Sbjct  46   KKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEAIL  105

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  411
            S+VG EPPS+EEL L+L EVDRDGDGCISLEEF  +SSAF PPSCD ELRD FDFFD DH
Sbjct  106  SRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAISSAFGPPSCDGELRDVFDFFDADH  165

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DGKI+AE+LFNVF+TIGD RCTLEDCRRMI GVD NGDGFVCF+DFC MME
Sbjct  166  DGKITAEKLFNVFRTIGDGRCTLEDCRRMIRGVDKNGDGFVCFDDFCLMME  216



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEALL  591
            KKP G STPTSVLP L+ +IS +E S +    Y EL QAF++IDRD DGKI+KEELEALL
Sbjct  46   KKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEALL  105

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  411
             ++GAEPP++EEL+LMLS+VDRDGDGCI+LEEF  + SAFAPP+CD ELRD FDFFD+D 
Sbjct  106  CRLGAEPPNQEELQLMLSDVDRDGDGCITLEEFYAIGSAFAPPTCDMELRDTFDFFDSDR  165

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DGKI+AEELFNVFKTIGDS+CTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  166  DGKITAEELFNVFKTIGDSQCTLEDCRRMISGVDTNGDGFVCFEDFSRMME  216



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEALL  591
            KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE LL
Sbjct  46   KKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEGLL  105

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  411
             ++G EPP +EEL+LML+EVDRDGDGCISLEEF  + SAFAPP+ D ELRDAFDFFD+D 
Sbjct  106  CRLGPEPPCQEELKLMLTEVDRDGDGCISLEEFYAIGSAFAPPARDGELRDAFDFFDSDR  165

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DGKI+AEEL NVFKTIGD+RCTLEDCRRMI GV+ NGDGFVCFEDF RMME
Sbjct  166  DGKITAEELLNVFKTIGDARCTLEDCRRMIRGVNRNGDGFVCFEDFSRMME  216



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 6/167 (4%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++VG
Sbjct  46   KKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTRVG  99

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
             +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD DHDGKI
Sbjct  100  PDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDADHDGKI  159

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +AEELFNVF+TIGD RCTL+DCRRMI GVD NGDGFVCFEDFC MME
Sbjct  160  TAEELFNVFRTIGDGRCTLDDCRRMIRGVDKNGDGFVCFEDFCLMME  206



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -1

Query  758  KKPGGESTPTSVLP-ALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEAL  594
            KKP G STPTSVLP A + EIS +E S +    Y +L QAF++IDRD DGK+ K ELE L
Sbjct  48   KKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELEDL  107

Query  593  LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  414
            L  +GA+PPSREELRLMLSEVDRDGDGCI+LEEF  + SAFAPP+CD+E+R+ FDFFD+D
Sbjct  108  LCGLGADPPSREELRLMLSEVDRDGDGCITLEEFHSIGSAFAPPTCDTEMRETFDFFDSD  167

Query  413  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
             DGKI+AEELF VF+TIGD++CTLEDCRRMI GVD NGDGFVCFEDF  MM+
Sbjct  168  RDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVDRNGDGFVCFEDFSLMMD  219



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 5/168 (3%)
 Frame = -1

Query  749  GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  585
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  584  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            VGAEPPS EEL ++LSEVDRDGDGCISLEEF  + SAF PPSCDSE+RDAFDFFDTDHDG
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCISLEEFEAIGSAFGPPSCDSEMRDAFDFFDTDHDG  185

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +I+AEEL+NVF+ IGD +CTL++C+RMI GV  NG GFVCFEDF RMM
Sbjct  186  RITAEELYNVFRVIGDGQCTLDECQRMISGVGKNGVGFVCFEDFSRMM  233



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 9/164 (5%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
            PS+EEL+LM+SEVDRDGDGCISLEEF  + SAFAPP+CD ELR  FDFFD+D DGKI+AE
Sbjct  95   PSQEELKLMVSEVDRDGDGCISLEEFYAIGSAFAPPTCDGELRSTFDFFDSDRDGKITAE  154

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ELF VF+TIGD+RCTLEDCRRMI GVD NGDGFVCFEDF  MM+
Sbjct  155  ELFRVFETIGDARCTLEDCRRMIKGVDRNGDGFVCFEDFSLMMD  198



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 6/167 (4%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            +KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++VG
Sbjct  46   QKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTRVG  99

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
             +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD +HDGKI
Sbjct  100  PDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDANHDGKI  159

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +AEELFNVF+TIGD RCTLEDCR MI GVD NGDGFVCFEDFC MME
Sbjct  160  TAEELFNVFRTIGDGRCTLEDCRHMIRGVDKNGDGFVCFEDFCLMME  206



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 5/167 (3%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            +KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+VG
Sbjct  43   RKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSRVG  97

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
             EPPS+EEL L+L EVD DGDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDGKI
Sbjct  98   TEPPSKEELMLLLEEVDVDGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDGKI  157

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +A+ELF+VF+ IGDSRCTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  158  TADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCIMME  204



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 5/166 (3%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+VG 
Sbjct  46   KPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSRVGT  100

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  396
            EPPS+EEL L+L EVD +GDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+
Sbjct  101  EPPSKEELMLLLEEVDVNGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDGKIT  160

Query  395  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            A+ELF+VF+ IGDSRCTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  161  ADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDFCVMME  206



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 129/162 (80%), Gaps = 4/162 (2%)
 Frame = -1

Query  734  PTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
            PTSVLP  + EIS D     S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  384
             EE+ +MLSEVDRDGDGCISLEEF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL
Sbjct  119  EEEIMMMLSEVDRDGDGCISLEEFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEEL  177

Query  383  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
              VF  IGD RCTLEDC+RMI GVD NGDGFVCFEDF RMME
Sbjct  178  NQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDFSRMME  219



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = -1

Query  725  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  549
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  548  LMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK  369
             +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+
Sbjct  140  QLLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFR  199

Query  368  TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            TIGD RCTLE+CRRMI GVD NGDGFVCFEDF  MME
Sbjct  200  TIGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMME  236



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 141/182 (77%), Gaps = 15/182 (8%)
 Frame = -1

Query  758  KKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEEL  603
            K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+L
Sbjct  41   KPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQL  100

Query  602  EALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS------EL  444
            EA+LS+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF      +      E+
Sbjct  101  EAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELTEATTAEDGGDEM  160

Query  443  RDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRM  264
            RDAFDFFDTDHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD NGDGFVCFEDFC M
Sbjct  161  RDAFDFFDTDHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLM  220

Query  263  ME  258
            ME
Sbjct  221  ME  222



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 139/178 (78%), Gaps = 15/178 (8%)
 Frame = -1

Query  746  GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  591
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  590  SQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS------CDSELRDAF  432
            S+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF  P          E+RDAF
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELPEEMTAEDGGDEMRDAF  164

Query  431  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DFFD DHDGKI+AEELFNVF+ IGD+RCTLEDCRRMI  VD NGDGFVCFEDFC MME
Sbjct  165  DFFDADHDGKITAEELFNVFRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLMME  222



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -1

Query  725  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  546
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  545  MLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKT  366
            +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+T
Sbjct  107  LLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRT  166

Query  365  IGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            IGD RCTLE+CRRMI GVD NGDGFVCFEDF  MME
Sbjct  167  IGDGRCTLEECRRMIRGVDKNGDGFVCFEDFSLMME  202



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
            PS+EE+ LMLSEVDR+G+G I+L+           P+ DSELRDAF  FD+DHDGKISAE
Sbjct  123  PSQEEVMLMLSEVDREGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAE  182

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ELFNVF  IGD RCTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  183  ELFNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMME  226



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 5/170 (3%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  588
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  587  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  408
            ++G EPPS+EE+ LML+E+D+DGDGCISLEEF  +SS+  P +  S+LR+AF+ FD D D
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCISLEEFEAISSSLVPAAL-SDLREAFNVFDADRD  165

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKISAEEL  VF  IGD RCTLEDCRRMI  VD NGDGFVCFEDF RMME
Sbjct  166  GKISAEELLGVFSAIGDDRCTLEDCRRMIRSVDTNGDGFVCFEDFSRMME  215



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
            PS+EE+ LMLSEVDR+G+G ISLE           P+ DSELRDAF+ FD+DHDGKISAE
Sbjct  123  PSQEEVMLMLSEVDREGNGSISLEALLSRVGPVCGPAADSELRDAFEVFDSDHDGKISAE  182

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL NVF  IGD RCTLEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  183  ELLNVFTAIGDDRCTLEDCRRMIAGVDKNGDGFVCFEDFARMME  226



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  378
            E+  MLSEVD  GDGCIS+E       +   P+ D ELR AF+FFD D DGKI+AEELF 
Sbjct  117  EVATMLSEVDHVGDGCISVEALMNRIGSACEPAGDDELRVAFEFFDADQDGKITAEELFG  176

Query  377  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            V+K IGD RCT EDC RMI  VD NGDGFVCFEDFCRMME
Sbjct  177  VYKAIGDERCTFEDCMRMIASVDKNGDGFVCFEDFCRMME  216



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 12/171 (7%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  573
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  572  -PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCD---SELRDAFDFFDTDH  411
             PP+ EEL L+L E+D++GDGCISLE F  ++SAF   PPS      E+RDAFDFFD DH
Sbjct  103  SPPTEEELVLLLDELDKNGDGCISLENFETITSAFEPTPPSAAEDAGEMRDAFDFFDEDH  162

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD NGDGFVCFEDFC MME
Sbjct  163  DGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDFCLMME  213



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -1

Query  635  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC  456
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF P +C
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFGP-AC  106

Query  455  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  276
            D+ELRDAF FFDTD DGKI+AEEL  VF  IGD RCTLEDC+RMI GVD NGDGFVCFED
Sbjct  107  DTELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFED  166

Query  275  FCRMME  258
            F RMME
Sbjct  167  FSRMME  172



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 123/171 (72%), Gaps = 16/171 (9%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDVDH  159

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  160  DGRISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score =   195 bits (495),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 121/171 (71%), Gaps = 17/171 (10%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDLDH  157

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DG+ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  158  DGRISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  208



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = -1

Query  758  KKPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
             KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++
Sbjct  46   HKPGGPAATPTSVLPGDWSEFS-------SVDMAQAFRLIDRDNDGVVSRTELEALLKRL  98

Query  581  -GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP---PSCDSELRDAFDFFDTD  414
             GAEPP++EE+ +MLSEVD DGDGCI LE    L   F P   P+ DSELR+AF+ FDTD
Sbjct  99   LGAEPPTQEEVAMMLSEVDGDGDGCIPLE---ALLHRFGPGCEPAADSELREAFEVFDTD  155

Query  413  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            HDGKISAEEL +VF  IGD RCTLE+CRRMI  VD NGDGFVCF+DF RMM+
Sbjct  156  HDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDFARMMD  207



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 12/172 (7%)
 Frame = -1

Query  740  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  575  E-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSCDS---ELRDAFDFFDTD  414
            + PPS EEL L+L E+D +GDGCISLE F  ++SAF   P S      E+RDAFDFFD D
Sbjct  100  KSPPSEEELVLLLDELDENGDGCISLENFETITSAFESTPTSAAGDAGEMRDAFDFFDED  159

Query  413  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            HDGKI+ EELFNVF+ IGD RCTLE+C+RMI  VD NGDGFVCF+DFC MME
Sbjct  160  HDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFDDFCLMME  211



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 124/170 (73%), Gaps = 15/170 (9%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  588
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALLS
Sbjct  57   GGIATPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLS  107

Query  587  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  408
            ++G +PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+  DTD+D
Sbjct  108  RLGNDPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVXDTDND  167

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKISAEEL  VF  IGD RCTLE+CRRMI GVD +GDGFVCFE+F  MME
Sbjct  168  GKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMME  217



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 120/168 (71%), Gaps = 10/168 (6%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
            EPPS+EE+ LML EVD  GDGCISLEE +  V  S+        E+R+ F+FFD DHDG+
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEELASRVAGSSSDSDESSVEMREVFEFFDVDHDGR  162

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  163  ISAEELHRVFGVIGDERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 123/170 (72%), Gaps = 15/170 (9%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  588
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALL 
Sbjct  128  GGITTPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLC  178

Query  587  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  408
            ++G  PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+ FDTD+D
Sbjct  179  RLGNAPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVFDTDND  238

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKISAEEL  VF  IGD RCTLE+CRRMI GVD +GDGFVCFE+F  MME
Sbjct  239  GKISAEELLRVFTAIGDERCTLEECRRMIDGVDKDGDGFVCFEEFVHMME  288



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 122/164 (74%), Gaps = 12/164 (7%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC----DSELRDAFDFFDTDHDGKISAE  390
            E+  MLSEVDRDGDGCIS+E    L S    P+C    D ELR AF+FFDTDHDGKI+AE
Sbjct  108  EVATMLSEVDRDGDGCISVE---ALMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAE  164

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL  V+K IGD RCTL+DCRRMI GVD NGDGFVCFEDF RMME
Sbjct  165  ELMGVYKAIGDERCTLDDCRRMIAGVDKNGDGFVCFEDFARMME  208



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  573
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  572  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  393
            PPS+EE+ LMLSEVDRDG G I+LE         + P  DSELRDAF+ FDTD+DGKISA
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSITLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISA  233

Query  392  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EEL  VF  IGD RCTLE+CRRMI  VD NGDGFVCFE+F  MME
Sbjct  234  EELLRVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFEEFVHMME  278



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 119/167 (71%), Gaps = 4/167 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEALL +V  +P
Sbjct  61   AGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEALLGKVARQP  119

Query  569  PSREELRLMLSEVDRDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  396
            PSR E+ LMLSEVD DGDG I+LE     V+  A   P+C+ ELR+ FD FDTDHDGKI+
Sbjct  120  PSRIEVSLMLSEVDGDGDGYINLETLMNQVVGPACDEPACEPELRETFDIFDTDHDGKIT  179

Query  395  AEELFNVFK-TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            AEEL   FK  IGD RCTLEDCRRMI  VD N DGFVCFEDF RMME
Sbjct  180  AEELMAFFKDKIGDERCTLEDCRRMIASVDKNEDGFVCFEDFSRMME  226



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 118/167 (71%), Gaps = 11/167 (7%)
 Frame = -1

Query  746  GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  396
            +PPS+EE+  ML EVD DGDGCISLE    L +  A P+C+ ELR+ FD FDTDHDGKI+
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCISLE---TLINQVAGPACEPELRETFDIFDTDHDGKIT  173

Query  395  AEELFNVFK-TIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            AEEL   +K  +GD RCTLEDCR MI  VD NGDGFVCF+DF RMME
Sbjct  174  AEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDFSRMME  220



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 119/163 (73%), Gaps = 6/163 (4%)
 Frame = -1

Query  746  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  567
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  566  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  387
            S EE+ ++L EVD      IS+E  +        P+ D ELRDAF FFD+D DGKI+A+E
Sbjct  113  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGDDELRDAFVFFDSDRDGKITADE  167

Query  386  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            L NV+K  GD +CTLEDCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  168  LLNVYKAFGDEKCTLEDCRRMIAVVDKNGDGFVCFEDFCRMME  210



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 124/168 (74%), Gaps = 5/168 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  569  PSREELRLMLSEVDRDGDGCISLE----EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD DG+
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGR  165

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ISAEEL  VF+ IGD RCTLE+C+RMI GVD NGDGFVCF++F  MM+
Sbjct  166  ISAEELLRVFRAIGDERCTLEECKRMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCISL+  
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94

Query  491  --SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMI  321
               V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK TIGD RCTLEDCRRMI
Sbjct  95   MTQVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMI  154

Query  320  LGVDNNGDGFVCFEDFCRMME  258
              VD NGDGFVCFEDF RMME
Sbjct  155  ASVDKNGDGFVCFEDFARMME  175



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 6/164 (4%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
            PS +E+ +ML EVD      IS+EE +    +   P+   ELRDAF FFD+D DGKI+AE
Sbjct  115  PSSQEMAVMLGEVD-----LISVEELASRLGSACEPAGGDELRDAFVFFDSDRDGKITAE  169

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL NV+K  GD +CTLEDC+ MI  VD NGDGFVCFEDFCRMME
Sbjct  170  ELLNVYKAFGDEKCTLEDCKGMIAVVDKNGDGFVCFEDFCRMME  213



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  569  PSREELRLMLSEVDRDGDGCISLE----EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD DG+
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGR  165

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ISAEEL  VF+ IGD RC LE+C+RMI GVD NGDGFVCF++F  MM+
Sbjct  166  ISAEELLRVFRAIGDERCALEECKRMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 8/173 (5%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  591
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDT  417
            S++  +PPS+EE+ +ML  VD   DGCISLEE +  V  S+ A      ELR+ F FFD 
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCISLEELANRVAGSSAAGSMEAGELREVFGFFDA  168

Query  416  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            D DG+ISAEEL  VF  IGD RCTLE+C+RMI  VD NGDG+VCF+DF RMME
Sbjct  169  DRDGRISAEELHRVFAVIGDERCTLEECQRMIATVDGNGDGYVCFDDFSRMME  221



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 123/169 (73%), Gaps = 4/169 (2%)
 Frame = -1

Query  752  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  581  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            GA+PP++EE++ MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHDG
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHDG  169

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            KI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  170  KITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  218



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
               EE+ +ML+EVD DG GCIS+E         + P+ + ELR+AF+ FDTD DG+ISAE
Sbjct  111  ---EEIAIMLTEVDGDGRGCISVEAIMNRVGTGSDPNPEEELREAFEVFDTDRDGRISAE  167

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL  VFK IGD RCTLE+CRRMI GVD N DGFVCFEDF RMME
Sbjct  168  ELLRVFKAIGDERCTLEECRRMIEGVDKNRDGFVCFEDFSRMME  211



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 122/169 (72%), Gaps = 4/169 (2%)
 Frame = -1

Query  752  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            P    TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  581  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            GA+PP++EE+  MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHDG
Sbjct  110  GADPPTQEEVSSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHDG  169

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            KI+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  170  KITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  218



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 6/163 (4%)
 Frame = -1

Query  746  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  567
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  566  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE  387
            S EE+ ++L EVD      IS+E  +        P+ + ELRDAF FFD+D DGKI+A+E
Sbjct  108  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGNDELRDAFVFFDSDRDGKITADE  162

Query  386  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            L NV+K  GD +CTL+DCRRMI  VD NGDGFVCFEDFCRMME
Sbjct  163  LLNVYKAFGDEKCTLDDCRRMIAVVDKNGDGFVCFEDFCRMME  205



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
            PS EE+ +ML E D      +S+E  +    +   P+ D ELRDAF FFD+D DG+I+AE
Sbjct  115  PSSEEMAVMLGERDH-----VSVEALASRLGSACEPAGDDELRDAFVFFDSDRDGRITAE  169

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL NV+K  GD +CTLEDC  MI  VD NGDGFVCFEDFCRMME
Sbjct  170  ELLNVYKAFGDEKCTLEDCAGMIAVVDKNGDGFVCFEDFCRMME  213



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 119/169 (70%), Gaps = 13/169 (8%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS++  
Sbjct  45   KPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSRLSP  96

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDG  405
            EPPS+EE+ +ML EVD   DGCISLEE  S ++ + +   C    E+R+ F+FFD D DG
Sbjct  97   EPPSQEEVSMMLREVD--ADGCISLEELASRVAGSTSGEGCVETEEMREVFEFFDADRDG  154

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DFCRMME
Sbjct  155  RISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFCRMME  203



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = -1

Query  728  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  552
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  551  RLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF  372
             LMLSEVDRDG+G ISLE         + P+ DSELRDAF+ FDTD+DGKISAEEL + F
Sbjct  123  TLMLSEVDRDGNGSISLEAVLNRVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLSFF  182

Query  371  KTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            + IGD  CTLE+C RMI G D NGDGFVCFE+F  MME
Sbjct  183  RAIGDEGCTLEECGRMIAGADKNGDGFVCFEEFAHMME  220



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 118/171 (69%), Gaps = 12/171 (7%)
 Frame = -1

Query  755  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  578  AEPPSREELRLMLSEVDRDGD--GCISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDH  411
             EPPS+EE+ LML EVD D D  GCISLE+  S ++      S ++E LR+ F++FD D 
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  163

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +GKISAEEL  VF  IGD RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  164  NGKISAEELHRVFGVIGDERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  214



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score =   177 bits (449),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 120/171 (70%), Gaps = 6/171 (4%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  585
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  584  VGAEPPSREELRLMLSE--VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  411
            +GA+ PS E   +++    VDRDGDGCI+L+E    S AF P    SELRDAFDFFD   
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCINLKETGATSPAFGPYDG-SELRDAFDFFDAGR  166

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DGKISA+EL  VF  +GD RCT+EDCR MI GVD +GDGFVCFEDF RMME
Sbjct  167  DGKISADELHRVFTALGDDRCTIEDCRLMIGGVDTDGDGFVCFEDFLRMME  217



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 117/174 (67%), Gaps = 17/174 (10%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  591
            +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A+L
Sbjct  52   RKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAAVL  102

Query  590  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS---VLSSAFAPPSCDSELRDAFDFFD  420
             ++  EPPS EE+R+ML EVD  GDGCISLEE +     +SA        ELR+ F+FFD
Sbjct  103  RRLSPEPPSEEEVRMMLREVD-GGDGCISLEELASRVAGTSATGSSVEKGELREVFEFFD  161

Query  419  TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
             D DG+ISAEEL  VF  IGD RCTL++CRRMI  VD  GDGFV F+DF RMME
Sbjct  162  ADRDGRISAEELLRVFGVIGDDRCTLDECRRMIATVDMKGDGFVRFDDFSRMME  215



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 125/173 (72%), Gaps = 9/173 (5%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  585
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  584  VGAEPPSREELRLMLSEVDR-DGDGCISLEEFS--VLSSAFAPPSCDSE-LRDAFDFFDT  417
            +  +PPS+EE+ LML EVD  +  GCISLEE +  V  S+    S ++E +R+ F+FFD 
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCISLEELASRVAGSSSGEGSVETEEMREVFEFFDA  167

Query  416  DHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            D DGKISAEEL+ VF  IGD RCT+++CRRMI  V  NGDGFVCFEDF RMME
Sbjct  168  DRDGKISAEELYRVFGVIGDERCTIDECRRMIATVGRNGDGFVCFEDFSRMME  220



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
            +P S+EE+ +ML ++DRDGDG I LE   S + SA       +ELR+ F+FFD D DG I
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAIRLEALASRVVSAGDLSRHSAELRETFEFFDADRDGLI  165

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            SAEEL  VF +IGD +CTLEDCRRMI  VD +GDGFVCF +F RMME
Sbjct  166  SAEELLRVFASIGDEQCTLEDCRRMIAAVDEDGDGFVCFGEFSRMME  212



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 115/170 (68%), Gaps = 16/170 (9%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S++  
Sbjct  49   KQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISRLSP  100

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD    GCISLEE   L+S  A  S +      ELR+ F+ FD D 
Sbjct  101  EPPSQEEVSLMLREVDGGDGGCISLEE---LASRVAGTSGEGSVETEELREVFEIFDVDR  157

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMM
Sbjct  158  NGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFEDFCRMM  207



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  579
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  578  AEPPSREELRLMLSEVDR-DGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHD  408
            +   S + +  MLSEVD  DG+GCIS+E     V S+A   P+ DSELR+AFDFFDTD D
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCISVEALMSRVGSAAACEPAGDSELREAFDFFDTDRD  176

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            G+I+A+EL + F  IGD RCTL+DCRRMI GV  +G+GFVCFEDF RMME
Sbjct  177  GRITADELHSFFTAIGDERCTLQDCRRMIDGVGRSGEGFVCFEDFSRMME  226



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 116/172 (67%), Gaps = 17/172 (10%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS++  
Sbjct  49   KPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSRLSP  100

Query  575  EPPSREELRLMLSEVDRDGDG-CISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTD  414
            EPPS+EE+ LML EVD D DG  I LEE   L+S  A  S +      ELR+ F+FFD D
Sbjct  101  EPPSQEEVSLMLKEVDGDDDGDSIRLEE---LASRVAGTSGEGSVETEELREVFEFFDAD  157

Query  413  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
             +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  158  RNGKISAEELHRVFGVIGDERCTLEECIRMIATVDRNGDGFVCFEDFCRMME  209



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 7/164 (4%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE  390
             + EE+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISA+
Sbjct  100  LTEEEINVMIKEVDGDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISAD  159

Query  389  ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  160  ELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  203



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 115/169 (68%), Gaps = 9/169 (5%)
 Frame = -1

Query  740  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  581  GA-EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            G  +PP+ EE+  M++EVDRDGDGCISLEEF  + +AF PP+  +ELR+AF  FD + DG
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCISLEEFGAIGTAFGPPA-GAELREAFAVFDANGDG  166

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            KISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFVCF+DF RMM+
Sbjct  167  KISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDFVRMMD  215



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 119/168 (71%), Gaps = 11/168 (7%)
 Frame = -1

Query  752  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  581  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
            GA+PP++EE++ MLSEVDR+GDG +         ++   P+C+ EL++ FDFFD DHDGK
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGRVG--------NSSCEPACEPELKETFDFFDADHDGK  161

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            I+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  162  ITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  209



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 118/168 (70%), Gaps = 9/168 (5%)
 Frame = -1

Query  737  TPTSVLPALNDE----ISPDELSGLYAELVQA---FKLIDRDDDGKIRKEELEALLSQVG  579
            TP SVLP  + +       D+L  L +        F + DRD DGKI + EL+A+L ++G
Sbjct  47   TPRSVLPPSSGKNPSAAGSDDLCFLSSASSSVSDLFAVFDRDGDGKITRHELQAVLRRLG  106

Query  578  -AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
             A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  ++LR+AF  FD D DGK
Sbjct  107  GADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GADLREAFAVFDADGDGK  165

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+
Sbjct  166  ISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMD  213



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 114/170 (67%), Gaps = 16/170 (9%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S++  
Sbjct  49   KQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISRLSH  100

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD D 
Sbjct  101  EPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDR  157

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  158  NGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 114/170 (67%), Gaps = 16/170 (9%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S++  
Sbjct  49   KQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISRLSH  100

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD D 
Sbjct  101  EPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDR  157

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  158  NGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 119/171 (70%), Gaps = 13/171 (8%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  575  EPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDH  411
            EPPS+EE+ LML EVD DGD    CISLE+  S ++      S ++E LR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  162  NGKISAEELHRVFGVIGDERCTLEECVRMIATVDRNGDGFVCFEDFCRMME  212



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS++  
Sbjct  45   KPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSRLSP  96

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDG  405
            EPPS EE+ +ML EVD   DGCISLEE  S ++   +   C    E+R+ F+FFD D DG
Sbjct  97   EPPSPEEVSMMLREVD--ADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDADRDG  154

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  155  RISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS++  
Sbjct  45   KPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSRLSP  96

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDG  405
            EPPS EE+ +ML EVD   DGCISLEE  S ++   +   C    E+R+ F+FFD D DG
Sbjct  97   EPPSPEEVSMMLREVD--ADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDADRDG  154

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +ISAEEL  VF  IGD RCTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  155  RISAEELHRVFGVIGDERCTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 115/168 (68%), Gaps = 15/168 (9%)
 Frame = -1

Query  752  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  581  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
            GA+PP++EE++ MLSEVDR+GDG I LE               S L++ FDFFD DHDGK
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALI------------SRLKETFDFFDADHDGK  157

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            I+AEELF VF  +GD  CTL+DCR MI  VD NGDGFVCFEDF RMME
Sbjct  158  ITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMME  205



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 10/170 (6%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  569  PSREELRLMLSEVDRDGDGCISLEEFS----VLSSAFAPPS--CDSELRDAFDFFDTDHD  408
            P+ EE+ +ML EVD DGDG I LEE +    V+SS     S     EL++ F+FFD D D
Sbjct  106  PTEEEIDVMLKEVDCDGDGTIRLEELASRCVVVSSEDDNKSRGGSDELKETFEFFDADRD  165

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKISAEEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  166  GKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFAEFSRMMD  215



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 115/159 (72%), Gaps = 6/159 (4%)
 Frame = -1

Query  734  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  555
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  554  LRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNV  375
            + +M+ EVDRDGDG I LEE +    +  P    +EL++ F+FFD D DG ISAEEL  V
Sbjct  95   IDVMIKEVDRDGDGTIRLEELASRVVSLDPCRDSTELKETFEFFDADRDGMISAEELLRV  154

Query  374  FKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            F+TIGD RCTL+DC+RMI  VD +G+GFVCF +F RMM+
Sbjct  155  FETIGDERCTLDDCKRMIADVDVDGNGFVCFTEFSRMMD  193



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 7/160 (4%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  378
            E+ +ML EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISA+EL  
Sbjct  107  EINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELLR  166

Query  377  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  167  VFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  206



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 114/167 (68%), Gaps = 3/167 (2%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ +G
Sbjct  50   KPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTCLG  109

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
            A P   +++ +ML EVD  GDG       S + S   P S   EL++AF+ FDTD DG+I
Sbjct  110  ASP-CPDDVAVMLGEVD--GDGITVERLMSYVGSGLKPGSDPDELKEAFEVFDTDRDGRI  166

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            SAEEL  VFK IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMME
Sbjct  167  SAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMME  213



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 119/171 (70%), Gaps = 13/171 (8%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  575  EPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDH  411
            EPPS+EE+ LML EVD DGD    CISLE+  S ++      S ++E LR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +GKISAEEL  VF  IGD RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  162  NGKISAEELHRVFGVIGDERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  212



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 120/179 (67%), Gaps = 16/179 (9%)
 Frame = -1

Query  749  GGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDDGKIRK  612
            G  STP SVLPA   L     P   +G   L+  L         + F + D D DGKI +
Sbjct  47   GLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGDGKITR  106

Query  611  EELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDA  435
            +ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  +ELR+ 
Sbjct  107  QELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GAELREV  165

Query  434  FDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            F  FD D DGKISAEEL  VF  +GD  CTLEDCRRMI GVD +GDGFVCFEDF RMM+
Sbjct  166  FAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGDGFVCFEDFVRMMD  224



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 8/166 (5%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  569  PSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGKIS  396
            PS EE+ +ML EVD DG+G I +EE +  V+SS  +  S  +EL++ F+FFD D DG IS
Sbjct  105  PSEEEIDVMLREVDCDGEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRDGFIS  162

Query  395  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            AEEL  VF  IGD RCTLEDC+RMI  VD++G+GFVCF +F RMM+
Sbjct  163  AEELLRVFSAIGDERCTLEDCKRMIAAVDDDGNGFVCFSEFSRMMD  208



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 111/170 (65%), Gaps = 17/170 (10%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S++  
Sbjct  49   KQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISRLSH  99

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  411
            EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD D 
Sbjct  100  EPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDR  156

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  157  NGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  206



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 113/168 (67%), Gaps = 7/168 (4%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDE-----LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
             STP S+LPA              LS   + +   F + DRD DGKI ++ELEA+L  +G
Sbjct  49   HSTPRSILPAGKPPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLG  108

Query  578  -AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGK  402
             A+PP+ EE+  M++EVD DGDGCISLEEF  + SAF PP+   +LR+AF  FD D DGK
Sbjct  109  GADPPTEEEVASMVAEVDLDGDGCISLEEFGAIGSAFGPPA-GGDLREAFAVFDADGDGK  167

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            ISAEEL  VF T+GD   TLEDCRRMI  VD +GDGFVCFEDF RMM+
Sbjct  168  ISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDFVRMMD  215



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 114/169 (67%), Gaps = 13/169 (8%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  585
             KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL++
Sbjct  51   HKPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTR  110

Query  584  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            +  EPPS++E+ +ML    R+ DG ++        ++ A      ELR+ F+FFD D DG
Sbjct  111  LSPEPPSQDEVSMML----READGGVA-------GTSAAGSVEAEELREVFEFFDADRDG  159

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +ISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCFEDF RMME
Sbjct  160  RISAEELLRVFGVIGDDRCTLEECLRMIATVDVNGDGFVCFEDFSRMME  208



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 5/165 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  569  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  393
            P+ EE+ +ML EVD DGDG + LEE  S             EL++ F+FFD D DGKISA
Sbjct  101  PTEEEIDVMLREVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  160

Query  392  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  161  EELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  205



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  378
            E+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISAEEL  
Sbjct  110  EISVMIQEVDCDGDGAIRLEELASRLVSSDPSRDSAELKETFEFFDADRDGLISAEELLR  169

Query  377  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct  170  VFSTIGDDRCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD  209



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 5/165 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  569  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISA  393
            P+ EE+ +ML EV+ DGDG + LEE  S             EL++ F+FFD D DGKISA
Sbjct  101  PTEEEIDVMLKEVNCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  160

Query  392  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  161  EELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  205



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = -1

Query  749  GGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
            G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L ++
Sbjct  56   GLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRRL  110

Query  581  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC--DSELRDAFDFFDTDHD  408
              + P+ EE+  M++E+DRDGDGCISL+EF+ L  A A  +   +SELR+AF  FD D D
Sbjct  111  VPDAPTAEEVASMVAEMDRDGDGCISLDEFAALGPALAASAGGGESELREAFAVFDADGD  170

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKISAEEL  VF T+GD  CTLEDCRRMI GVD +GDGFV FEDF RMM+
Sbjct  171  GKISAEELLGVFATLGDCGCTLEDCRRMIGGVDADGDGFVGFEDFVRMMD  220



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 13/171 (8%)
 Frame = -1

Query  758  KKPGGEST-PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  582
             KP   ST P SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S++
Sbjct  52   HKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISKL  103

Query  581  GAEPPSREELRLMLSEVDRDG--DGCISLEEFS-VLSSAFAPPSCDSELRDAFDFFDTDH  411
              EPPS EE+ LML EVD DG  DGCISLE+ +  +  A +    + E+R+ F++FD D 
Sbjct  104  SPEPPSHEEVSLMLREVD-DGEEDGCISLEDLANRVVVASSGDGSEEEMREVFEYFDVDR  162

Query  410  DGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            DG+ISAEEL+ VF  IGD RCTL++CRRMI  VD NGDGFVCF DF  MME
Sbjct  163  DGRISAEELYRVFGVIGDERCTLDECRRMIATVDKNGDGFVCFHDFSCMME  213



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  569  PSREELRLMLSEVDRDGD-GCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKIS  396
             + +E+ +M+ EV  +GD G I LEE +        PS DS E+++ F+FFD D DG IS
Sbjct  109  LTEDEINVMIKEVGCEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRDGLIS  168

Query  395  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            AEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  169  AEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  213



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 5/165 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISA  393
             + EE+ +ML EVD DGDG + LEE +            S EL++ F+FFD D DGKISA
Sbjct  138  LTEEEIDVMLKEVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA  197

Query  392  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EEL  VF  IGD RCTLE+C RMI  VD++G+GFVCF +F RMM+
Sbjct  198  EELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMD  242



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 118/167 (71%), Gaps = 11/167 (7%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
             G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA  
Sbjct  54   AGSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGAS-  111

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS---ELRDAFDFFDTDHDGKI  399
                ++ LMLSEV+    GCI++E  ++++   + P   S   EL++AF  FDTD DG+I
Sbjct  112  ----DVALMLSEVEGGAGGCITVE--ALMNHIGSGPESGSDPEELKEAFAVFDTDRDGRI  165

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            SAEEL  VF+ IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMME
Sbjct  166  SAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMME  212



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 115/169 (68%), Gaps = 5/169 (3%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALLSQ  585
            K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL++
Sbjct  51   KPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLLTR  110

Query  584  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDG  405
            +GA P S  ++ LML EVD DG    SL   S + S     S   EL++AF+ FDTD DG
Sbjct  111  LGASP-SPGDVALMLGEVDGDGITVESL--MSYVGSGLETGSDPDELKEAFEVFDTDRDG  167

Query  404  KISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +ISAEEL  VFK IGD RCTLE+CRRMI GVD NGDGFVCFEDF RMM+
Sbjct  168  RISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFSRMMD  216



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 115/166 (69%), Gaps = 5/166 (3%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  569  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKI  399
             + +E+ +M+ EV  +   DG I LEE +        PS DS E+++ F+FFD D DG I
Sbjct  111  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRDGLI  170

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            SAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  171  SAEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  216



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -1

Query  749  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  569  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKI  399
             + +E+ +M+ EV  +   DG I LEE +        PS DS EL++ F+FFD D DG I
Sbjct  110  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAELKETFEFFDADRDGLI  169

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            SAEEL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM
Sbjct  170  SAEELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMM  215



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 113/170 (66%), Gaps = 11/170 (6%)
 Frame = -1

Query  746  GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  575  EPPSREELRLMLSEVDRDGDG---CISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  408
               SR+E+ +MLSEV   G+G    +S+EE  S +  A  P   D+ELR+ F+FFD DHD
Sbjct  115  ---SRDEVAVMLSEVGCHGEGEDAAVSIEELLSRVGPACGPACDDAELRETFEFFDADHD  171

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            GKI+AEEL  VF   GD RCTLE+CRRMI  VD NGDGFVCFEDF RMME
Sbjct  172  GKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDFTRMME  221



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = -1

Query  743  ESTPTSVLPALNDEIS----PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC-DSELRDAFDFFDTDHDGKI  399
            +PP+ EE+  M++EVDRDGDGCISL+EF  L +        +SELRDAF  FD D DGKI
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCISLDEFGALGALLGGGRGGESELRDAFAVFDADGDGKI  173

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            SAEEL  VF T+GD  CTL+DCRRMI GVD +GDGFV F+DF RMM+
Sbjct  174  SAEELLGVFATLGDGGCTLDDCRRMIGGVDTDGDGFVGFDDFVRMMD  220



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 117/178 (66%), Gaps = 17/178 (10%)
 Frame = -1

Query  749  GGES-TPTSVLPA-----LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  588
            GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEALLS
Sbjct  47   GGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEALLS  103

Query  587  QVGAEPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAF----APPSCDSELRDAF  432
            ++GAEP S +E  LML EV   D  G   + +E+  S + SA     A   CD E+R  F
Sbjct  104  RLGAEPLSADEKALMLREVGCADEGGAAGVRIEDLVSRVGSAGGDEEADAGCDVEMRRTF  163

Query  431  DFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            +FFD + DG+I+AEEL   F+ +GD RCTL +CRRMI  VD NGDGFVCFEDF RMM+
Sbjct  164  EFFDRNGDGRITAEELLGAFEAMGDGRCTLGECRRMIAEVDRNGDGFVCFEDFSRMMQ  221



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  641  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP  462
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LEE   L SAF PP
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVALGSAFGPP  145

Query  461  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  282
                ELR+ F  FD D DG ISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVCF
Sbjct  146  VV-PELRETFAVFDGDGDGMISAEELLAMFVTLGDKRCTLEDCRRMIGVVDSDGDGFVCF  204

Query  281  EDFCRMME  258
            EDF RMM+
Sbjct  205  EDFVRMMD  212



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = -1

Query  644  IDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  465
            ++RD + ++ + ELE +L ++G +PP+ EE+  ML+E DR G+G I L+E   L SAF P
Sbjct  79   VERDGEERVTRRELEVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQEIVALGSAFGP  138

Query  464  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVC  285
            P    EL+  F  FD D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVC
Sbjct  139  PVA-PELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVC  197

Query  284  FEDFCRMME  258
            FEDF RMM 
Sbjct  198  FEDFVRMMH  206



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 105/167 (63%), Gaps = 6/167 (4%)
 Frame = -1

Query  743  ESTPTSVLP-ALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            +STP SVLP +    ++     G     ++         +R+ + ++ + ELE +L ++G
Sbjct  41   QSTPKSVLPPSPRRRVAKSASIGGGEECWSSSSTDHSPAEREGEERVTRRELEVVLQRLG  100

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
             +PP+ EE+  ML+E DR GDG I L+E   L SAF PP    ELR+ F  FD D DGKI
Sbjct  101  PDPPTEEEVAAMLAEADRGGDGSIRLQEIVALGSAFGPP-VAPELRETFAVFDVDGDGKI  159

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            SAEEL  +F T+GD RCTLEDCRRMI  VD++ DGFVCFEDF RMM 
Sbjct  160  SAEELLAMFVTLGDERCTLEDCRRMIGVVDSDCDGFVCFEDFVRMMH  206



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 3/136 (2%)
 Frame = -1

Query  659  QAFKLIDRDDDGKIRKEELEALLSQVGAEPPS--REELRLMLSEVDRDGDGCISLEEFSV  486
            +AFK++D D DGKI + EL +L  +V    PS   EE+  M+ ++D DGDGCISLEE   
Sbjct  70   EAFKMMDLDGDGKITRVELHSLFKRVRVNAPSLSEEEVAEMIKDIDTDGDGCISLEELEA  129

Query  485  LSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
            + SA  P   D + L+DAF FFD + DGKIS EEL   F  +GD RCTLE+CRRMI GVD
Sbjct  130  VGSALDPTGADEDDLKDAFGFFDVNKDGKISPEELHAGFVALGDERCTLEECRRMIEGVD  189

Query  308  NNGDGFVCFEDFCRMM  261
             N DGFVCF+DF RMM
Sbjct  190  KNKDGFVCFQDFSRMM  205



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 103/162 (64%), Gaps = 1/162 (1%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
            + TP +VLP L         +   +     +   +R+ +G+I + ELE +L ++G +PP+
Sbjct  42   QCTPKTVLPRLPGCHLAAPAAKSASSSSTDYPSAEREGEGRITRRELEVVLRRLGPDPPT  101

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  384
             EE+  ML+E DR GDG I LEE   L S   PP    ELR+ F  FD D DGKISAEEL
Sbjct  102  EEEVVAMLAEADRAGDGSIRLEEIVELGSVVGPPVV-PELRETFAVFDADGDGKISAEEL  160

Query  383  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
              +F T+GD +CTLEDCRRMI  VD++GDGFVCF+DF RMM+
Sbjct  161  LAMFVTLGDEQCTLEDCRRMIGVVDSDGDGFVCFQDFVRMMD  202



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 100/160 (63%), Gaps = 39/160 (24%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  43   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  81

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  378
            E+++M+ E+DR G                  P+C SELRD F+ FD DHDG+I+AEELF+
Sbjct  82   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHDGRITAEELFS  123

Query  377  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF RMM+
Sbjct  124  VFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFVRMMD  163



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 100/160 (63%), Gaps = 39/160 (24%)
 Frame = -1

Query  737  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  44   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  82

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFN  378
            E+++M+ E+DR G                  P+C SELRD F+ FD DHDG+I+AEELF+
Sbjct  83   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHDGRITAEELFS  124

Query  377  VFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF RMM+
Sbjct  125  VFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFVRMMD  164



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 18/124 (15%)
 Frame = -1

Query  629  DGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  450
            D  + ++EL+ALL  +GAEPPS EE+++M+ E+DR G                  P+C S
Sbjct  125  DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PACHS  166

Query  449  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  270
            ELRD F+ FD DHDG+I+AEELF+VF  +GD  CTLEDCRRMI GVD NGDGFVCF+DF 
Sbjct  167  ELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVCFDDFA  226

Query  269  RMME  258
            RMM+
Sbjct  227  RMMD  230



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query  674  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  495
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  494  FSV----LSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF-KTIGDSRCTLEDCR  330
             +       S+ +     +EL++ F+ FD+D +G ISAEEL  VF   IGD RCTLE+C 
Sbjct  114  LATRVVSSVSSDSSHGSSTELKETFELFDSDRNGLISAEELLRVFAAAIGDDRCTLEECS  173

Query  329  RMILGVDNNGDGFVCFEDFCRMME  258
            RMI  VD +GDGFV F +F RMM+
Sbjct  174  RMIAAVDEDGDGFVSFNEFSRMMD  197



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = -1

Query  638  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS  459
            R+++G + ++ELEA+LS++ +E    EE+ +MLSEVD  GDG I LEE      +    +
Sbjct  68   RENEGVVTRKELEAILSRIASE----EEVAMMLSEVDSGGDGFIRLEELMARVGS-GEAA  122

Query  458  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFE  279
             +SELR+ F+FFD D DG+I+AEEL  VF++IGD +CTLEDCRRMI  VD NGDGFVCF 
Sbjct  123  GESELRETFEFFDADQDGRITAEELHGVFRSIGDEQCTLEDCRRMIRDVDENGDGFVCFA  182

Query  278  DFCRMME  258
            +F RMME
Sbjct  183  EFVRMME  189



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 5/127 (4%)
 Frame = -1

Query  638  RDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS  459
            R ++G + ++ELEA+LS++ +E    EE+ +ML EVD  GDG I LEE      +    +
Sbjct  68   RGNEGVVSRKELEAILSRIASE----EEVAMMLREVDSGGDGFIRLEELMARVGS-GEAA  122

Query  458  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFE  279
             +SE+R+ F+FFD D DG+I+AEEL  VF++IGD RCTLEDC RMI  VD NGDGFVCF 
Sbjct  123  GESEMRETFEFFDADQDGRITAEELHGVFRSIGDERCTLEDCGRMIRDVDENGDGFVCFA  182

Query  278  DFCRMME  258
            +F RMME
Sbjct  183  EFVRMME  189



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            +N +  P  +     EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ E
Sbjct  1    MNKQQHPRHIQ----ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVRE  55

Query  533  VDRDGDGCISLEEFSVLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  363
            VD DGDG +  +EF  L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +
Sbjct  56   VDADGDGFVDFDEFVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNL  115

Query  362  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  116  GEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149


 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  533  VDRDGDGCISLEEFS--VLSSAFAPPSC  456
            VD DGDG ++ EEF   +LSS+ A PS 
Sbjct  132  VDSDGDGFVNFEEFQRMMLSSSNASPST  159



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            +N +  P  +     EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ E
Sbjct  1    MNKQQHPRHIQ----ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVRE  55

Query  533  VDRDGDGCISLEEFSVLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTI  363
            VD DGDG +  +EF  L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +
Sbjct  56   VDADGDGFVDFDEFVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNL  115

Query  362  GDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            G+   T+EDC RMI GVD++GDGFV FE+F RMM
Sbjct  116  GEKGVTMEDCNRMIGGVDSDGDGFVNFEEFQRMM  149



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = -1

Query  704  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  525
            +  P +  G   ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+
Sbjct  26   QAKPADSLGNVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDK  85

Query  524  DGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
            DGDG I L+EF+  +L      P C + ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  86   DGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLG-Q  144

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  145  KCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  175


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL  AF L D D +G I   EL A++ ++G +  S  + R M+S VDRDGDG ++ EEF 
Sbjct  114  ELRDAFDLYDLDGNGVISVSELHAVMKKLG-QKCSLRDCRKMISSVDRDGDGNVNFEEFK  172

Query  488  VLSSA  474
             + +A
Sbjct  173  KMMTA  177



>gb|ABK24059.1| unknown [Picea sitchensis]
 gb|ABK24534.1| unknown [Picea sitchensis]
Length=260

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 93/147 (63%), Gaps = 13/147 (9%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + FK+ D D DGKI   EL  +L  +G +  S EEL LM+   D+DGDG I L+EF 
Sbjct  112  ELREVFKVFDADGDGKITITELGCVLRSLG-DDLSEEELALMVQAADKDGDGSIDLDEFI  170

Query  488  VLSSAFAP-----------PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  342
             L++A A            P+ D +L DAF  FD D DGKISA+EL  V  ++GD+ CT+
Sbjct  171  SLNTAAADAAEFSASAGVFPATD-DLHDAFRIFDADKDGKISAQELHRVLTSLGDAECTI  229

Query  341  EDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +DCR+MI GVD NGDG+V F+DF  MM
Sbjct  230  DDCRQMIRGVDKNGDGYVDFQDFSTMM  256



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 3/150 (2%)
 Frame = -1

Query  707  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  528
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+ML EVD
Sbjct  7    DSSQPTSLTAEMEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMML-EVD  65

Query  527  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  351
             DGDG I L+EF+       +P + + +LR+AF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  350  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            C+L+DCRRMI  VD++GDG V FE+F +MM
Sbjct  125  CSLKDCRRMISSVDDDGDGSVNFEEFKKMM  154


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            +L +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDG ++ EEF 
Sbjct  93   DLREAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDGDGSVNFEEFK  151

Query  488  VLSS  477
             + S
Sbjct  152  KMMS  155



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFKEF  113

Query  491  SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++     +   E L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI G
Sbjct  114  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRQMIGG  172

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDG + FE+F  MM
Sbjct  173  VDSDGDGMISFEEFKVMM  190



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 93/162 (57%), Gaps = 3/162 (2%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
            +STP+S    L             AEL Q F   D + DGKI   EL A++  +G  P +
Sbjct  12   KSTPSSAAAPLVMRSPSFATRAQIAELEQVFNKFDVNGDGKISSSELGAIMGSLG-HPAT  70

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEE  387
             +ELR M+ EVD DGDG I + EF  L++           LRDAF  +D D +G ISAEE
Sbjct  71   EDELRSMILEVDADGDGFIDINEFVELNTKGIDSAEALQNLRDAFSVYDKDGNGSISAEE  130

Query  386  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            LF V K++GD  C+L +CR+MI GVD +GDG + FE+F  MM
Sbjct  131  LFEVLKSLGD-ECSLAECRKMIGGVDADGDGMINFEEFKVMM  171



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 9/146 (6%)
 Frame = -1

Query  689  ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGC  510
            +L+    E+ + F+  D + DGKI   EL+ +L+ +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTPRMKEVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  509  ISLEEFSVLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            I LEEF+    AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+
Sbjct  62   IDLEEFA----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGIGE-KCSLK  116

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DCRRMI  VD++GDG V FE+F +MM
Sbjct  117  DCRRMISSVDDDGDGSVNFEEFKKMM  142



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 98/166 (59%), Gaps = 8/166 (5%)
 Frame = -1

Query  740  STPT-----SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  576
            S+PT     S   + N  +S         +L   F+  D + DGKI   EL +++  +G 
Sbjct  20   SSPTAAATNSTFFSRNPSVSSRSRLHFTEDLEHVFRKFDVNGDGKISSSELGSIMGSLG-  78

Query  575  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKI  399
            +P + EEL  M+ EVD DGDG I+LEEF  L++    P      L+DAF  FD D +G I
Sbjct  79   QPATEEELNNMIREVDADGDGHINLEEFIELNTKDVNPNEIIENLKDAFSIFDIDGNGSI  138

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +AEEL NV  +IGD +C+L +C++MI GVD +GDG + FE+F RMM
Sbjct  139  TAEELHNVMVSIGD-KCSLAECKKMIRGVDKDGDGMIDFEEFKRMM  183



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 92/150 (61%), Gaps = 6/150 (4%)
 Frame = -1

Query  698  SPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  528
            SP +  G   +  EL   FK  D + DGKI   EL +++  +G  P + EELR M+ EVD
Sbjct  27   SPSQNGGRCRIEEELEHVFKKFDVNGDGKICAAELGSIMGSLG-HPATEEELRTMIQEVD  85

Query  527  RDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  351
             DGDG I L EF  L++           LRDAF+ FD D +G ISAEEL NV K++G+  
Sbjct  86   SDGDGFIDLREFIELNTNGIGQDEVIENLRDAFEVFDMDKNGSISAEELHNVLKSLGE-E  144

Query  350  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            CTL +CR+MI GVD +G+G +CF++F  MM
Sbjct  145  CTLAECRKMISGVDADGNGTICFDEFKVMM  174



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFKEF  180

Query  491  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++    P      L+DAF  +D D +G IS EEL+ V +++GD  C++++CR+MI G
Sbjct  181  VELNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSLGD-ECSMDECRKMIGG  239

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDG + FE+F  MM
Sbjct  240  VDSDGDGMINFEEFKVMM  257



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q FK  D + DGKI   EL A++S +G +  S EEL  M+SEVD DGDG I+ +EF
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFINFKEF  108

Query  491  SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++     +   E L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI G
Sbjct  109  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRKMIGG  167

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDG + FE+F  MM
Sbjct  168  VDSDGDGMISFEEFKVMM  185



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 7/167 (4%)
 Frame = -1

Query  746  GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  402
             +P + EELR+M+ EVD DGDG I L+EF  L++           L+DAF  FD D +G 
Sbjct  78   -QPATEEELRIMIQEVDADGDGFIDLQEFIALNTTDVGHEEVMENLKDAFKVFDIDKNGY  136

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            I+AEEL +V +++G+  CTL +C +MI GVD++G G + F++F  MM
Sbjct  137  ITAEELQDVLQSLGE-ECTLAECEKMISGVDSDGSGTINFDEFKVMM  182



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 3/150 (2%)
 Frame = -1

Query  707  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  528
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+M+ EVD
Sbjct  7    DSSPPASLTAEMEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMI-EVD  65

Query  527  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  351
             DGDG I L+EF+       +P + + +LRDAF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  350  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            C+L+DCRRMI  VD++ DG V FE+F +MM
Sbjct  125  CSLKDCRRMISSVDDDCDGSVNFEEFKKMM  154



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q FK  D + DGKI  EEL  +++ +G    + EE+R+M+ EVD DGDG I L EF 
Sbjct  35   ELEQVFKKFDANGDGKISGEELGKIIASLG-HSVTDEEIRIMIQEVDSDGDGFIDLREFI  93

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++A          LR AFD FD D +G ISAEEL  V +++G+  CT+EDCR+MI GV
Sbjct  94   DLNTADVDNDEALENLRRAFDVFDIDRNGAISAEELRQVLRSLGEE-CTIEDCRKMISGV  152

Query  311  DNNGDGFVCFEDFCRMM  261
            D +G+G +CF++F  MM
Sbjct  153  DADGNGTICFDEFQVMM  169



>ref|XP_009411743.1| PREDICTED: probable calcium-binding protein CML36 [Musa acuminata 
subsp. malaccensis]
Length=202

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 98/165 (59%), Gaps = 18/165 (11%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
             ++P SVLP      S  +L          F ++DRD DGKI   ELEA+L ++G +P +
Sbjct  50   HASPRSVLP-----FSVHDL----------FGVLDRDGDGKIVVRELEAVLRRLGPDPLT  94

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFD---FFDTDHDGKISA  393
             EE   + +EV   GDGCI++EE   L +    P+      +  +    FD D DG+ISA
Sbjct  95   AEEAASVAAEVGLAGDGCITVEELEALGAKLQLPAAAEAEAELREAFAVFDADGDGRISA  154

Query  392  EELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  258
            EEL  VF T+GD  CTLEDCR MI GVD +GDGFVCF+DF RMM+
Sbjct  155  EELLGVFVTLGDDGCTLEDCRCMIQGVDTDGDGFVCFDDFARMMD  199



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 8/152 (5%)
 Frame = -1

Query  698  SPDELSGLY----AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEV  531
            +P     +Y    AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+
Sbjct  6    TPTSTPSMYLEDMAEVQKVFDRFDTNNDGKISPGELGGVLKALGSES-SPDEVARMMGEI  64

Query  530  DRDGDGCISLEEFSVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  357
            D D DG I+L+EF+   SA A P  S + ELR+AF+ +D +HDGKISA EL      +G+
Sbjct  65   DTDKDGNINLQEFAAFCSAEADPYHSAEKELREAFELYDQNHDGKISAAELQKTLLRLGE  124

Query  356  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              C++EDC  MI  +D NGDG+V FE+F +MM
Sbjct  125  -HCSIEDCAGMIKPIDANGDGYVSFEEFKKMM  155



>gb|KHN40730.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=143

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  3    DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  61

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI GV
Sbjct  62   ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  120

Query  311  DNNGDGFVCFEDFCRMM  261
            D NGDG + F++F  MM
Sbjct  121  DGNGDGMINFDEFQIMM  137



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 93/146 (64%), Gaps = 9/146 (6%)
 Frame = -1

Query  689  ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGC  510
            +L+    E+ + F+  D + DGKI   EL+ +L  +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTARMKEVEKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  509  ISLEEFSVLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            I LEEF+    AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+
Sbjct  62   IDLEEFA----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISAAELHSVMKGIGE-KCSLK  116

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DCRRMI  VD +GDG V FE+F +MM
Sbjct  117  DCRRMISSVDVDGDGSVNFEEFKKMM  142



>ref|XP_006843397.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
 gb|ERN05072.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
Length=229

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+    ++++   DGKI KE++  +   +G EPPS EELR     V  D +G ISLE+ +
Sbjct  91   EIYDTCRILELVGDGKISKEDVGPVFRALGVEPPSYEELR----NVATDDEGRISLEDLA  146

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
               +  +     SEL +AF  FD D DG+ISAEEL  V   +GD+ CT+ DC RMI G D
Sbjct  147  RFGAPASAEEPVSELMEAFGVFDRDGDGRISAEELQGVLSALGDAECTVGDCHRMIRGFD  206

Query  308  NNGDGFVCFEDFCRMM  261
            ++GDGFVCF+DF RMM
Sbjct  207  SDGDGFVCFQDFARMM  222



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = -1

Query  683  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  510
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  509  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  336
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  61   VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  112

Query  335  CRRMILGVDNNGDGFVCFEDFCRMM  261
            CRRMI GVD +GDGFV FE+F  MM
Sbjct  113  CRRMIRGVDTDGDGFVNFEEFRSMM  137



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ Q F   D++ DGKI   EL+ +LS +G++    EEL+ M+ E+D++GDG I L+EF+
Sbjct  4    EVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTD-EELKRMIEELDQNGDGFIDLKEFA  62

Query  488  VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
                       DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  V
Sbjct  63   DFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHHVLRNLGE-KCSLSDCRRMISNV  121

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V FE+F +MM
Sbjct  122  DGDGDGNVNFEEFKKMM  138



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            +L   FK  D + DGKI   EL +++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  42   DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  100

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI GV
Sbjct  101  ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  159

Query  311  DNNGDGFVCFEDFCRMM  261
            D NGDG + F++F  MM
Sbjct  160  DGNGDGMINFDEFQIMM  176



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                     S + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD
Sbjct  79   AFYCPGGADSDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISKVD  137

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  138  VDGDGCVNFEEFKKMM  153


 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC++ EEF 
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCVNFEEFK  150

Query  488  VLSS  477
             + S
Sbjct  151  KMMS  154



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 90/142 (63%), Gaps = 11/142 (8%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  94

Query  491  SVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  327
              L++       DS+     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+
Sbjct  95   IELNT----KGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRK  149

Query  326  MILGVDNNGDGFVCFEDFCRMM  261
            MI GVD NGDG + F++F  MM
Sbjct  150  MITGVDKNGDGMISFDEFKVMM  171



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q F   D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELHNMIKEVDADGDGYIDLDEF  94

Query  491  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++     +     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI G
Sbjct  95   IELNTKGVDSNEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  153

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + F++F  MM
Sbjct  154  VDKNGDGMISFDEFKVMM  171



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 11/141 (8%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q FK  D + DGKI   EL A++  +G +P   EELR M+ EVD DGDG I L+EF 
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLKEFI  102

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
             L++       DS+     L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+M
Sbjct  103  ELNTK----GVDSDEVLENLKDAFSVYDIDKNGSISAEELYEVLRSLGD-ECSIAECRKM  157

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVD +GDG + FE+F  MM
Sbjct  158  ISGVDCDGDGTISFEEFKVMM  178



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = -1

Query  683  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  510
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  120

Query  509  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  336
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  121  VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  172

Query  335  CRRMILGVDNNGDGFVCFEDFCRMM  261
            CRRMI GVD +GDGFV FE+F  MM
Sbjct  173  CRRMIRGVDTDGDGFVNFEEFRSMM  197



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            +L   F+  D + DGKI   EL +++  +G +P + EEL  M+ EVD DGDG I+LEEF 
Sbjct  46   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELDNMIREVDADGDGHINLEEFI  104

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P      L+DAF  FD D +G ISAEEL NV  ++GD +C+L +C++MI GV
Sbjct  105  ELNTKDIDPNEILENLKDAFSVFDIDKNGSISAEELHNVMVSLGD-QCSLAECQKMIGGV  163

Query  311  DNNGDGFVCFEDFCRMM  261
            D++GDG + FE+F +MM
Sbjct  164  DSDGDGMIDFEEFKKMM  180



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q F   D + DGKI   EL +++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  18   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  76

Query  491  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++           L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI G
Sbjct  77   IELNTKGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  135

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + F++F  MM
Sbjct  136  VDKNGDGMISFDEFKVMM  153



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 87/136 (64%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG ISL EF 
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISLAEFK  89

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             ++ A      + +L++AF  FD D DGKISA+EL NV K +G+ + T E C+ MI GVD
Sbjct  90   DINGA-GEGVEEVDLKEAFAVFDEDRDGKISAKELQNVLKGLGE-QVTTEQCQEMIRGVD  147

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V F++F  MM
Sbjct  148  RDGDGMVSFQEFKVMM  163



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+ + F   D++ DGKI ++EL+++LS +G+ PPS +E+  ++S +D+DG+G + L
Sbjct  6    GSMEEMKEVFNKFDKNGDGKISRDELKSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDL  64

Query  500  EEFSVLSSAFAPPSCD------SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            +EF          + D       EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFIAFHGTNINGNGDDSQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DCRRMI  VD +GDG V FE+F +MM
Sbjct  124  DCRRMISQVDKDGDGNVNFEEFKKMM  149



>ref|XP_004241666.2| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=197

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+L+EF+
Sbjct  60   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINLDEFA  118

Query  488  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
                +  +      EL++AFD +D DH+G+ISA EL  +   +G + CTL+DC RMI  V
Sbjct  119  DFCKNDESVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLGQN-CTLQDCTRMITSV  177

Query  311  DNNGDGFVCFEDFCRMM  261
            D NGDG+VCFE+F +MM
Sbjct  178  DANGDGYVCFEEFKKMM  194



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 98/158 (62%), Gaps = 11/158 (7%)
 Frame = -1

Query  731  TSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  552
             S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +G +P + +EL
Sbjct  17   ASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSLG-QPATEQEL  75

Query  551  RLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEE  387
              M+ EVD DGDGCISL+EF  L++       DS+     L+DAF  FD D +G I+AEE
Sbjct  76   DNMIREVDGDGDGCISLQEFIELNT----KGVDSDEILENLKDAFAVFDMDGNGSITAEE  131

Query  386  LFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF  273
            L  V +++G+  C+L +CRRMI GVD++GDG + FE+F
Sbjct  132  LNTVMRSLGE-ECSLAECRRMIGGVDSDGDGMIDFEEF  168



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DGDG I+L EF 
Sbjct  38   ELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADGDGFINLAEFK  97

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             ++ A      +++LR+AF  FD DHDGKISA EL  V K +G+   T + CR+MI GVD
Sbjct  98   DINRA-GEGVQEADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTTAQ-CRKMIRGVD  155

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V F++F  MM
Sbjct  156  RDGDGMVSFQEFKVMM  171


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            A+L +AF + D D DGKI   EL  +L  +G E  +  + R M+  VDRDGDG +S +EF
Sbjct  109  ADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTT-AQCRKMIRGVDRDGDGMVSFQEF  167

Query  491  SVLSSAFAPP  462
             V+ +    P
Sbjct  168  KVMMTGGGRP  177



>gb|AFK34900.1| unknown [Lotus japonicus]
Length=196

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F+  D + DGKI   EL +++  +G +  ++EEL  M+ EVD DGDG ISLEEF 
Sbjct  51   ELEKVFEKFDVNRDGKISSSELGSIMGSLG-QSATKEELDNMIREVDSDGDGYISLEEFI  109

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P      LRDAF  FD D +G I+AEEL NV  ++GD  C+LE+C++MI GV
Sbjct  110  ELNTKDIDPNEILENLRDAFSVFDIDGNGSITAEELHNVMASLGD-ECSLEECQKMIGGV  168

Query  311  DNNGDGFVCFEDFCRMM  261
            D++GDG + FE+F  MM
Sbjct  169  DSDGDGMIDFEEFRTMM  185



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D + DGKI  +EL  ++  +G+E  S +E+  M+ E+D D DG ISLEEF+
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSET-SADEVARMMEEIDTDKDGFISLEEFA  78

Query  488  VLSSAFAPPS----CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            V  SA + PS     + ELR+AFD +D DHDG+IS  EL  +   +G+ RC++ DC  MI
Sbjct  79   VFCSADSDPSGGGNSEKELREAFDLYDQDHDGQISKTELHLILTRLGE-RCSVNDCSEMI  137

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD++GDGFV F++F +MM
Sbjct  138  RSVDSDGDGFVSFDEFRKMM  157



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  488  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
                     + D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGETNGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD +GDG V FE+F +MM
Sbjct  138  VDVDGDGCVNFEEFKKMM  155


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  488  VLSS  477
             + S
Sbjct  153  KMMS  156



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  491  SVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L ++          L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGSISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDG + FE+F  MM
Sbjct  157  VDSDGDGMINFEEFKVMM  174



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
             E+ Q F   D++ DGKI   EL+ +L+ +G++    EEL+ M+ E+D++GDG I L+EF
Sbjct  3    VEVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTD-EELKRMMEELDQNGDGFIDLKEF  61

Query  491  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
            +           DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  
Sbjct  62   ADFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHDVLRNLGE-KCSLSDCRRMISN  120

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD +GDG V FE+F +MM
Sbjct  121  VDADGDGNVNFEEFKKMM  138



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            +E+ + F   D + DGKI   EL++LL  +G+E  S EE++ M+ E+D+DGDG + L EF
Sbjct  5    SEIERIFSKFDANGDGKISATELKSLLQALGSET-STEEVKKMMEEMDKDGDGFVDLLEF  63

Query  491  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
            S   +     +  + EL +AF  +D D +GKISA EL++V K++G+ +C+L+DC++MI  
Sbjct  64   SEFHAGSGGNAGSTKELEEAFRLYDKDGNGKISARELYDVLKSLGE-KCSLKDCKKMISS  122

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD +GDG V FE+F +MM
Sbjct  123  VDADGDGHVDFEEFKKMM  140


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  683  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  504
            +G   EL +AF+L D+D +GKI   EL  +L  +G E  S ++ + M+S VD DGDG + 
Sbjct  74   AGSTKELEEAFRLYDKDGNGKISARELYDVLKSLG-EKCSLKDCKKMISSVDADGDGHVD  132

Query  503  LEEFSVLSSA  474
             EEF  + +A
Sbjct  133  FEEFKKMMAA  142



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 94/167 (56%), Gaps = 8/167 (5%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGK  402
             E  + EEL+ M+ EVD DGDG I L+EF  L++           L+DAF  FD D DG 
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFIDLKEFVELNTKDIDYDETVENLKDAFQVFDIDGDGS  117

Query  401  ISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            IS EEL  V +++G+  CTL +C +MI GVD++G+G + FE+F  MM
Sbjct  118  ISCEELRQVLESLGE-ECTLGECAKMIAGVDSDGNGMISFEEFKVMM  163



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = -1

Query  701  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  522
            +S  E+ G+     + F+  D + DGKI   EL A+L+ +G++    E  R+ML EVD D
Sbjct  13   VSSAEMDGVE----KVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIML-EVDTD  67

Query  521  GDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  342
            GDG I L+EF+           + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L
Sbjct  68   GDGFIDLKEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSL  126

Query  341  EDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +DCRRMI  VD +GDG V FE+F +MM
Sbjct  127  KDCRRMISKVDVDGDGCVNFEEFKKMM  153


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -1

Query  695  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  516
            P    G   EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGD
Sbjct  83   PRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGD  141

Query  515  GCISLEEFSVLSS  477
            GC++ EEF  + S
Sbjct  142  GCVNFEEFKKMMS  154



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+++EF+
Sbjct  17   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINIDEFA  75

Query  488  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
                +  +      EL++AFD +D DH+G+ISA EL  +   +G   CT++DC RMI  V
Sbjct  76   DFCKNDDSVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLG-QNCTIQDCTRMITSV  134

Query  311  DNNGDGFVCFEDFCRMM  261
            D NGDG+VCFE+F +MM
Sbjct  135  DANGDGYVCFEEFKKMM  151



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 2/137 (1%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFEEF  69

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             ++ S+    +   E++DAF  FD D DG ISA EL NV   +G+ R T E+  +MI  V
Sbjct  70   LIVMSSKMKENVVEEIKDAFKVFDRDQDGFISAIELRNVMINMGE-RLTEEEAEQMINEV  128

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V ++DF +MM
Sbjct  129  DLDGDGLVSYDDFVKMM  145



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL + FK  D + DGKI   EL ++++ +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   AELEEVFKKFDVNGDGKISSAELGSIMTSLG-HNATEEELGKMIEEFDADGDGFINLHEF  99

Query  491  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLRSLGDD-CSVADCRQMISG  158

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  704  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  525
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLRSLG-DDCSVADCRQMISGVDS  161

Query  524  DGDGCISLEEFSVLSSA  474
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ Q F   D++ DGKI   EL  +L  +G+   ++EEL+ ++ E+D++GDG I L+EF+
Sbjct  4    EVRQIFNKFDKNGDGKISITELRDMLGTLGS-KTTKEELKRIMEELDQNGDGYIDLKEFA  62

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                  A      ELRDAFD +D D +G ISA+EL +V   +G+ +C+L DCRRMI  VD
Sbjct  63   DFHCNDAGNDESKELRDAFDLYDVDKNGLISAKELHDVLSKLGE-KCSLSDCRRMISNVD  121

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  122  ADGDGSVNFEEFKKMM  137


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  455  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  276
            D E+R  F+ FD + DGKIS  EL ++  T+G S+ T E+ +R++  +D NGDG++  ++
Sbjct  2    DDEVRQIFNKFDKNGDGKISITELRDMLGTLG-SKTTKEELKRIMEELDQNGDGYIDLKE  60

Query  275  FC  270
            F 
Sbjct  61   FA  62



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  491  SVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L ++          L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGLISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDG + FE+F  MM
Sbjct  157  VDSDGDGMINFEEFKVMM  174



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DGKI   EL A+L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  488  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
                       D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGGTDGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD +GDG V FE+F +MM
Sbjct  138  VDVDGDGCVNFEEFKKMM  155


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  488  VLSS  477
             + S
Sbjct  153  KMMS  156



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 90/141 (64%), Gaps = 11/141 (8%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK+ D + DGKI   EL +++  +G +P S EE++ M+ E D DGDG I+ EEF 
Sbjct  50   ELEHIFKMFDANGDGKISSSELASIMGSLGQQP-SDEEVQKMIKEFDADGDGFINFEEFV  108

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  109  ELNTK----GVDSKEVLENLKDAFSVYDLDGNGSISAEELHKVLKSLGDD-CSITECRKM  163

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVDN+G+G + FE+F  MM
Sbjct  164  ISGVDNDGNGMIDFEEFKVMM  184



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 8/146 (5%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+ + F   D++ DGKI ++EL+++L+ +G+ P S E  R+M SE+D+DG+G + L
Sbjct  6    GSVEEMKKVFNKFDKNGDGKISRDELKSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDL  64

Query  500  EEFSVLSSAF-----APPSC-DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            +EF                C + EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFVAFQQTNINDDDGEAQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DCRRMI  VD +GDG V F++F +MM
Sbjct  124  DCRRMISQVDKDGDGNVNFDEFKKMM  149



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 89/139 (64%), Gaps = 3/139 (2%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            L  E+ + F   D + DG+I   EL A+L+ +G+  P  E  R+M SE+D DGDG I L 
Sbjct  12   LEEEVEKVFSKFDTNGDGRISLTELGAILNGLGSATPGDEVARIM-SELDTDGDGFIDLN  70

Query  497  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  318
            EF          S + EL++AFD +D D +GKISA EL +V +++G+ +C+L+DCRRMI 
Sbjct  71   EFKAFHCGGGEDS-NKELKEAFDLYDKDKNGKISASELHSVLRSLGE-KCSLKDCRRMIS  128

Query  317  GVDNNGDGFVCFEDFCRMM  261
             VD +GDG V FE+F +MM
Sbjct  129  SVDVDGDGCVNFEEFKKMM  147



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (58%), Gaps = 6/165 (4%)
 Frame = -1

Query  743  ESTPTSVLPALNDEI--SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  570
            +S P    PA   +   SP   +    E+ + F+  D + DG+I + EL AL   +G   
Sbjct  17   KSPPPQQQPAAEGKGTGSPPRAATAEEEMARVFRKFDANGDGRISRSELAALFESLG-HA  75

Query  569  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKIS  396
             S +E+  M++E D DGDG ISL+EF+ L++  A    + + +LR AF  FD D +G IS
Sbjct  76   ASDDEVARMMAEADADGDGFISLDEFAALNATVAGDAAAVEEDLRHAFRVFDADGNGTIS  135

Query  395  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            A EL  V + +G+S  ++  CRRMI GVD NGDG + FE+F  MM
Sbjct  136  AAELARVLRGLGES-ASVAQCRRMIEGVDQNGDGLISFEEFKVMM  179



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
             +L + F   D + DGKI   EL A+L  +  +PPS EEL  M+ E D DGDG IS  EF
Sbjct  36   GDLERVFNKFDANGDGKISSAELAAVLEILSGQPPSEEELGRMMREADVDGDGFISFAEF  95

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
              L++  AP + + +LR AF  FD D  G ISA+EL ++   IG+   +L  CRRMI GV
Sbjct  96   VDLNT--APAALEEDLRLAFAVFDLDRSGSISADELAHILGGIGEG-ASLAQCRRMIDGV  152

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V FE+F  MM
Sbjct  153  DRDGDGLVSFEEFKAMM  169



>ref|XP_002274476.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
 emb|CAN68471.1| hypothetical protein VITISV_028194 [Vitis vinifera]
Length=150

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+ + F   D++ DGKI  EE   +L  +G+   S +EL  ++SE+D DGDG I L
Sbjct  10   GTMEEVERVFNRFDKNGDGKISAEEFGEVLQALGS-TTSPDELTRIMSEIDTDGDGFIDL  68

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            +EF+    A       +ELRDAFD +D D +G ISA EL  VFK++G+ + TL+DC RMI
Sbjct  69   KEFADFHRATDSNGGLTELRDAFDMYDRDKNGLISASELHAVFKSLGE-KVTLKDCSRMI  127

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD +GDG V FE+F +MM
Sbjct  128  SSVDADGDGCVNFEEFKKMM  147



>emb|CDP16307.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q FK  D + DGKI   EL  ++  +G  P + EEL  +++E D DGDG I L+EF 
Sbjct  42   ELEQVFKKFDVNGDGKISASELGQIMGSLGY-PTTDEELHKLMNEADSDGDGFIDLQEFI  100

Query  488  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  FD D +G ISA+EL NV K++G+  C+L +CR+MI GV
Sbjct  101  ELNTKDIDSDEVMENLKDAFSVFDIDKNGSISADELQNVLKSLGE-ECSLAECRKMICGV  159

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG +CFE+F  MM
Sbjct  160  DADGDGMICFEEFKVMM  176



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q F+  D + DGKI   EL +++S +G  P + EEL  M+ EVD DGDG I  +EF 
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFDEFV  101

Query  488  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P+   E LRDAF  +D D DG I+AEEL  V +++G+   +L +CR+MI GV
Sbjct  102  ELNTKGVDPAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSLGEEN-SLAECRKMIGGV  160

Query  311  DNNGDGFVCFEDFCRMM  261
            D++GDG + FE+F  MM
Sbjct  161  DSDGDGMISFEEFKVMM  177



>ref|XP_004971250.1| PREDICTED: probable calcium-binding protein CML10-like [Setaria 
italica]
Length=235

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    S +EL  M++E D DGDG ISL+EF+
Sbjct  90   EMARVFRKFDANGDGRISRSELAALFESLG-HAASDDELARMMAEADADGDGFISLDEFA  148

Query  488  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L++  A    + + +LR AF  FD D +G ISA EL  V + +G+S  ++  CRRMI G
Sbjct  149  ALNATVAGDAAAVEEDLRHAFRVFDADGNGTISATELARVLRGLGES-ASVAQCRRMIEG  207

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + FE+F  MM
Sbjct  208  VDQNGDGLISFEEFKVMM  225



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 89/145 (61%), Gaps = 10/145 (7%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  4    AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLTEF  62

Query  491  SVL--------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  336
            +          S+     + ++ELR+AF  +D D +GKISA EL  V + +GD +C++ D
Sbjct  63   TAFHCSGGSGDSAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-KCSVAD  121

Query  335  CRRMILGVDNNGDGFVCFEDFCRMM  261
            C RMI  VD +GDG V F++F +MM
Sbjct  122  CSRMIRSVDADGDGCVNFDEFKKMM  146


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -1

Query  698  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  519
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  75   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  133

Query  518  DGCISLEEFSVLSSAFAP  465
            DGC++ +EF  +    A 
Sbjct  134  DGCVNFDEFKKMMGGGAA  151



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = -1

Query  695  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD  516
            P     L  EL   FK  D + DGKI   EL +++  +G  P + EEL+ M+  VD DG+
Sbjct  35   PGNSRTLVEELGAVFKKFDMNGDGKISWSELGSIMENLG-NPVTEEELQKMVKVVDLDGN  93

Query  515  GCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  351
            G I L EF  L++       DSE     LR AF  FDTD +G IS EEL  VF+++GD +
Sbjct  94   GFIDLNEFIDLNTN----GVDSEKAVEDLRHAFMIFDTDGNGSISPEELQAVFRSLGDDK  149

Query  350  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            C++ DC++MI GVD +GDG + FE+F  MM
Sbjct  150  CSIADCKKMIRGVDCDGDGLISFEEFKNMM  179



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -1

Query  698  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  519
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  518  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            DG I +EEF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+
Sbjct  71   DGHIDIEEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-QKCSLK  125

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DC +MI  VD +GDG V F +F +MM
Sbjct  126  DCAKMISSVDVDGDGHVNFAEFKKMM  151



>ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
Length=204

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 5/141 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR-EELRLMLSEVDRDGDGCISLEEF  492
            +L Q F+L+D + DGKI   EL  +L  +G E  +  EE   M+ EVD +GDG I L+EF
Sbjct  55   QLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVREVDCNGDGFIDLDEF  114

Query  491  -SVLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
              V+++ F   +  +CD  L DAF  FD+D +G ISAEEL  V  ++G  +C+L++C+RM
Sbjct  115  MRVMNTDFTVGSSSTCDDGLMDAFLIFDSDKNGVISAEELQRVLISLGCVKCSLQECKRM  174

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVD +GDGFV FE+F  MM
Sbjct  175  IKGVDKDGDGFVDFEEFRSMM  195


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  494  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT-LEDCRRMIL  318
            F +L+S+F      ++L+  F   DT+ DGKIS+ EL  V   +G  + T +E+   M+ 
Sbjct  40   FDLLTSSFTAMEVSNQLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVR  99

Query  317  GVDNNGDGFVCFEDFCRMM  261
             VD NGDGF+  ++F R+M
Sbjct  100  EVDCNGDGFIDLDEFMRVM  118



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 92/151 (61%), Gaps = 5/151 (3%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  533  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
             D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  66   FDKDGDGHIDIVEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-Q  120

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            +C+L+DC +MI  VD +GDG V F +F +MM
Sbjct  121  KCSLKDCAKMISSVDADGDGHVNFAEFKKMM  151



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  492
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKVMM  168



>ref|XP_004145834.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 ref|XP_004160107.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 gb|KGN57816.1| hypothetical protein Csa_3G319280 [Cucumis sativus]
Length=156

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+++ F   D++ DGKI   EL A L ++     + E  R+M SE+D+DGDG I L
Sbjct  18   GSMDEIIRVFNKFDKNGDGKISVTELAAALGELSGNISTDEIHRIM-SEIDKDGDGFIDL  76

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  77   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  133

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD +GDG V FE+F +MM
Sbjct  134  SSVDVDGDGHVNFEEFKKMM  153



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 96/151 (64%), Gaps = 6/151 (4%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            + D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  533  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  115  RLTDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = -1

Query  698  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  519
            S D  + +  EL Q FK  D + DGKI   EL ++++ +G  P + EEL  M+ EVD DG
Sbjct  36   SIDSRARIEEELEQVFKKFDMNGDGKICSSELGSIMASLG-NPTTEEELVNMIREVDSDG  94

Query  518  DGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  342
            DG I L+EF  L++           L+DAF  FD D +G ISAEEL  V +++G+  CTL
Sbjct  95   DGFIDLQEFIELNTKDIDSNEVLESLKDAFSVFDMDKNGSISAEELLTVLRSLGED-CTL  153

Query  341  EDCRRMILGVDNNGDGFVCFEDFCRMM  261
             +CR+MI GVD +GDG + FE+F  MM
Sbjct  154  AECRKMISGVDCDGDGMINFEEFKIMM  180



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DGKI  +EL  +L+ +G+   S +E+  M+ E+D D DG I+L+EF+
Sbjct  20   EVRKVFQRFDTNGDGKISSDELGGVLNALGS-GTSADEVARMMEEIDTDKDGHINLQEFA  78

Query  488  VLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
               S  + P  S + ELR+AF  +D DH+GKISA EL  +   +G+  C+ +DC  MI  
Sbjct  79   AFCSGDSDPYNSAEKELREAFQLYDQDHNGKISAAELHQILTRLGE-HCSEQDCAGMIRT  137

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD++GDGFV F++F +MM
Sbjct  138  VDSDGDGFVSFDEFRKMM  155



>ref|XP_008457051.1| PREDICTED: probable calcium-binding protein CML27 [Cucumis melo]
Length=157

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+++ F   D++ DGKI   EL A L ++     + E  R+M SE+D+DGDG I L
Sbjct  19   GSMDEVIRVFNKFDKNGDGKISVSELGAALGELSGNISTGEIHRIM-SEIDKDGDGFIDL  77

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  78   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  134

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD +GDG V FE+F +MM
Sbjct  135  SSVDVDGDGHVNFEEFKKMM  154



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI + EL+ +L  +G+E  S EE++ M+ E+D++GDG I L+EF+
Sbjct  4    EVRKIFSKFDKNGDGKISRSELKEMLLTLGSETTS-EEVKRMMEELDQNGDGFIDLKEFA  62

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                        SELRDAFD +D D +G ISA EL  V   +G+ +C+L DC++MI  VD
Sbjct  63   DFHCTEPGKDESSELRDAFDLYDLDKNGLISANELHAVLMKLGE-KCSLNDCKKMISNVD  121

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  122  VDGDGNVNFEEFKKMM  137


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  455  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  276
            D E+R  F  FD + DGKIS  EL  +  T+G S  T E+ +RM+  +D NGDGF+  ++
Sbjct  2    DDEVRKIFSKFDKNGDGKISRSELKEMLLTLG-SETTSEEVKRMMEELDQNGDGFIDLKE  60

Query  275  FC  270
            F 
Sbjct  61   FA  62



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSL-HENPTREEMQEMMNE  55

Query  533  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  115  RLTEEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
             EL + FK  D + DGKI   EL +++  +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSIMRSLG-HNATEEELGKMIDEFDADGDGFINLHEF  99

Query  491  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLQSLGDD-CSVADCRQMISG  158

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  704  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  525
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLQSLG-DDCSVADCRQMISGVDS  161

Query  524  DGDGCISLEEFSVLSSA  474
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            +L   FK  D + DGKI   EL +++  +G +P + EE++ M+ EVD +GDG I+L EF 
Sbjct  8    DLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINLGEFL  66

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++    P      L+DAF  FD D +G I+A+EL  V  ++GD+ C++++C++MI GV
Sbjct  67   ELNTKGVDPDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLGDA-CSIDECQKMIAGV  125

Query  311  DNNGDGFVCFEDFCRMM  261
            D NGDG + FE+F  MM
Sbjct  126  DGNGDGMINFEEFQLMM  142



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_002962635.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
 gb|EFJ36098.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
Length=140

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGA---EPPSREELRLMLSEVDRDGDGCISLE  498
            EL   F+L D + DG+I   EL A+L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELHKMVEEVDADGDGFISLD  60

Query  497  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  318
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  317  GVDNNGDGFVCFEDFCRMM  261
            GVD+NGDG V FE+F  MM
Sbjct  119  GVDSNGDGRVDFEEFKLMM  137



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL+EF+
Sbjct  40   EMERVFRKFDANGDGRISRSELGALFESLG-HAATDDELARMMAEADADGDGFISLDEFA  98

Query  488  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L++  +    + + +LR AF  FD D +G ISA EL  V   +G+ + T++ CRRMI G
Sbjct  99   ALNATASGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLHGLGE-KATVQQCRRMIEG  157

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + FE+F  MM
Sbjct  158  VDQNGDGLISFEEFKVMM  175



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            + AEL Q F   D + DGKI   EL A++  +G +  + +EL  ML EVD DGDG ISL+
Sbjct  9    MAAELEQVFHKFDVNGDGKIDASELGAVMGSLG-QKATEQELINMLREVDGDGDGYISLQ  67

Query  497  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            EF  L++           L++AF  FD D +G I+AEEL  V +++G+  CTL +CRRMI
Sbjct  68   EFIELNTKGVDSDEVLENLKEAFSVFDIDGNGSITAEELNTVMRSLGE-ECTLAECRRMI  126

Query  320  LGVDNNGDGFVCFEDFCRMM  261
             GVD++GDG + FE+F  MM
Sbjct  127  SGVDSDGDGMIDFEEFRVMM  146



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  492
            EL   FK  D + DGKI  +EL ++++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGSIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKVMM  168



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  740  STPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR  561
            ++PT+            +L     EL Q FK  D + DGKI   EL +++S +G E  + 
Sbjct  21   NSPTTANQVTGSRSQSLKLKPHIEELEQVFKKFDVNGDGKISSLELGSIMSSLGHEA-NE  79

Query  560  EELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEEL  384
            EE+  M+ E D DGDG I  +EF  L++           L+DAFD +D D +G ISAEEL
Sbjct  80   EEVMKMIKEFDADGDGFIDFKEFVELNTQGVGSDEVMENLKDAFDVYDIDGNGSISAEEL  139

Query  383  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              V  +IG+S C++ +CR+MI GVD++GDG + FE+F  MM
Sbjct  140  HKVMGSIGES-CSIAECRKMISGVDSDGDGMIDFEEFKVMM  179



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 7/141 (5%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + FK  D + DGKI   EL  +L  +G++  S EE+  M+SE+D DGDG I L+EF+
Sbjct  18   EVEKVFKRFDANGDGKISSTELRDVLGALGSDT-SPEEIHRMMSEIDTDGDGFIDLKEFA  76

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
                +    +  +E     L+DAF+ +D D +G ISA+EL+ V K +G+ +C+L+DC RM
Sbjct  77   EFHKSNGTGNTKAEDELKELKDAFNLYDKDKNGLISAKELYTVLKRLGE-KCSLQDCSRM  135

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I  VD +GDG V FE+F  MM
Sbjct  136  INSVDVDGDGHVNFEEFKLMM  156



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            +  EL Q FK  D + DGKI   EL +++  +G E  + +E+  M+ EVD DGDGCISL+
Sbjct  32   MAGELEQVFKKFDVNGDGKISASELGSIMRSLGQEA-TEQEVDNMIREVDGDGDGCISLQ  90

Query  497  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            EF  L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRMI
Sbjct  91   EFIELNTKGVDSDEVLENLKDAFSVFDMDGNGLITAEELNTVMRSLGEE-CSLAECRRMI  149

Query  320  LGVDNNGDGFVCFEDFCRMM  261
             GVD +GDG + FE+F  MM
Sbjct  150  GGVDRDGDGTIDFEEFRVMM  169



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (60%), Gaps = 13/152 (9%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  501
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  500  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  357
            +EF               S  F     DSEL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDNNSVGFGNEEEDSELMDAFRIFDTDKNGKISAKELQRVLFSLGC  167

Query  356  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  168  KECSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL+  ++E+DR GDG I+ EEF 
Sbjct  50   ELEAVFKKFDVNGDGKISSKELGAIMANLGHEVPE-EELQKAITEIDRKGDGYINFEEFV  108

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  109  ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDD-CSIAECRKMIGGV  167

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  168  DKDGDGTIDFEEFKVMM  184



>ref|XP_007045260.1| Polcalcin Jun o, putative [Theobroma cacao]
 gb|EOY01092.1| Polcalcin Jun o, putative [Theobroma cacao]
Length=199

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 89/141 (63%), Gaps = 11/141 (8%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + FK  D + DGKI   EL +++  +G   PS +EL+ M+ E D DGDG I+ +EF 
Sbjct  54   ELEEVFKKFDVNGDGKISSSELGSIMGSLG-HKPSEDELQKMIKEFDADGDGSINFKEFV  112

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  113  ELNT----KGVDSDEVLENLKDAFSVYDIDGNGSISAEELHEVLKSLGD-ECSIAECRKM  167

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVD++GDG + FE+F  MM
Sbjct  168  ISGVDSDGDGMIDFEEFKVMM  188



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -1

Query  710  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  540
            ND IS       SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  539  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  360
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG  119

Query  359  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              +C+L++C +MI  VD +GDG V F +F +MM
Sbjct  120  -QKCSLKECAKMIGSVDADGDGHVNFAEFKKMM  151



>ref|XP_009413607.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F   D D DG+I   EL A+L  +G++P S +E+R M++E+D D DG + L+EF+
Sbjct  26   ELEKVFARFDADGDGRISASELAAVLRALGSDP-SPDEIRDMIAEMDADRDGFVDLQEFA  84

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
                        ++EL+DAF  +D D DG IS +EL  V +++G+ +CTLEDC RMI  V
Sbjct  85   AFHRCGVGRGGAEAELKDAFRMYDLDSDGLISVDELLRVMRSLGE-KCTLEDCARMIRSV  143

Query  311  DNNGDGFVCFEDFCRMM  261
            D++GDG V FE+F  MM
Sbjct  144  DSDGDGSVSFEEFKTMM  160



>ref|XP_002312460.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
 gb|EEE89827.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
Length=172

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q FK  D + DGKI   EL++   ++G E  S EEL+ M++E D DGDG I L+EF 
Sbjct  21   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEEELQRMITEFDADGDGFIDLQEFV  79

Query  488  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++     +   E L+DAF  +D D +G ISAEEL  V  ++G+  C++ +CR+MI GV
Sbjct  80   ALNTQGVDTNEVMENLKDAFSVYDIDGNGSISAEELHKVMASLGEP-CSMAECRKMISGV  138

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  139  DRDGDGMIDFEEFKVMM  155



>ref|XP_004159084.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=185

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
             EL + FK  D + DGKI   EL + +  +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSTMRSLG-HNATEEELGKMIDEFDADGDGFINLHEF  99

Query  491  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLQSLGDD-CSVADCRQMISG  158

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  704  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  525
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLQSLG-DDCSVADCRQMISGVDS  161

Query  524  DGDGCISLEEFSVLSSA  474
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+ + F   D++ DGKI  +EL+ +L  +G++  S EE++ ++ E+D DGDG I  
Sbjct  13   GSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDF  71

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            +EFS    A        EL+DAFD +D D +G ISA EL  V K +G+ + +L+DC  MI
Sbjct  72   KEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGE-KSSLKDCVNMI  130

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD +GDG V FE+F +MM
Sbjct  131  KKVDADGDGHVNFEEFKKMM  150



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFEEF  69

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
              + +     +   EL++AF  FD D DG ISA EL NV   +G+ R + E+  +MI   
Sbjct  70   LGIMARKMKENVGEELKEAFKVFDRDQDGFISAIELKNVMINLGE-RVSDEEAEQMIREA  128

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V +E+F RMM
Sbjct  129  DVDGDGVVSYEEFVRMM  145



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_011024051.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=195

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 93/160 (58%), Gaps = 4/160 (3%)
 Frame = -1

Query  734  PTSVLPALNDEISPD-ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  558
            P+ +  ++N   SP   L     EL Q FK  D + DGKI   EL++   ++G E  S E
Sbjct  21   PSGMATSINGSKSPSVRLRLQVEELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEE  79

Query  557  ELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELF  381
            EL  M++E D DGDG I L+EF  L++           L+DAF  +D D +G ISAEEL 
Sbjct  80   ELLRMITEFDADGDGFIDLQEFVALNTQGVDTDEVMENLKDAFSVYDIDGNGSISAEELH  139

Query  380  NVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
             V  ++G+  C++ +CR+MI GVD +GDG + FE+F  MM
Sbjct  140  KVMASLGEP-CSMAECRKMISGVDRDGDGMIDFEEFKVMM  178



>ref|XP_002980456.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
 gb|EFJ18716.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
Length=140

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGA---EPPSREELRLMLSEVDRDGDGCISLE  498
            EL   F+L D + DG+I   EL A+L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELLKMVEEVDADGDGFISLD  60

Query  497  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  318
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  317  GVDNNGDGFVCFEDFCRMM  261
            GVD+NGDG V FE+F  MM
Sbjct  119  GVDSNGDGRVDFEEFKLMM  137



>ref|XP_011467223.1| PREDICTED: calcium-binding protein CML24-like [Fragaria vesca 
subsp. vesca]
Length=148

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 91/137 (66%), Gaps = 6/137 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F   D++ DGKI ++EL  +  ++G+E    EE++ +++E D+DGDG I L+EF+
Sbjct  17   ELKKIFNKFDKNGDGKICRDELREIFRELGSETTP-EEVKTIMAEFDKDGDGRIDLDEFA  75

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             + +  +      +LRDAFD +D D +G+ISA EL  V K +G  +C+L+DC +MI  VD
Sbjct  76   EILNGGSTK----DLRDAFDLYDLDKNGRISASELHEVLKRLG-QKCSLKDCAKMIGSVD  130

Query  308  NNGDGFVCFEDFCRMME  258
             +GDG V FE+F +MM+
Sbjct  131  ADGDGHVNFEEFKKMMK  147



>emb|CDM86427.1| unnamed protein product [Triticum aestivum]
Length=190

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISLEEF+
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLEEFA  107

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L+ A A    + +LR AF  FD D  G ISA EL +V   +G+ + T++ CRRMI GVD
Sbjct  108  ALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELASVLHGLGE-KATVQQCRRMIEGVD  165

Query  308  NNGDGFVCFEDFCRMM  261
             NGDG + F++F  MM
Sbjct  166  KNGDGLISFDEFKVMM  181



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSL-HEHPTREEIQEMINE  55

Query  533  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGSIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            R T E+ ++MI   D +GDG V +++F ++M
Sbjct  115  RLTEEEAQQMIREADLDGDGLVSYDEFVKIM  145



>ref|XP_006574101.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=195

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 89/140 (64%), Gaps = 3/140 (2%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            +  +L   FK  D + DGKI   EL +++  +G +P + EE++ M+ EVD +GDG I+L 
Sbjct  48   ITEDLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINLG  106

Query  497  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            EF  L++    P      L+DAF  FD D +G I+A+EL  V  ++GD+ C++++C++MI
Sbjct  107  EFLELNTKGVDPDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLGDA-CSIDECQKMI  165

Query  320  LGVDNNGDGFVCFEDFCRMM  261
             GVD NGDG + FE+F  MM
Sbjct  166  AGVDGNGDGMINFEEFQLMM  185



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFV  95

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGV  154

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -1

Query  710  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  540
            ND IS       +G   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGAAGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  539  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  360
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG  119

Query  359  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              +C+L++C +MI  VD +GDG V F +F +MM
Sbjct  120  -QKCSLKECAKMIGSVDADGDGHVNFAEFKKMM  151



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFV  95

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGV  154

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  92

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +C++MI GV
Sbjct  93   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECKKMIGGV  151

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKIMM  168



>gb|KJB15360.1| hypothetical protein B456_002G172400 [Gossypium raimondii]
Length=197

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 88/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + FK  D + DGKI   EL +++  +G + PS EEL  M+ E D DGDG I+  EF 
Sbjct  46   EIEEVFKKFDANGDGKISASELGSIMKSLG-QQPSDEELHNMIKEFDADGDGFINFNEFI  104

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
             L++       DSE     L+DAF  +D D +G ISAEEL  V K++G+  C++ +CR+M
Sbjct  105  ELNT----KGVDSEEVLENLKDAFSVYDIDGNGWISAEELHEVLKSLGE-ECSIAECRKM  159

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVDN+G+G + FE+F  MM
Sbjct  160  ISGVDNDGNGMIDFEEFKVMM  180



>ref|XP_002974189.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
 gb|EFJ25144.1| hypothetical protein SELMODRAFT_100711 [Selaginella moellendorffii]
Length=181

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 94/166 (57%), Gaps = 4/166 (2%)
 Frame = -1

Query  755  KPGGESTPTSVLPALNDEISPDE-LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            K  G  +P + + A     SP   +     EL Q F+ ID D DG+I  EEL A+L  +G
Sbjct  10   KKSGRDSPVASIAAEATVPSPARSIDQRAKELEQVFRSIDTDGDGRICLEELRAMLRLIG  69

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKI  399
               P   EL  +L  +D DGDG ISLEEF  L +     S   +LR AF  FD D +G I
Sbjct  70   NANPDDTELLGLLRAIDSDGDGFISLEEF--LRANDEGGSSAGDLRAAFQVFDIDGNGFI  127

Query  398  SAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            SA+EL  V + +GD + T  +CRRMI GVD++G+G V FE+F  MM
Sbjct  128  SADELHCVLQKMGD-KITKSECRRMIKGVDSDGNGLVDFEEFRIMM  172



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI   EL  L++ +G++  + EE+R M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFNKFDKNGDGKISCSELRELMAALGSKTTT-EEVRRMMAELDRNGDGYIDLKEFG  62

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGGGD-GKELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  121  ADGDGNVNFEEFKKMM  136



>emb|CDM86445.1| unnamed protein product [Triticum aestivum]
Length=190

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISLEEF+
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLEEFA  107

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L+ A A    + +LR AF  FD D  G ISA EL  V   +G+ + T++ CRRMI GVD
Sbjct  108  ALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELARVLHGLGE-KATVQQCRRMIEGVD  165

Query  308  NNGDGFVCFEDFCRMM  261
             NGDG + F++F  MM
Sbjct  166  KNGDGLISFDEFKVMM  181



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 13/152 (9%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  501
            + ++  Q F+++D + DGKI   EL A+LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  500  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  357
            +EF               S  F     D EL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDSDSVGFGNEEEDCELMDAFRIFDTDKNGKISAKELQRVLVSLGC  167

Query  356  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  168  KECSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199



>ref|XP_003630938.1| Calcium-binding pollen allergen [Medicago truncatula]
Length=188

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 11/140 (8%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  31   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  89

Query  497  EFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  333
            EF  L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +C
Sbjct  90   EFIELNT----KGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAEC  144

Query  332  RRMILGVDNNGDGFVCFEDF  273
            R+MI GVD++GDG + FE+F
Sbjct  145  RKMIGGVDSDGDGTIDFEEF  164



>ref|XP_010938627.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
 ref|XP_010938628.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=189

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + FK  D + DGKI   EL A+   +G  P + EEL+ M+ E D DGDG ISL+EF 
Sbjct  42   EVERVFKKFDSNGDGKISSAELAAIFQNLG-HPATEEELQRMMGEADADGDGFISLDEFV  100

Query  488  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L+      S   E LR AF  FD D +G ISA+EL  V ++IG+   ++  C+RMI GV
Sbjct  101  DLNVRTVDDSAALEDLRHAFSVFDLDRNGAISADELARVLRSIGEG-ASVTQCKRMIEGV  159

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V FE+F  MM
Sbjct  160  DRDGDGLVSFEEFKLMM  176



>gb|KDP23917.1| hypothetical protein JCGZ_27077 [Jatropha curcas]
Length=158

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 2/137 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F   D + DGKI   EL  +L  +G+     E  R+M  +VD D DG I+LEEF+
Sbjct  10   ELKKVFDQFDTNGDGKISTAELGGILKAMGSTYTIAELDRVM-DDVDTDKDGFINLEEFA  68

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L  + +  S  SELRDAFD +D + +G IS+ EL+ V   +G S CT++DC +MI GVD
Sbjct  69   QLCRSSSGGSAVSELRDAFDLYDQNKNGLISSSELYQVLTRLGMS-CTVDDCVQMIKGVD  127

Query  308  NNGDGFVCFEDFCRMME  258
            ++GDG V FE+F +MM+
Sbjct  128  SDGDGCVSFEEFRKMMD  144



>ref|XP_009414956.1| PREDICTED: probable calcium-binding protein CML15 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -1

Query  665  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  486
            L + F   D + DGKI   EL  +L  +G + PS EEL  M+ E D DGDG ISL EF  
Sbjct  31   LERVFNKFDSNGDGKISSAELADVLESLGGQRPSEEELGRMMREADADGDGFISLAEFVE  90

Query  485  LSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDN  306
            L+++  P + + +LR AF  FD D  G ISA+E+  V + IG+   ++  CRRMI GVD 
Sbjct  91   LNTS-PPAAVEEDLRLAFAVFDLDRSGAISADEIARVLRGIGEG-ASVAQCRRMIDGVDL  148

Query  305  NGDGFVCFEDFCRMM  261
            +GDG + FE+F  MM
Sbjct  149  DGDGLISFEEFKAMM  163



>ref|XP_008800225.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=189

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + FK  D + DGKI   EL A+   +G  PP+ EEL+ M+ E D DGDG ISL+EF 
Sbjct  42   EVERVFKKFDLNGDGKISSAELAAIFQSLG-HPPTEEELQRMMGEADADGDGFISLDEFV  100

Query  488  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L+ +    S   E LR AF  FD D +G IS +EL  V ++IG+   ++  C+RMI GV
Sbjct  101  ELNVSTVDDSTALEDLRHAFSVFDLDRNGSISPDELARVLRSIGEG-ASVAQCKRMIEGV  159

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  160  DRDGDGLISFEEFKLMM  176



>ref|XP_010526084.1| PREDICTED: calmodulin-like protein 4 [Tarenaya hassleriana]
Length=208

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
             EL + F++ D++ DG+I KEEL   L  +G   P RE L  M+ ++D +GDGC+ ++EF
Sbjct  66   VELKRVFQMFDKNGDGRITKEELNDSLENLGLFLPDRE-LAQMIQKIDANGDGCVDMDEF  124

Query  491  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL  318
              L  +    S  D ++RDAFD FD D DG I+ EEL +V  ++G  +  TLEDC++MI+
Sbjct  125  ESLYKSIVDQSDKDDDMRDAFDVFDQDGDGFITVEELKSVMGSLGLKQGKTLEDCKKMIM  184

Query  317  GVDNNGDGFVCFEDFCRMME  258
             VD +GDG V +++F +MM+
Sbjct  185  QVDVDGDGRVNYKEFLQMMK  204



>gb|AET05414.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=190

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 11/140 (8%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            L  EL + FK  D + DGKI   EL +++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  33   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  91

Query  497  EFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  333
            EF  L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +C
Sbjct  92   EFIELNT----KGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAEC  146

Query  332  RRMILGVDNNGDGFVCFEDF  273
            R+MI GVD++GDG + FE+F
Sbjct  147  RKMIGGVDSDGDGTIDFEEF  166



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 86/146 (59%), Gaps = 11/146 (8%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AE+ Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  30   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDADRDGFVDLAEF  88

Query  491  SVLS---------SAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
                               + ++ELR+AF  +D DH+G ISA EL  V + +GD +C++ 
Sbjct  89   VAFHCGPSGGAGAGEGQEDATEAELREAFRMYDADHNGLISARELHRVLRQLGD-KCSVA  147

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            DC RMI  VD +GDG V F++F +MM
Sbjct  148  DCSRMIRSVDADGDGSVNFDEFKKMM  173



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = -1

Query  698  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  519
            +P  L G   EL + F   D + DGKI   ELE +L  + ++ P +EELR ++ E+  D 
Sbjct  16   TPSPLLGDMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDR  75

Query  518  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  339
            DG I+L EF+    +      DS LRDAFD +D D +G IS EEL      +G  +C++E
Sbjct  76   DGFINLSEFAAFCRSDTTDGGDSALRDAFDLYDKDKNGLISTEELHLALDRLG-MKCSVE  134

Query  338  DCRRMILGVDNNGDGFVCFEDFCRMM  261
            +C+ MI  VD++GDG V F++F +MM
Sbjct  135  ECQDMIKSVDSDGDGSVNFDEFKKMM  160



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 93/161 (58%), Gaps = 17/161 (11%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
            ES  TS L ++ND             + + F   D + DGKI   EL  ++  +G+E  S
Sbjct  6    ESEKTSELVSVND-------------VERVFTRYDTNGDGKISPSELADVMRALGSEV-S  51

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  384
             EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D D DG+ISA+EL
Sbjct  52   DEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EGELRDAFAMYDLDRDGQISAKEL  109

Query  383  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              V K +G+ +C++ DC RMI  VD++GDG V FE+F  MM
Sbjct  110  HLVLKRLGE-KCSVHDCSRMIRSVDSDGDGSVNFEEFKMMM  149



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AE  +AF +ID+D DG I  EEL +++  +  E P++EE+R M+ EVD DGDG +  EEF
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTVDFEEF  69

Query  491  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
              + +     +   EL++AF  FD D DG ISA EL NV   +G+ R + E+  +MI   
Sbjct  70   LSIMARKMKENVAEELKEAFKVFDRDQDGFISAIELRNVMMNLGE-RLSDEEAEQMIREA  128

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG V +E+F RMM
Sbjct  129  DLDGDGVVSYEEFVRMM  145



>ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=188

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 88/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q F   D + DGKI   EL +++  +G +P +  EL  M+ EVD DGDGCISL EF 
Sbjct  36   ELEQVFNKFDVNGDGKISASELGSIMGSLG-QPATELELDNMIREVDGDGDGCISLPEFI  94

Query  488  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  324
             L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRM
Sbjct  95   ELNT----KGVDSDEVLENLKDAFAVFDIDGNGSITAEELNTVMRSLGED-CSLAECRRM  149

Query  323  ILGVDNNGDGFVCFEDFCRMM  261
            I GVD +GDG + FE+F  MM
Sbjct  150  ISGVDGDGDGTIDFEEFRVMM  170



>ref|XP_010531587.1| PREDICTED: probable calcium-binding protein CML25 [Tarenaya hassleriana]
Length=202

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + FK  D + DGKI   EL ++++ +G E P  +EL+  ++E+D DGDG I+ EEF 
Sbjct  49   ELEEVFKKFDVNGDGKISSSELGSIMASLGHEVP-EDELQKAITEIDGDGDGNINFEEFV  107

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+MI GV
Sbjct  108  ELNTKGMDQDDVMENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIGECRKMISGV  166

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  167  DKDGDGSIDFEEFKVMM  183



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  713  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  534
            + D +S +++S    E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  533  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  354
            VD DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ 
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-  114

Query  353  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            R T E+ ++MI   D +GDG V +E+F ++M
Sbjct  115  RLTDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_010271280.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=205

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 2/133 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI   EL +++  +G  P + EEL+ M+ EVD DGDG I L EF 
Sbjct  44   ELEHVFKRFDVNGDGKISWSELGSIMGSLG-HPATEEELQKMVEEVDSDGDGFIDLNEFI  102

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++          +L++AF  FD D +G IS EEL  V K++GD RC++ +C++MI GV
Sbjct  103  ELNTKGVDSLKVIEDLKNAFMVFDIDRNGSISPEELQTVLKSLGDDRCSIAECKKMIRGV  162

Query  311  DNNGDGFVCFEDF  273
            D +GDG + FE+F
Sbjct  163  DCDGDGLINFEEF  175



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   E+ + F   D++ DGKI + EL  +L  +G+   S +E++ +++E+D DGDG I  
Sbjct  7    GSMEEVQKIFNKFDKNRDGKISRSELRDVLGALGS-KTSDDEVKRVMAEIDADGDGYIDF  65

Query  500  EEFSVLSSAFAP---PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  330
            +EF    S  +     + + ELRDAFD +D D +G IS+ EL +V +++G+ +C+L DC 
Sbjct  66   DEFVKFHSGGSENDGAANEKELRDAFDLYDLDKNGVISSRELHSVLRSLGE-KCSLSDCS  124

Query  329  RMILGVDNNGDGFVCFEDFCRMM  261
            RMI  VD +GDG V FE+F +MM
Sbjct  125  RMIRSVDADGDGSVNFEEFKKMM  147



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRGVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
             EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+DC +MI
Sbjct  84   LEFAEIMNGGSSQ----ELRDAFDLYDLDKNGLISVSELHEVMKRLG-LKCSLQDCVKMI  138

Query  320  LGVDNNGDGFVCFEDFCRMM  261
              VD +GDG V F++F +MM
Sbjct  139  RNVDADGDGHVNFDEFKKMM  158



>gb|AAM67124.1| calmodulin-related protein [Arabidopsis thaliana]
Length=157

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI  507
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  506  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  336
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  335  CRRMILGVDNNGDGFVCFEDFCRMM  261
            C+RMI  VD++GDG V FE+F +MM
Sbjct  127  CQRMISKVDSDGDGCVDFEEFKKMM  151



>ref|XP_004490807.1| PREDICTED: calcium-binding protein CML24-like [Cicer arietinum]
Length=143

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI   EL+ +L  +G +  S +E++ M+  +D++GDG I L+EFS
Sbjct  8    EVRKIFSKFDKNGDGKISSSELKEMLITLGTKTTS-DEVKRMMEMIDQNGDGYIDLKEFS  66

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                  A     +ELRDAFD +D D +G ISA EL  V   +G+ +C+L DCRRMI  VD
Sbjct  67   DFHCIDAGKDDANELRDAFDLYDLDKNGLISANELHAVLIKLGE-KCSLGDCRRMIKNVD  125

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  126  VDGDGNVNFEEFKKMM  141


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  461  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  282
            S D E+R  F  FD + DGKIS+ EL  +  T+G ++ T ++ +RM+  +D NGDG++  
Sbjct  4    SMDDEVRKIFSKFDKNGDGKISSSELKEMLITLG-TKTTSDEVKRMMEMIDQNGDGYIDL  62

Query  281  EDF  273
            ++F
Sbjct  63   KEF  65



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 17/161 (11%)
 Frame = -1

Query  743  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  564
            ES  +S L ++ND             + + F   D + DGKI   EL  ++  +G+E  S
Sbjct  6    ESEKSSELVSVND-------------IKRVFTRYDTNGDGKISPSELADVMRALGSEV-S  51

Query  563  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL  384
             EEL+ M++E+D DGDG + L+EF            + ELRDAF  +D D DG+ISA+EL
Sbjct  52   DEELKAMMAELDSDGDGFVDLKEFVAFHRGLGEK--EEELRDAFAMYDLDRDGQISAKEL  109

Query  383  FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
              V K +G+ +C++ DC RMI  VD++GDG V FE+F  MM
Sbjct  110  HLVLKQLGE-KCSVHDCSRMIRSVDSDGDGSVNFEEFKMMM  149



>ref|NP_001152603.1| polcalcin Jun o 2 [Zea mays]
 gb|ACG48452.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  488  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>gb|ACG44451.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  488  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  E L+  ++++DR GDG I+ EEF 
Sbjct  38   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFEEFV  96

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  97   ELNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  155

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  156  DKDGDGTIDFEEFKIMM  172



>gb|EAY97018.1| hypothetical protein OsI_18939 [Oryza sativa Indica Group]
Length=189

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 15/146 (10%)
 Frame = -1

Query  671  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  492
            AEL Q F+  D + DGKI  EEL ++L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLSEF  93

Query  491  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  351
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  94   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  152

Query  350  CTLEDCRRMILGVDNNGDGFVCFEDF  273
            C++ DC RMI  VD +GDG V F++F
Sbjct  153  CSVADCSRMIRSVDADGDGCVNFDEF  178


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -1

Query  698  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  519
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  111  AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  169

Query  518  DGCISLEEF  492
            DGC++ +EF
Sbjct  170  DGCVNFDEF  178



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  488  VLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI GV
Sbjct  110  DLNTKGNDKAACLEDLKNAFKIFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  311  DNNGDGFVCFEDF  273
            D NGDG + FE+F
Sbjct  169  DRNGDGLINFEEF  181



>ref|NP_564874.1| calmodulin like 23 [Arabidopsis thaliana]
 sp|Q9C8Y1.1|CML23_ARATH RecName: Full=Probable calcium-binding protein CML23; AltName: 
Full=Calmodulin-like protein 23 [Arabidopsis thaliana]
 gb|AAG52166.1|AC020665_11 calmodulin-related protein; 72976-72503 [Arabidopsis thaliana]
 gb|AAL36209.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AAM51400.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AEE34504.1| calmodulin like 23 [Arabidopsis thaliana]
Length=157

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI  507
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  506  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  336
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  335  CRRMILGVDNNGDGFVCFEDFCRMM  261
            C+RMI  VD++GDG V FE+F +MM
Sbjct  127  CQRMINKVDSDGDGCVDFEEFKKMM  151



>ref|XP_004962216.1| PREDICTED: probable calcium-binding protein CML15-like [Setaria 
italica]
Length=205

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D D DG+I + EL AL   VG    + +E+  M+ E D DGDGCISL EF+
Sbjct  58   EMERVFRKFDADGDGQISRSELAALFESVG-HAATDDEVSRMMEEADADGDGCISLPEFA  116

Query  488  VL--SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L  S+     + + +LR AF  FD D +G I+  EL  V + IG++  T+  CRRMI G
Sbjct  117  ALVRSADADAAAVEEDLRHAFMVFDADGNGLITPAELARVLRGIGEA-ATVAQCRRMIQG  175

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG V F++F  MM
Sbjct  176  VDKNGDGLVSFDEFKLMM  193



>ref|XP_008673034.1| PREDICTED: polcalcin Jun o 2 isoform X1 [Zea mays]
 tpg|DAA55826.1| TPA: polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (61%), Gaps = 4/138 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  488  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  315
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  314  VDNNGDGFVCFEDFCRMM  261
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>ref|XP_010033692.1| PREDICTED: probable calcium-binding protein CML27 [Eucalyptus 
grandis]
 gb|KCW84060.1| hypothetical protein EUGRSUZ_B00943 [Eucalyptus grandis]
Length=171

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + F   D + DGKI   EL  +L+ +G+  P  E+L   ++E+D DGDG ISL EF+
Sbjct  33   ELRKVFDQFDANGDGKISASELSQVLAAMGSAVPP-EDLDRAMAEIDADGDGFISLPEFA  91

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L  +   PS D++LRDAFD +D D +G ISA EL  V   +    C++EDC RMI  VD
Sbjct  92   GLCRS--GPSPDADLRDAFDLYDQDRNGLISAAELHLVLNRLS-MNCSVEDCARMIKSVD  148

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  149  GDGDGNVNFEEFRKMM  164


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = -1

Query  467  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFV  288
            P   + ELR  FD FD + DGKISA EL  V   +G S    ED  R +  +D +GDGF+
Sbjct  27   PHMTNEELRKVFDQFDANGDGKISASELSQVLAAMG-SAVPPEDLDRAMAEIDADGDGFI  85

Query  287  CFEDF---CR  267
               +F   CR
Sbjct  86   SLPEFAGLCR  95



>emb|CDX84967.1| BnaC05g20880D [Brassica napus]
Length=189

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ EEF 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFV  97

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  98   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGV  156

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  157  DKDGDGTIDFEEFKIMM  173



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI + EL+ +++ +G++  + EE+  M+ E+DR+GDG I L+EF 
Sbjct  5    EVRKIFNKFDKNGDGKISRTELKEMMTALGSKTTT-EEVTRMMEELDRNGDGYIDLKEFG  63

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L +         ELR+AF+ +D D +G ISA+EL  V + +G+ +C+L DCR+MI  VD
Sbjct  64   ELHNGGGDTK---ELREAFEMYDLDKNGLISAKELHAVMRRLGE-KCSLGDCRKMIGNVD  119

Query  308  NNGDGFVCFEDFCRMM  261
             + DG V FE+F +MM
Sbjct  120  ADADGNVNFEEFKKMM  135



>ref|XP_009370750.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=148

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  680  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  501
            G  +E  +AF LID+D DG IR EEL  ++  +  + P++EE++ M+SE+  DG+G I  
Sbjct  8    GQISEFQEAFCLIDKDSDGLIRLEELATVIQSLD-QRPTKEEIQDMISEIGADGNGTIDF  66

Query  500  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            EEF  + S     +   EL++AF  FD D DG ISA EL  V   +G+ R T E+  +MI
Sbjct  67   EEFLNIMSRKMKENVAEELKEAFKVFDRDQDGYISASELRQVMINLGE-RLTDEEAEQMI  125

Query  320  LGVDNNGDGFVCFEDFCRMM  261
               D +GDG V +E+F RMM
Sbjct  126  KEADLDGDGLVSYEEFARMM  145



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  488  VLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI GV
Sbjct  110  DLNTKGNDKAACLEDLKNAFKVFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  311  DNNGDGFVCFEDF  273
            D NGDG + FE+F
Sbjct  169  DRNGDGLINFEEF  181



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  60   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVKEIDADGDGFVDFDEFV  118

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI GV
Sbjct  119  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  177

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  178  DCDGDGTIDFEEFKVMM  194



>ref|XP_009797345.1| PREDICTED: probable calcium-binding protein CML25 [Nicotiana 
sylvestris]
Length=189

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 99/171 (58%), Gaps = 11/171 (6%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            KK   ++      P ++   S +  + +  EL Q FK  D + DGKI   EL ++++ +G
Sbjct  11   KKRVAKANNNDPTPVISSSSSINARARIEEELEQVFKKFDVNGDGKICSSELGSIMASLG  70

Query  578  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTD  414
                + EEL  M+ EVD DGDG I L+EF  L++       DS+     L+DAF  FD D
Sbjct  71   -NAATEEELLNMIREVDADGDGFIDLQEFIELNT----KDVDSDEVLENLKDAFSVFDMD  125

Query  413  HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
             +G ISAEEL  V +++G+  C+L +CR+MI GVD +GDG + FE+F  MM
Sbjct  126  KNGSISAEELQTVLRSLGED-CSLAECRKMISGVDCDGDGMINFEEFKVMM  175



>ref|XP_009113828.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY27574.1| BnaA09g28330D [Brassica napus]
Length=191

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL   FK  D + DGKI  +EL A+++ +G E P  E L   ++E+DR GDG I+ EEF 
Sbjct  39   ELEAVFKKFDVNGDGKISSKELGAIMASLGNEVP-EEVLEKAITEIDRKGDGYINFEEFV  97

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  98   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIGECRKMIGGV  156

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  157  DKDGDGTIDFEEFKIMM  173



>ref|XP_001768532.1| predicted protein [Physcomitrella patens]
 gb|EDQ66683.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 84/143 (59%), Gaps = 8/143 (6%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL + FK+ D D DGKI   EL A+L+ +G      E ++LM  ++D + DG ISL EF 
Sbjct  32   ELARVFKVYDADHDGKISLVELRAVLTTLGGAISEEEGVQLM-KDIDTNNDGFISLAEFV  90

Query  488  VLSSAFAP-------PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  330
                +           S D  LRDAF  FD D D +ISA++L +V  ++GD   +LEDCR
Sbjct  91   AFHVSIKGGIVGGDISSVDDPLRDAFQVFDKDGDKRISADDLQSVLVSLGDKGHSLEDCR  150

Query  329  RMILGVDNNGDGFVCFEDFCRMM  261
            +MI  VD +GDG+V FE+F  +M
Sbjct  151  QMINNVDKDGDGYVDFEEFQELM  173



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q F   D + DGKI   EL ++L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  43   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVREIDADGDGFVDFDEFV  101

Query  488  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  312
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI GV
Sbjct  102  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  160

Query  311  DNNGDGFVCFEDFCRMM  261
            D +GDG + FE+F  MM
Sbjct  161  DCDGDGTIDFEEFKVMM  177



>ref|XP_003552973.1| PREDICTED: calcium-binding protein CML24-like isoform 1 [Glycine 
max]
Length=139

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI   EL+ +++ +G++  S +E++ M++E+DR+GDG I L+EF 
Sbjct  5    EVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTS-DEVKRMMAELDRNGDGYIDLKEFG  63

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  64   EFHCGGGGDG--RELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  121  ADGDGNVNFEEFKKMM  136



>ref|XP_003538397.1| PREDICTED: probable calcium-binding protein CML27-like isoformX1 
[Glycine max]
 ref|XP_006591331.1| PREDICTED: probable calcium-binding protein CML27-like isoform 
X2 [Glycine max]
Length=137

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F   D++ DGKI   EL+ ++  +G++  S EE++ M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFSKFDKNGDGKISCAELKEMMVALGSKTTS-EEVKRMMAELDRNGDGYIDLKEFG  62

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGDGR---ELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  118

Query  308  NNGDGFVCFEDFCRMM  261
             +GDG V FE+F +MM
Sbjct  119  ADGDGNVNFEEFKKMM  134



>dbj|BAJ88405.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL EF+
Sbjct  50   EMERVFRKFDANGDGRISRPELAALFESLG-HAATDDELSRMMAEADADGDGFISLAEFA  108

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L+ A A    + +LR AF  FD D  G ISA EL  V   +G+ + T++ CRRMI GVD
Sbjct  109  ALN-ATAAGDDEEDLRLAFKVFDADGSGAISAAELARVLHGLGE-KATVQQCRRMIEGVD  166

Query  308  NNGDGFVCFEDFCRMM  261
             NGDG + F++F  MM
Sbjct  167  KNGDGLISFDEFKVMM  182



>ref|XP_002968790.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
 gb|EFJ29906.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
Length=135

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = -1

Query  668  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  489
            EL Q F+ ID D DG+I  EEL A+L  +G   P   EL  +L  +D DGDG ISLEEF 
Sbjct  2    ELEQVFRSIDTDGDGRICLEELRAMLRLIGNANPDDTELLGLLRAIDSDGDGFISLEEF-  60

Query  488  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  309
             L +     S   +LR AF  FD D +G ISA+EL  V + +GD + T  +CRRMI GVD
Sbjct  61   -LRANDEGGSSADDLRAAFQVFDIDGNGFISADELHCVLQKMGD-KITKSECRRMIKGVD  118

Query  308  NNGDGFVCFEDFCRMM  261
            ++G+G V FE+F  MM
Sbjct  119  SDGNGLVDFEEFRIMM  134



>ref|XP_011075365.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=197

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 3/140 (2%)
 Frame = -1

Query  677  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  498
            +  EL Q FK  D + DGKI   EL +++  +G    + EELR M+  VD DGDG I L+
Sbjct  44   MEQELEQVFKKFDVNGDGKISALELGSIMGSLG-HSATEEELRTMIQGVDSDGDGHIDLQ  102

Query  497  EFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  321
            EF  L++           L+DAF  FD D +G ISAEEL +V + +G+  CTL +CR+MI
Sbjct  103  EFIELNTKDVDYDEVLQNLKDAFQVFDIDKNGSISAEELQDVLQNLGE-ECTLAECRKMI  161

Query  320  LGVDNNGDGFVCFEDFCRMM  261
             GVD +G+G + F++F  MM
Sbjct  162  SGVDTDGNGAISFDEFKVMM  181



>gb|KJB60897.1| hypothetical protein B456_009G330300 [Gossypium raimondii]
Length=185

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 100/169 (59%), Gaps = 12/169 (7%)
 Frame = -1

Query  758  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  579
            K+    +TPTS         S  +L     EL Q F  +D + DGKI   EL +++  + 
Sbjct  12   KQNSTSNTPTSTASPSTRSSSQTQLQ----ELEQIFNKLDVNGDGKISLSELGSIMGSLA  67

Query  578  AEPPSREELRLMLSEVDRD-GDGCISLEEFSVLSSAFAPPSCDSE--LRDAFDFFDTDHD  408
             +  S+EEL+ M+ E + D GDG ++ ++F  L++       +SE  L+DAF  +D + +
Sbjct  68   QKHQSKEELQKMMKEFNADYGDGFMNFDQFVELNT----KGVESEEVLKDAFSVYDRNGN  123

Query  407  GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  261
            G ISAEEL  V K++GD  C++E+CR+MI GVDN+G+G + F++F  MM
Sbjct  124  GWISAEELQEVLKSLGD-ECSIEECRKMISGVDNDGNGMIDFQEFKVMM  171


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  665  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  486
            L  AF + DR+ +G I  EEL+ +L  +G E  S EE R M+S VD DG+G I  +EF V
Sbjct  111  LKDAFSVYDRNGNGWISAEELQEVLKSLGDEC-SIEECRKMISGVDNDGNGMIDFQEFKV  169

Query  485  LSSA  474
            +  A
Sbjct  170  MMVA  173



>ref|XP_010908206.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=186

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 84/142 (59%), Gaps = 3/142 (2%)
 Frame = -1

Query  683  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  504
            +G+  EL + FK  D + DGKI   EL A+   +G  P + EEL  M+ E D DGDG IS
Sbjct  34   AGVTDELERVFKKFDTNGDGKISSSELAAIFQSLG-HPVTDEELERMMGEADTDGDGFIS  92

Query  503  LEEFSVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  327
             +EF  L+      S   E LR AF  FD D +G ISA+EL  V ++IG+   ++  C+R
Sbjct  93   FDEFVDLNVRTVDDSAALEDLRQAFSVFDLDRNGSISADELARVLRSIGEG-ASVAQCKR  151

Query  326  MILGVDNNGDGFVCFEDFCRMM  261
            MI GVD +GDG + FE+F  MM
Sbjct  152  MIDGVDRDGDGLISFEEFRLMM  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260