BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040J22

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              409   4e-142   Solanum lycopersicum
emb|CAJ38386.1|  alpha tubulin                                          410   2e-141   Plantago major [cart-track plant]
gb|AHM93474.1|  alpha-tubulin                                           411   3e-141   Camellia chekiangoleosa
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               407   4e-141   Erythranthe guttata [common monkey flower]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    409   3e-140   Gossypium raimondii
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            403   8e-140   
gb|EPS62716.1|  alpha-tubulin                                           410   1e-139   Genlisea aurea
gb|AHJ80819.1|  Tua1                                                    404   2e-139   Eragrostis tef [tef]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    407   2e-139   Gossypium raimondii
gb|AAW57310.1|  alpha-tubulin                                           404   3e-139   Ceratopteris richardii
gb|AAW57309.1|  alpha-tubulin                                           404   3e-139   Ceratopteris richardii
gb|AAW57305.1|  alpha-tubulin                                           405   3e-139   Ceratopteris richardii
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     410   3e-139   Nicotiana tomentosiformis
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     410   3e-139   Nicotiana sylvestris
emb|CAD13176.1|  alpha-tubulin                                          410   3e-139   Nicotiana tabacum [American tobacco]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     410   4e-139   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              410   4e-139   Nicotiana tomentosiformis
gb|ABB02631.1|  unknown                                                 410   4e-139   Solanum tuberosum [potatoes]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              410   4e-139   Solanum lycopersicum
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   410   4e-139   Nicotiana tomentosiformis
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                410   4e-139   Solanum tuberosum [potatoes]
gb|ACH68563.1|  alpha-tubulin                                           410   5e-139   Solanum tuberosum [potatoes]
gb|ABP65320.1|  alpha tubulin                                           410   5e-139   Capsicum annuum
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              410   5e-139   
gb|ABC59068.2|  alpha tubulin 1                                         409   8e-139   Camellia sinensis [black tea]
ref|WP_039310890.1|  hypothetical protein                               409   9e-139   
emb|CAA52158.1|  alpha tubulin                                          402   1e-138   Zea mays [maize]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                409   2e-138   Erythranthe guttata [common monkey flower]
dbj|BAH19954.1|  AT1G50010                                              401   2e-138   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB19779.1|  alpha tubulin                                          409   2e-138   Nicotiana tabacum [American tobacco]
emb|CAB76917.1|  alpha-tubulin 4                                        402   2e-138   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001275271.1|  alpha-tubulin-like protein                         409   2e-138   Solanum tuberosum [potatoes]
ref|NP_001291325.1|  tubulin alpha chain-like                           409   2e-138   Sesamum indicum [beniseed]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     408   2e-138   Sesamum indicum [beniseed]
gb|AFR42026.1|  alpha-tubulin                                           399   2e-138   Populus trichocarpa [western balsam poplar]
emb|CDP02221.1|  unnamed protein product                                408   2e-138   Coffea canephora [robusta coffee]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   405   3e-138   Citrus sinensis [apfelsine]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       407   3e-138   Cucumis sativus [cucumbers]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    407   3e-138   Gossypium raimondii
gb|AFR42020.1|  alpha-tubulin                                           398   3e-138   Populus trichocarpa [western balsam poplar]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                408   4e-138   Solanum lycopersicum
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                407   4e-138   Nicotiana tomentosiformis
gb|AFW67749.1|  alpha tubulin4                                          402   8e-138   
gb|KIY91712.1|  Tubulin alpha chain                                     399   9e-138   Monoraphidium neglectum
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            403   1e-137   Oryza sativa Japonica Group [Japonica rice]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                405   1e-137   Erythranthe guttata [common monkey flower]
gb|AAW57306.1|  alpha-tubulin                                           399   1e-137   Ceratopteris richardii
gb|AFR42035.1|  alpha-tubulin                                           397   2e-137   Populus alba [abele]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   405   2e-137   Citrus sinensis [apfelsine]
gb|ADW83724.1|  alpha-tubulin                                           405   2e-137   Musa acuminata AAA Group [Cavendish banana]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     405   2e-137   Vitis vinifera
gb|AFW67748.1|  alpha tubulin4                                          403   2e-137   
ref|NP_001289660.1|  tubulin alpha chain-like                           406   2e-137   Eucalyptus grandis [rose gum]
gb|ABX57816.1|  alpha tubulin                                           406   2e-137   Picea wilsonii
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                406   2e-137   Cucumis sativus [cucumbers]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             406   2e-137   Citrus clementina [clementine]
gb|KHG18997.1|  Tubulin alpha chain                                     405   2e-137   Gossypium arboreum [tree cotton]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              406   2e-137   Medicago truncatula
gb|ABO47736.1|  alpha-tubulin                                           405   2e-137   Gossypium hirsutum [American cotton]
gb|AAV92352.1|  alpha tubulin 1                                         405   3e-137   Pseudotsuga menziesii var. menziesii
ref|XP_007018369.1|  Tubulin alpha-2 chain                              405   3e-137   Theobroma cacao [chocolate]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                405   3e-137   Pyrus x bretschneideri [bai li]
gb|ABO47740.1|  alpha-tubulin                                           405   3e-137   Gossypium hirsutum [American cotton]
gb|AFR42049.1|  alpha-tubulin                                           396   3e-137   Populus fremontii
gb|ABO47739.1|  alpha-tubulin                                           405   3e-137   Gossypium hirsutum [American cotton]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              405   3e-137   
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             405   3e-137   Citrus clementina [clementine]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                405   3e-137   Elaeis guineensis
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     405   3e-137   Eucalyptus grandis [rose gum]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    405   3e-137   Gossypium hirsutum [American cotton]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   405   3e-137   Fragaria vesca subsp. vesca
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     405   3e-137   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     405   3e-137   Pyrus x bretschneideri [bai li]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         405   3e-137   Jatropha curcas
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                405   3e-137   Nelumbo nucifera [Indian lotus]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    405   3e-137   Citrus sinensis [apfelsine]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                405   3e-137   Cucumis sativus [cucumbers]
ref|XP_010093625.1|  Tubulin alpha chain                                405   3e-137   Morus notabilis
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          405   3e-137   Malus domestica [apple tree]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             405   3e-137   Prunus persica
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     405   3e-137   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     405   3e-137   Phoenix dactylifera
ref|XP_001764722.1|  predicted protein                                  405   3e-137   
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          405   3e-137   Tarenaya hassleriana [spider flower]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                405   3e-137   Phoenix dactylifera
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         405   3e-137   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           405   3e-137   Betula pendula [white birch]
gb|AIX10966.1|  tubulin                                                 405   3e-137   Ornithogalum longebracteatum [sea-onion]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   405   3e-137   Nelumbo nucifera [Indian lotus]
ref|XP_002510010.1|  tubulin alpha chain, putative                      405   3e-137   Ricinus communis
ref|XP_002522104.1|  tubulin alpha chain, putative                      405   3e-137   Ricinus communis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                405   3e-137   Prunus dulcis [sweet almond]
gb|AID52921.1|  tubulin alpha chain                                     405   4e-137   Carthamus tinctorius
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             405   4e-137   Selaginella moellendorffii
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Elaeis guineensis
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Tarenaya hassleriana [spider flower]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     405   4e-137   Cucumis melo [Oriental melon]
gb|ACN40181.1|  unknown                                                 405   4e-137   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     405   4e-137   Vitis vinifera
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               405   4e-137   Pisum sativum [garden pea]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                405   4e-137   Vitis vinifera
gb|AHJ80823.1|  Tua1                                                    405   4e-137   Eragrostis tef [tef]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Elaeis guineensis
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Nelumbo nucifera [Indian lotus]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Tarenaya hassleriana [spider flower]
ref|XP_008621874.1|  tubulin alpha                                      399   4e-137   Saprolegnia diclina VS20
ref|XP_007042689.1|  Tubulin alpha-2 chain                              405   4e-137   Theobroma cacao [chocolate]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              405   4e-137   Cucumis sativus [cucumbers]
ref|XP_010099392.1|  Tubulin alpha chain                                405   4e-137   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                405   4e-137   Cicer arietinum [garbanzo]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     405   5e-137   Vitis vinifera
gb|AGG37283.1|  alpha-tubulin 1                                         405   5e-137   Salix arbutifolia
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        405   5e-137   Cucumis melo [Oriental melon]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        405   5e-137   Glycine max [soybeans]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             405   5e-137   Phaseolus vulgaris [French bean]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         405   5e-137   Jatropha curcas
ref|XP_003603670.1|  Tubulin alpha-7 chain                              405   5e-137   Medicago truncatula
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             405   5e-137   Prunus persica
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             405   6e-137   Populus trichocarpa [western balsam poplar]
ref|XP_002959708.1|  alpha tubulin                                      397   6e-137   Volvox carteri f. nagariensis
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             405   6e-137   Anemia phyllitidis
gb|AGG37289.1|  alpha-tubulin 7                                         405   6e-137   Salix arbutifolia
gb|KHN08201.1|  Tubulin alpha chain                                     405   6e-137   Glycine soja [wild soybean]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    405   6e-137   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          405   6e-137   Miscanthus sinensis
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                405   7e-137   Fragaria vesca subsp. vesca
dbj|BAJ06362.1|  alpha-tubulin                                          405   7e-137   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   405   7e-137   Brachypodium distachyon [annual false brome]
ref|NP_001167663.1|  tubulin alpha-3 chain                              405   7e-137   Zea mays [maize]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     405   7e-137   Populus euphratica
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              405   7e-137   Setaria italica
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                404   7e-137   Phoenix dactylifera
gb|AIX10773.1|  alpha tubulin                                           404   7e-137   Panax notoginseng [san-qi]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   404   7e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|AHJ80815.1|  Tua1                                                    404   7e-137   Eragrostis tef [tef]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              404   8e-137   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   404   8e-137   Zea mays [maize]
gb|AEQ75493.1|  alpha-tubulin                                           404   8e-137   Rosa multiflora [Japanese rose]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              404   8e-137   Oryza brachyantha
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             404   8e-137   
gb|AFR42036.1|  alpha-tubulin                                           395   9e-137   Populus alba [abele]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              404   9e-137   Oryza brachyantha
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             404   9e-137   Prunus persica
gb|ABO47742.1|  alpha-tubulin                                           404   9e-137   Gossypium hirsutum [American cotton]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              404   9e-137   Fragaria vesca subsp. vesca
gb|ABK92520.1|  unknown                                                 404   1e-136   Populus trichocarpa [western balsam poplar]
gb|AFR42054.1|  alpha-tubulin                                           395   1e-136   Populus fremontii
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 404   1e-136   Populus trichocarpa [western balsam poplar]
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          404   1e-136   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        404   1e-136   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG37285.1|  alpha-tubulin 3                                         404   1e-136   Salix arbutifolia
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     404   1e-136   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             404   1e-136   Hordeum vulgare [barley]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          404   1e-136   Citrus sinensis [apfelsine]
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              403   1e-136   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA51109.1|  TPA: alpha tubulin                                     404   1e-136   
gb|ABQ59633.1|  alpha-tubulin 3                                         404   1e-136   Populus tremuloides
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   404   1e-136   Malus domestica [apple tree]
ref|XP_002517492.1|  tubulin alpha chain, putative                      404   1e-136   Ricinus communis
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   404   1e-136   Populus euphratica
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              404   1e-136   Oryza brachyantha
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     404   1e-136   Glycine max [soybeans]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             404   1e-136   Phaseolus vulgaris [French bean]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    404   1e-136   Glycine max [soybeans]
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   404   1e-136   Citrus sinensis [apfelsine]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   404   1e-136   Citrus sinensis [apfelsine]
gb|AAB36609.1|  alpha-tubulin                                           401   1e-136   Eucalyptus globulus subsp. bicostata
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             404   1e-136   Prunus persica
ref|XP_010104543.1|  Tubulin alpha chain                                404   1e-136   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    404   1e-136   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                404   1e-136   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH43997.1|  tubulin beta-1 chain                                    404   1e-136   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                404   1e-136   Cicer arietinum [garbanzo]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              404   1e-136   Populus euphratica
gb|KHN42598.1|  Tubulin alpha-2 chain                                   404   1e-136   Glycine soja [wild soybean]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    404   1e-136   Gossypium hirsutum [American cotton]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              404   1e-136   Glycine max [soybeans]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    404   1e-136   Glycine max [soybeans]
dbj|BAG99724.1|  unnamed protein product                                402   1e-136   Oryza sativa Japonica Group [Japonica rice]
gb|AAO73546.1|  alpha-tubulin                                           404   1e-136   Ceratopteris richardii
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                404   2e-136   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             404   2e-136   Phaseolus vulgaris [French bean]
gb|ABD92930.1|  alpha tubulin-2A                                        404   2e-136   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             404   2e-136   Hordeum vulgare [barley]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             404   2e-136   
ref|XP_007515802.1|  alpha-tubulin                                      402   2e-136   Bathycoccus prasinos
gb|AAB08791.1|  alpha tubulin                                           403   2e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO97305.1|  unnamed protein product                                403   3e-136   Coffea canephora [robusta coffee]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             403   3e-136   Selaginella moellendorffii
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    403   3e-136   Tarenaya hassleriana [spider flower]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             403   3e-136   Eutrema salsugineum [saltwater cress]
dbj|BAC24800.1|  alpha tubulin                                          403   3e-136   Physcomitrella patens
gb|ABL61201.1|  alpha-tubulin                                           397   4e-136   Oxymonadida environmental sample
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     403   4e-136   Sesamum indicum [beniseed]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             403   4e-136   Capsella rubella
emb|CAB66336.1|  alpha-tubulin                                          403   4e-136   Betula pendula [white birch]
gb|AFR42042.1|  alpha-tubulin                                           393   4e-136   Populus fremontii
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   402   4e-136   Vitis vinifera
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                402   4e-136   Eucalyptus grandis [rose gum]
dbj|BAP59012.1|  alpha tubulin                                          402   4e-136   Taxus cuspidata [ichii]
ref|XP_010096739.1|  Tubulin alpha chain                                402   5e-136   
gb|AEW46684.1|  beta-tubulin                                            402   5e-136   Ulva linza
gb|ABQ59634.1|  alpha-tubulin 5                                         402   5e-136   Populus tremuloides
gb|ACU20294.1|  unknown                                                 398   5e-136   Glycine max [soybeans]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                402   5e-136   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO46127.1|  alpha-tubulin                                           395   6e-136   Streblomastix strix
gb|KHG20487.1|  Tubulin alpha chain                                     402   6e-136   Gossypium arboreum [tree cotton]
emb|CAA06619.1|  alpha-tubulin 1                                        402   6e-136   Eleusine indica [crabgrass]
gb|AGG37287.1|  alpha-tubulin 5                                         402   6e-136   Salix arbutifolia
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             402   6e-136   Populus trichocarpa [western balsam poplar]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              404   6e-136   
ref|XP_011398411.1|  Tubulin alpha chain                                400   7e-136   Auxenochlorella protothecoides
emb|CAA62916.1|  alpha-tubulin                                          402   7e-136   Oryza sativa Japonica Group [Japonica rice]
gb|AHJ80817.1|  Tua1                                                    402   7e-136   Eragrostis tef [tef]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    402   8e-136   Gossypium hirsutum [American cotton]
gb|ABL61216.1|  alpha-tubulin                                           397   8e-136   Oxymonadida environmental sample
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                402   9e-136   Populus euphratica
gb|ACK76232.1|  alpha-tubulin                                           401   1e-135   Dimocarpus longan [longan]
gb|ABV55999.1|  alpha-tubulin 7                                         401   1e-135   Populus tremuloides
emb|CDY29334.1|  BnaA05g16010D                                          400   1e-135   Brassica napus [oilseed rape]
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   401   1e-135   Monoraphidium neglectum
ref|NP_001051132.1|  Os03g0726100                                       401   1e-135   
gb|ACU19580.1|  unknown                                                 401   1e-135   Glycine max [soybeans]
emb|CAD20821.1|  alpha tubulin                                          395   1e-135   Zea mays [maize]
emb|CDY66630.1|  BnaCnng51680D                                          400   2e-135   Brassica napus [oilseed rape]
gb|ABL61215.1|  alpha-tubulin                                           396   2e-135   Oxymonadida environmental sample
dbj|BAJ06364.1|  alpha-tubulin                                          401   2e-135   Alopecurus aequalis
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              401   2e-135   Brachypodium distachyon [annual false brome]
gb|ABL61212.1|  alpha-tubulin                                           396   2e-135   Oxymonadida environmental sample
ref|NP_171974.1|  tubulin alpha-4 chain                                 401   2e-135   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ03400.1|  Tubulin alpha chain                                     401   2e-135   Monoraphidium neglectum
gb|ABD92937.1|  alpha tubulin-4A                                        400   2e-135   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        400   2e-135   Triticum aestivum [Canadian hard winter wheat]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    400   2e-135   Arabis alpina [alpine rockcress]
ref|XP_005851144.1|  alpha-tubulin                                      400   2e-135   Chlorella variabilis
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          400   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              400   2e-135   
gb|AFK33477.1|  unknown                                                 397   2e-135   Lotus japonicus
gb|ADJ00012.1|  tubulin alpha chain                                     392   3e-135   Chromera velia
gb|AFR42047.1|  alpha-tubulin                                           391   3e-135   Populus fremontii
gb|ABL61202.1|  alpha-tubulin                                           395   3e-135   Oxymonadida environmental sample
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        400   3e-135   Camelina sativa [gold-of-pleasure]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             400   3e-135   Arabidopsis thaliana [mouse-ear cress]
gb|ETM52928.1|  tubulin alpha chain                                     398   3e-135   Phytophthora parasitica
ref|NP_193232.1|  tubulin alpha-6 chain                                 400   3e-135   Arabidopsis thaliana [mouse-ear cress]
gb|ABL61224.1|  alpha-tubulin                                           395   3e-135   Oxymonadida environmental sample
gb|ABR25510.1|  tubulin alpha-1 chain                                   393   3e-135   Oryza sativa Indica Group [Indian rice]
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     400   4e-135   Helicosporidium sp. ATCC 50920
gb|AAO46130.1|  alpha-tubulin                                           392   4e-135   Streblomastix strix
gb|KJB29387.1|  hypothetical protein B456_005G097800                    400   4e-135   Gossypium raimondii
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    400   4e-135   Brassica rapa
gb|ABL61219.1|  alpha-tubulin                                           395   4e-135   Oxymonadida environmental sample
ref|XP_002508010.1|  alpha tubulin 2                                    400   4e-135   Micromonas commoda
ref|XP_005643073.1|  tubulin alpha chain                                400   4e-135   Coccomyxa subellipsoidea C-169
ref|XP_005651460.1|  tubulin alpha chain                                400   5e-135   Coccomyxa subellipsoidea C-169
gb|ABK92552.1|  unknown                                                 400   5e-135   Populus trichocarpa [western balsam poplar]
ref|XP_001777110.1|  predicted protein                                  396   5e-135   
gb|ABG78593.1|  alpha-tubulin                                           400   6e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770881.1|  predicted protein                                  400   6e-135   
ref|NP_001067613.1|  Os11g0247300                                       400   6e-135   
gb|ABL61203.1|  alpha-tubulin                                           394   7e-135   Oxymonadida environmental sample
ref|XP_003058621.1|  alpha tubulin                                      399   7e-135   Micromonas pusilla CCMP1545
gb|AAO46128.1|  alpha-tubulin                                           392   7e-135   Streblomastix strix
gb|ABL61217.1|  alpha-tubulin                                           394   8e-135   Oxymonadida environmental sample
gb|EJY81124.1|  Alpha tubulin,putative                                  399   8e-135   Oxytricha trifallax
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                399   8e-135   Oxytricha granulifera
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  399   8e-135   Ostreococcus tauri
emb|CDW82295.1|  alpha tubulin                                          399   8e-135   Stylonychia lemnae
gb|ABL61213.1|  alpha-tubulin                                           394   8e-135   Oxymonadida environmental sample
gb|AAT09063.1|  alpha tubulin 1                                         399   8e-135   Bigelowiella natans
emb|CAL35827.1|  alpha-2 tubulin                                        392   8e-135   Plantago major [cart-track plant]
gb|ABL61227.1|  alpha-tubulin                                           394   9e-135   Oxymonadida environmental sample
emb|CDP12358.1|  unnamed protein product                                399   1e-134   Coffea canephora [robusta coffee]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    399   1e-134   Glycine max [soybeans]
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                400   1e-134   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              399   1e-134   Camelina sativa [gold-of-pleasure]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   399   1e-134   Brassica rapa
gb|ETW27380.1|  tubulin alpha chain                                     394   1e-134   Plasmodium falciparum FCH/4
gb|KHN01709.1|  Tubulin alpha chain                                     399   1e-134   Glycine soja [wild soybean]
ref|XP_002782100.1|  Tubulin alpha chain, putative                      394   1e-134   
ref|XP_001419217.1|  predicted protein                                  399   1e-134   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           399   1e-134   
gb|ABL61214.1|  alpha-tubulin                                           394   1e-134   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              399   2e-134   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           399   2e-134   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             399   2e-134   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    390   2e-134   
gb|ABL61226.1|  alpha-tubulin                                           393   2e-134   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  398   2e-134   
emb|CDJ60085.1|  tubulin alpha chain, putative                          397   2e-134   
gb|ABL61204.1|  alpha-tubulin                                           392   2e-134   
gb|EPR58771.1|  alpha tubulin TUBA1                                     397   2e-134   
gb|ABL61218.1|  alpha-tubulin                                           393   3e-134   
ref|XP_002951007.1|  alpha tubulin                                      398   3e-134   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             398   3e-134   
ref|XP_007512064.1|  alpha-tubulin                                      398   3e-134   
gb|EWC76931.1|  tubulin alpha chain                                     393   3e-134   
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              391   3e-134   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              398   3e-134   
gb|AAO46126.1|  alpha-tubulin                                           390   4e-134   
gb|ABO47737.1|  alpha-tubulin                                           397   4e-134   
emb|CAE52514.1|  alpha tubulin                                          397   4e-134   
gb|ABU93324.1|  tubulin alpha subunit                                   397   4e-134   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           398   4e-134   
gb|AHJ80816.1|  Tua1                                                    397   4e-134   
emb|CAA62917.1|  alfa-tubulin                                           397   4e-134   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           397   5e-134   
ref|XP_002675196.1|  alpha-tubulin                                      397   5e-134   
emb|CDJ53173.1|  tubulin alpha chain, putative                          397   5e-134   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             396   6e-134   
emb|CDI81818.1|  tubulin alpha chain, putative                          397   6e-134   
ref|XP_002364807.1|  tubulin alpha chain                                397   6e-134   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                397   6e-134   
gb|AEF79970.1|  alpha-tubulin protein                                   397   6e-134   
gb|AAT09064.1|  alpha tubulin 2                                         397   6e-134   
gb|ETM30643.1|  tubulin alpha chain                                     397   6e-134   
gb|ABL61086.1|  alpha-tubulin                                           392   6e-134   
gb|ADP08782.1|  alpha tubulin                                           397   6e-134   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             397   7e-134   
gb|ABP65323.1|  alpha tubulin                                           397   7e-134   
emb|CCD11782.1|  unnamed protein product                                390   8e-134   
emb|CDJ42547.1|  tubulin alpha chain, putative                          397   8e-134   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             397   8e-134   
gb|ETM52951.1|  tubulin alpha chain                                     397   8e-134   
gb|ABU93323.1|  tubulin alpha subunit                                   397   9e-134   
ref|XP_008872990.1|  tubulin alpha chain                                397   9e-134   
ref|XP_002904194.1|  alpha-tubulin                                      397   9e-134   
ref|XP_009842456.1|  tubulin alpha chain                                397   9e-134   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    392   9e-134   
ref|XP_001691876.1|  alpha tubulin 1                                    397   9e-134   
emb|CBH08958.1|  alpha tubulin, (fragment)                              391   9e-134   
ref|XP_002904195.1|  alpha-tubulin, putative                            397   1e-133   
emb|CCI41153.1|  unnamed protein product                                397   1e-133   
ref|XP_008900864.1|  tubulin alpha chain                                397   1e-133   
gb|ABL61228.1|  alpha-tubulin                                           391   1e-133   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 396   1e-133   
gb|AAZ23863.1|  alpha-tubulin                                           396   1e-133   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                396   1e-133   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             396   1e-133   
dbj|BAH20267.1|  AT5G19780                                              390   1e-133   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    391   1e-133   
gb|AAD11425.1|  alpha tubulin                                           393   1e-133   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    394   2e-133   
gb|AHJ80821.1|  Tua3                                                    394   2e-133   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   394   2e-133   
gb|ABL61205.1|  alpha-tubulin                                           395   2e-133   
gb|ABL61209.1|  alpha-tubulin                                           395   2e-133   
gb|ABL61208.1|  alpha-tubulin                                           395   2e-133   
gb|ABL61210.1|  alpha-tubulin                                           395   2e-133   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             395   2e-133   
gb|EKF29047.1|  epsilon tubulin, putative                               388   2e-133   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             395   2e-133   
gb|ABL61206.1|  alpha-tubulin                                           395   3e-133   
gb|EKF28172.1|  epsilon tubulin, putative                               388   3e-133   
gb|ETO82054.1|  tubulin alpha chain                                     395   3e-133   
gb|ETW61813.1|  tubulin alpha chain                                     393   3e-133   
gb|AEG74028.1|  alpha-tubulin                                           395   3e-133   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     393   3e-133   
gb|EPY33355.1|  tubulin alpha                                           390   3e-133   
gb|ETM53018.1|  tubulin alpha chain                                     388   4e-133   
ref|XP_001777081.1|  predicted protein                                  395   4e-133   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 395   4e-133   
gb|AAU10519.1|  alpha tubulin                                           387   4e-133   
gb|ACN40824.1|  unknown                                                 395   4e-133   
emb|CAA61255.1|  alpha tubulin                                          395   4e-133   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             395   4e-133   
gb|AAX63396.1|  alpha-tubulin                                           394   4e-133   
gb|AAB86649.1|  alpha-tubulin                                           395   4e-133   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   395   4e-133   
emb|CDP00974.1|  unnamed protein product                                395   4e-133   
gb|AHJ80820.1|  Tua3                                                    393   5e-133   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             390   5e-133   
ref|XP_001782790.1|  predicted protein                                  395   5e-133   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              395   5e-133   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              395   5e-133   
gb|AAB86648.1|  alpha-tubulin                                           395   5e-133   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              394   6e-133   
emb|CAL80740.1|  alpha-tubulin                                          395   6e-133   
gb|ABU93321.1|  tubulin alpha subunit                                   394   6e-133   
gb|EUT86396.1|  tubulin alpha chain                                     392   7e-133   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          394   7e-133   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         393   7e-133   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      393   8e-133   
gb|ETW20218.1|  tubulin alpha chain                                     393   8e-133   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              394   8e-133   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             394   8e-133   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   394   8e-133   
gb|ABC97356.1|  alpha tubulin                                           394   9e-133   
emb|CDP17586.1|  unnamed protein product                                394   9e-133   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   394   1e-132   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              394   1e-132   
ref|XP_008877307.1|  tubulin alpha chain                                391   1e-132   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                394   1e-132   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              394   1e-132   
dbj|BAJ98211.1|  predicted protein                                      394   1e-132   
gb|AHJ80822.1|  Tua1                                                    394   1e-132   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             394   1e-132   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                394   1e-132   
gb|ETW45898.1|  tubulin alpha chain                                     392   1e-132   
gb|ETP23198.1|  tubulin alpha chain                                     391   1e-132   
gb|ETW56906.1|  tubulin alpha chain                                     392   1e-132   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              394   1e-132   
gb|ABD92942.1|  alpha tubulin-1D                                        394   1e-132   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             394   1e-132   
gb|AAO23139.1|  alpha tubulin                                           394   2e-132   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              394   2e-132   
ref|XP_001427643.1|  hypothetical protein                               386   2e-132   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   
emb|CAD26891.1|  alpha-tubulin                                          394   2e-132   
ref|NP_001105324.1|  tubulin alpha-5 chain                              394   2e-132   
dbj|BAJ06363.1|  alpha-tubulin                                          394   2e-132   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    394   2e-132   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   394   2e-132   
gb|AGY80453.1|  tubulin                                                 393   2e-132   
ref|NP_001060075.1|  Os07g0574800                                       393   2e-132   
ref|NP_001105588.1|  tubulin alpha-6 chain                              393   2e-132   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   393   2e-132   
ref|XP_001420620.1|  predicted protein                                  393   2e-132   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    393   2e-132   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               389   2e-132   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              393   2e-132   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             393   2e-132   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              393   2e-132   
emb|CAD24765.1|  alpha-tubulin                                          393   2e-132   
gb|ETW57405.1|  tubulin alpha chain                                     392   2e-132   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     393   2e-132   
gb|AGD80034.1|  alpha-tubulin 1                                         393   2e-132   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              393   2e-132   
gb|ABB16994.1|  unknown                                                 394   2e-132   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   393   2e-132   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             393   2e-132   
gb|EPY40479.1|  tubulin alpha                                           385   3e-132   
ref|XP_002532068.1|  tubulin alpha chain, putative                      393   3e-132   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   393   3e-132   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             390   3e-132   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   393   3e-132   
gb|EPY39349.1|  tubulin alpha                                           387   3e-132   
gb|AGG37284.1|  alpha-tubulin 2                                         393   3e-132   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  392   3e-132   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                393   4e-132   
gb|ABO47741.1|  alpha-tubulin                                           392   4e-132   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      393   4e-132   
gb|ABO47735.1|  alpha-tubulin                                           392   4e-132   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              392   4e-132   
emb|CAD24768.1|  alpha-tubulin                                          392   4e-132   
ref|XP_008818311.1|  tubulin alpha chain                                392   4e-132   
gb|ACJ04933.1|  alpha tubulin                                           384   4e-132   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     393   4e-132   
ref|XP_001351526.1|  alpha-tubulin ii                                   392   4e-132   
ref|XP_001615123.1|  tubulin alpha chain                                392   5e-132   
gb|ETW30983.1|  tubulin alpha chain                                     394   5e-132   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              392   5e-132   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   392   5e-132   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             392   5e-132   
ref|XP_008625823.1|  tubulin alpha chain                                392   5e-132   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             392   5e-132   
gb|ETW38327.1|  tubulin alpha chain                                     392   5e-132   
ref|XP_004221286.1|  tubulin alpha chain                                392   5e-132   
emb|CAA65330.1|  alpha-tubulin                                          392   5e-132   
gb|EUD70907.1|  tubulin alpha chain                                     392   5e-132   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   392   6e-132   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   392   6e-132   
gb|ABR25378.1|  tubulin alpha 3 chain                                   383   6e-132   
ref|XP_002786953.1|  Tubulin alpha chain, putative                      392   7e-132   
gb|ABL61230.1|  alpha-tubulin                                           391   7e-132   
ref|XP_724313.1|  hypothetical protein                                  392   8e-132   
emb|CCW60849.1|  unnamed protein product                                389   8e-132   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              392   8e-132   
emb|CCA20146.1|  alpha tubulin 1 putative                               392   8e-132   
emb|CCI45804.1|  unnamed protein product                                392   8e-132   
gb|AGG37286.1|  alpha-tubulin 4                                         392   8e-132   
ref|XP_001614576.1|  tubulin alpha chain                                392   9e-132   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              392   9e-132   
emb|CDR11405.1|  alpha tubulin 1, putative                              392   9e-132   
ref|XP_002258308.1|  alpha tubulin                                      392   1e-131   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     391   1e-131   
ref|XP_001351911.1|  alpha tubulin                                      391   1e-131   
gb|KJB48791.1|  hypothetical protein B456_008G087400                    389   1e-131   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        391   1e-131   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   391   1e-131   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              391   1e-131   
emb|CAA65329.1|  alpha-tubulin                                          391   1e-131   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              391   1e-131   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              391   1e-131   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        391   1e-131   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   391   1e-131   
ref|XP_728879.1|  tubulin subunit alpha                                 391   1e-131   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              391   1e-131   
gb|ABR67425.1|  alpha-tubulin 4                                         391   2e-131   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   391   2e-131   
emb|CAD26887.1|  alpha-tubulin                                          391   2e-131   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                391   2e-131   
gb|EWM25815.1|  alpha tubulin 1                                         391   2e-131   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   389   2e-131   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             390   3e-131   
gb|EWC88756.1|  tubulin alpha chain                                     392   3e-131   
emb|CAD26886.1|  alpha-tubulin                                          390   3e-131   
gb|ETO12554.1|  hypothetical protein RFI_24821                          392   4e-131   
ref|XP_007014666.1|  Tubulin alpha-5                                    390   4e-131   
gb|AAO63773.2|  alpha-tubulin 2                                         390   4e-131   



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   409 bits (1052),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  13   SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  72

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  73   EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  132

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  133  YQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  192

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  193  EFSEAREDLAALEKDY  208



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  57   SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  116

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  117  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  176

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  177  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  236

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  237  EFSEAREDLAALEKDY  252



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  114  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  173

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  174  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  233

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  234  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  293

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  294  EFSEAREDLAALEKDY  309



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   407 bits (1045),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITN+AF
Sbjct  4    SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNTAF  63

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  64   EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  123

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  124  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  183

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  184  EFSEAREDLAALEKDY  199



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   409 bits (1051),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  127  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  186

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  187  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  246

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  247  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  306

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  307  EFSEAREDLAALEKDY  322



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   403 bits (1036),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  4    SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  63

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  64   EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  123

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  124  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  183

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  184  EFSEAREDLAALEKDY  199



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  191  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  250

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  251  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  310

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  311  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  370

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  371  EFSEAREDLAALEKDY  386



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   404 bits (1037),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  29   SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  88

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  89   EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  148

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  149  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  208

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  209  EFSEAREDLAALEKDY  224



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   407 bits (1047),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  148  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  207

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  208  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  267

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  268  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  327

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  328  EFSEAREDLAALEKDY  343



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   404 bits (1038),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  53   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  112

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  113  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  172

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEG
Sbjct  173  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEG  232

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  233  EFSEAREDLAALEKDY  248



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   404 bits (1037),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  52   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  111

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  112  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  171

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEG
Sbjct  172  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEG  231

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  232  EFSEAREDLAALEKDY  247



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   405 bits (1041),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  93   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  152

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  153  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  212

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEG
Sbjct  213  YQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEG  272

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  273  EFSEAREDLAALEKDY  288



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   410 bits (1055),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   410 bits (1054),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  236  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  295

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  296  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  355

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  356  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  415

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  416  EFSEAREDLAALEKDY  431



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   410 bits (1054),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   410 bits (1053),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/196 (99%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   409 bits (1052),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   409 bits (1052),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  241  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  300

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  301  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  360

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  361  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  420

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  421  EFSEAREDLAALEKDY  436



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   402 bits (1032),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  42   SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  101

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  102  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  161

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  162  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  221

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDL ALEKDY
Sbjct  222  EFSEAREDLRALEKDY  237



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   401 bits (1031),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  35   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  94

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  95   EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  154

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  155  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  214

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  215  EFSEAREDLAALEKDY  230



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   402 bits (1034),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  75   SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  134

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  135  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  194

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  195  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  254

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  255  EFSEAREDLAALEKDY  270



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/196 (98%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  238  SLTTSLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  297

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  298  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  357

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  358  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  417

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  418  EFSEAREDLAALEKDY  433



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   399 bits (1024),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  715  ASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  536
            ASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
Sbjct  1    ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  60

Query  535  SMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  356
            SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
Sbjct  61   SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  120

Query  355  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFS  176
            PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFS
Sbjct  121  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS  180

Query  175  EAREDLAALEKDY  137
            EAREDLAALEKDY
Sbjct  181  EAREDLAALEKDY  193



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   405 bits (1040),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  141  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  200

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  201  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  260

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  261  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  320

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  321  EFSEAREDLAALEKDY  336



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  202  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  261

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  262  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  321

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  322  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  381

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  382  EFSEAREDLAALEKDY  397



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  202  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  261

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  262  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  321

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  322  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  381

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  382  EFSEAREDLAALEKDY  397



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   398 bits (1023),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  715  ASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  536
            ASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
Sbjct  1    ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  60

Query  535  SMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  356
            SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
Sbjct  61   SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  120

Query  355  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFS  176
            PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFS
Sbjct  121  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS  180

Query  175  EAREDLAALEKDY  137
            EAREDLAALEKDY
Sbjct  181  EAREDLAALEKDY  193



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   408 bits (1048),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   407 bits (1047),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 192/196 (98%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   402 bits (1033),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  107  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  166

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  167  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  226

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  227  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  286

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  287  EFSEAREDLAALEKDY  302



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   399 bits (1026),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  35   SLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  94

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  95   EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGIN  154

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  155  YQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  214

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  215  EFSEAREDLAALEKDY  230



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  132  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  191

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  192  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  251

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  252  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEG  311

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  312  EFSEAREDLAALEKDY  327



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  203  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  262

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  263  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  322

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  323  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  382

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  383  EFSEAREDLAALEKDY  398



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   399 bits (1025),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  43   SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  102

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  103  EPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGIN  162

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  163  YQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  222

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKD+
Sbjct  223  EFSEAREDLAALEKDF  238



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   397 bits (1019),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -3

Query  712  SLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  533
            SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS
Sbjct  1    SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  60

Query  532  MMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  353
            MM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
Sbjct  61   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  120

Query  352  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSE  173
            TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSE
Sbjct  121  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  180

Query  172  AREDLAALEKDY  137
            AREDLAALEKDY
Sbjct  181  AREDLAALEKDY  192



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  218  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  277

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  278  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  337

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  338  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  397

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  398  EFSEAREDLAALEKDY  413



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   405 bits (1041),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  209  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  268

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  269  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  328

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  329  YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  388

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  389  EFSEAREDLAALEKDY  404



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  222  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  281

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  282  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  341

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  342  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  401

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  402  EFSEAREDLAALEKDY  417



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   403 bits (1035),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  150  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  209

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  210  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  269

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  270  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  329

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  330  EFSEAREDLAALEKDY  345



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVC ISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLARVQRAVCKISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   396 bits (1017),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  715  ASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  536
            ASLRFDGALNVDV EFQTNX PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
Sbjct  1    ASLRFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  60

Query  535  SMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  356
            SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
Sbjct  61   SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  120

Query  355  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFS  176
            PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFS
Sbjct  121  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS  180

Query  175  EAREDLAALEKDY  137
            EAREDLAALEKDY
Sbjct  181  EAREDLAALEKDY  193



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   399 bits (1024),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  57   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  116

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  117  EPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  176

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  177  YQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  236

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  237  EFSEAREDLAALEKDY  252



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   405 bits (1042),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  253  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  312

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  313  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  372

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  373  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  432

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  433  EFSEAREDLAALEKDY  448



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   405 bits (1041),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   405 bits (1041),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   405 bits (1041),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   397 bits (1021),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAP+ISAEKAYHEQLSVAEITN+AF
Sbjct  41   SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAF  100

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  101  EPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  160

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  161  YQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  220

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKD+
Sbjct  221  EFSEAREDLAALEKDF  236



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  242  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  301

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  302  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  361

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  362  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  421

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  422  EFSEAREDLAALEKDY  437



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   405 bits (1040),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   405 bits (1040),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 191/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEIT SAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITTSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   404 bits (1039),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   404 bits (1039),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   404 bits (1038),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  226  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  285

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  286  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  345

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  346  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  405

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  406  EFSEAREDLAALEKDY  421



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   404 bits (1039),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   404 bits (1039),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAF
Sbjct  240  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAF  299

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  300  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  359

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  360  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  419

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  420  EFSEAREDLAALEKDY  435



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   395 bits (1014),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 186/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = -3

Query  709  LRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM  530
            LRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM
Sbjct  1    LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM  60

Query  529  MVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPT  350
            M KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPT
Sbjct  61   MAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPT  120

Query  349  VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEA  170
            VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEA
Sbjct  121  VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEA  180

Query  169  REDLAALEKDY  137
            REDLAALEKDY
Sbjct  181  REDLAALEKDY  191



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEIT+SAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITSSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   395 bits (1014),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -3

Query  712  SLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  533
            SLRFDGALNVDV EFQTNX PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS
Sbjct  1    SLRFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  60

Query  532  MMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  353
            MM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
Sbjct  61   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  120

Query  352  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSE  173
            TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSE
Sbjct  121  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  180

Query  172  AREDLAALEKDY  137
            AREDLAALEKDY
Sbjct  181  AREDLAALEKDY  192



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  238  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  297

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  298  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  357

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  358  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  417

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  418  EFSEAREDLAALEKDY  433



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   403 bits (1035),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  202  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  261

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  262  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  321

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  322  YQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  381

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  382  EFSEAREDLAALEKDY  397



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  238  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  297

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  298  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  357

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  358  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  417

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  418  EFSEAREDLAALEKDY  433



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  233  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  292

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  293  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  352

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  353  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  412

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  413  EFSEAREDLAALEKDY  428



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   401 bits (1031),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAE TNSAF
Sbjct  167  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAETTNSAF  226

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSS+M KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  227  EPSSLMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  286

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  287  YQPPTVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  346

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  347  EFSEAREDLAALEKDY  362



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSS+APVISAEKAYHEQLSVAEITNSAF
Sbjct  234  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAF  293

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  294  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  353

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  354  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  413

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  414  EFSEAREDLAALEKDY  429



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  202  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  261

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  262  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  321

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  322  YQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  381

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  382  EFSEAREDLAALEKDY  397



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  239  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  298

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  299  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  358

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  359  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  418

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  419  EFSEAREDLAALEKDY  434



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  202  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  261

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGIN
Sbjct  262  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGIN  321

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  322  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  381

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  382  EFSEAREDLAALEKDY  397



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   403 bits (1036),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDG+LNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGSLNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDL+ VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLSGVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV+TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AF
Sbjct  237  SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKF LMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFGLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   397 bits (1020),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  85   SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  144

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  145  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  204

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  205  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  264

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  265  EFSEAREDLAALEKDY  280



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   403 bits (1035),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAP ISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPAISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   403 bits (1035),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   403 bits (1035),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   393 bits (1009),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -3

Query  706  RFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  527
            RFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM
Sbjct  1    RFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  60

Query  526  VKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  347
             KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV
Sbjct  61   AKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  120

Query  346  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAR  167
            VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAR
Sbjct  121  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAR  180

Query  166  EDLAALEKDY  137
            EDLAALEKDY
Sbjct  181  EDLAALEKDY  190



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   402 bits (1034),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   402 bits (1034),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   402 bits (1034),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   402 bits (1034),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSS+APVISAEKAYHEQLSVAEITNSAF
Sbjct  234  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAF  293

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  294  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  353

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  354  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  413

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  414  EFSEAREDLAALEKDY  429



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   402 bits (1034),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   402 bits (1034),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACU20294.1| unknown [Glycine max]
Length=339

 Score =   398 bits (1023),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSV EITNSAF
Sbjct  126  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVGEITNSAF  185

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPTGFKCGIN
Sbjct  186  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPTGFKCGIN  245

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  246  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  305

Query  184  EFSEAREDLAALEKDY  137
            +FSEAREDLAALEKDY
Sbjct  306  KFSEAREDLAALEKDY  321



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   402 bits (1034),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            E SSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  ETSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   395 bits (1014),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  36   SLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  95

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GIN
Sbjct  96   EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGIN  155

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  156  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  215

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  216  EFSEAREDLAALEKDY  231



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   402 bits (1034),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISA KAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   402 bits (1034),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SL ASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLIASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   402 bits (1033),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   402 bits (1033),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   404 bits (1038),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS F
Sbjct  287  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSTF  346

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  347  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  406

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  407  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  466

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  467  EFSEAREDLAALEKDY  482



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   400 bits (1028),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  181  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  240

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGIN
Sbjct  241  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGIN  300

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  301  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  360

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  361  EFSEAREDLAALEKDY  376



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   402 bits (1033),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   402 bits (1033),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQ N VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQANLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   402 bits (1033),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EF+TN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFRTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   397 bits (1019),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  100  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  159

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  160  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  219

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  220  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  279

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  280  EFSEAREDLAALEKDY  295



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   402 bits (1032),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/196 (97%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGA NVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGAPNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRRGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   400 bits (1029),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  218  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  277

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  278  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  337

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  338  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  397

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  398  EFSEAREDLAALEKDY  413



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDVNEFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EF EAREDLAALEKDY
Sbjct  417  EFFEAREDLAALEKDY  432



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   395 bits (1014),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGA+NVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ F
Sbjct  61   SLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVF  120

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGIN
Sbjct  121  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGIN  180

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  181  YQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  240

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  241  EFSEAREDLAALEKDY  256



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   396 bits (1017),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  100  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  159

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  160  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  219

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  220  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  279

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  280  EFSEAREDLAALEKDY  295



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   396 bits (1017),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  100  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  159

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  160  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  219

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  220  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  279

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  280  EFSEAREDLAALEKDY  295



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF
Sbjct  237  SLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRXGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AFK33477.1| unknown [Lotus japonicus]
Length=352

 Score =   397 bits (1020),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  139  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  198

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV +IKTKRTIQFVDWCPTGFKCGIN
Sbjct  199  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGSIKTKRTIQFVDWCPTGFKCGIN  258

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  259  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDVKFDLMYSKRAFVHWYVGEGMEEG  318

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  319  EFSEAREDLAALEKDY  334



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   392 bits (1008),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAP+ISAEKAYHEQLSVAEITNSAF
Sbjct  39   SLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAF  98

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACCLM+RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  99   EPANMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGIN  158

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKV RA CMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  159  YQPPTVVPGGDLAKVMRACCMISNSTAIAEVFSRMDHKFDLMYAKRAFVHWYVGEGMEEG  218

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  219  EFSEAREDLAALEKDY  234



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   391 bits (1004),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -3

Query  706  RFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  527
            RFDGALNVDV EFQTNX PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM
Sbjct  1    RFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  60

Query  526  VKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  347
             KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV
Sbjct  61   AKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  120

Query  346  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAR  167
            VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAR
Sbjct  121  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAR  180

Query  166  EDLAALEKDY  137
            EDLAALEKDY
Sbjct  181  EDLAALEKDY  190



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   395 bits (1014),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  85   SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  144

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  145  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  204

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KF+LMY KRAFVHWYVGEGMEEG
Sbjct  205  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFELMYAKRAFVHWYVGEGMEEG  264

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  265  EFSEAREDLAALEKDY  280



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   398 bits (1023),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  182  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  241

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  242  EPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  301

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  302  YQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  361

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  362  EFSEAREDLAALEKDY  377



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   400 bits (1028),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   395 bits (1015),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            S+TASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+F
Sbjct  100  SMTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSF  159

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  160  EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  219

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEG
Sbjct  220  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEG  279

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  280  EFSEAREDLAALEKDY  295



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   393 bits (1009),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLT SLRFDGA+NVDV EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ F
Sbjct  42   SLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVF  101

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGIN
Sbjct  102  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGIN  161

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  162  YQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  221

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  222  EFSEAREDLAALEKDY  237



>gb|KDD76276.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=450

 Score =   400 bits (1028),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF
Sbjct  237  SLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   392 bits (1008),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVD+ EFQTN VPYPRIHFMLSSY PVISAEKAYHEQLSVAEITNS+F
Sbjct  36   SLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYTPVISAEKAYHEQLSVAEITNSSF  95

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GIN
Sbjct  96   EPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGIN  155

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  156  YQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  215

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  216  EFSEAREDLAALEKDY  231



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   400 bits (1028),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  724  SLTASLRFDGALNVDVNEFQTNXVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF  545
            SLTASLRFDGALNVDV EFQTN VPYPRIHFMLSSYAPVISA KAYHEQLSVAEITN+AF
Sbjct  237  SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAF  296

Query  544  EPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  365
            EPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN
Sbjct  297  EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN  356

Query  364  YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEG  185
            YQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEG
Sbjct  357  YQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG  416

Query  184  EFSEAREDLAALEKDY  137
            EFSEAREDLAALEKDY
Sbjct  417  EFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455