BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040J11

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   5e-86   Nicotiana tomentosiformis
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    269   8e-86   Nicotiana sylvestris
ref|XP_006364961.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    269   1e-85   Solanum tuberosum [potatoes]
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   3e-85   Sesamum indicum [beniseed]
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   3e-85   Nicotiana tomentosiformis
emb|CAA06925.1|  Avr9 elicitor response protein                         270   3e-85   Nicotiana tabacum [American tobacco]
ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   4e-85   Nicotiana sylvestris
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                270   4e-85   Erythranthe guttata [common monkey flower]
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    269   1e-84   Solanum lycopersicum
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    269   1e-84   Solanum tuberosum [potatoes]
emb|CDP18301.1|  unnamed protein product                                266   1e-83   Coffea canephora [robusta coffee]
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   266   2e-83   Morus notabilis
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         264   9e-83   Jatropha curcas
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                263   1e-82   Erythranthe guttata [common monkey flower]
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        263   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    262   5e-82   Glycine max [soybeans]
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    262   6e-82   Glycine max [soybeans]
ref|XP_003601132.1|  Avr9 elicitor response protein                     261   2e-81   Medicago truncatula
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   2e-81   Cicer arietinum [garbanzo]
ref|XP_003601133.1|  Avr9 elicitor response protein                     261   2e-81   Medicago truncatula
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   2e-81   Cicer arietinum [garbanzo]
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                        259   2e-81   Glycine soja [wild soybean]
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   2e-81   Glycine max [soybeans]
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             260   2e-81   Phaseolus vulgaris [French bean]
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   2e-81   Pyrus x bretschneideri [bai li]
gb|EPS64555.1|  hypothetical protein M569_10226                         260   2e-81   Genlisea aurea
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   3e-81   Glycine max [soybeans]
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   3e-81   Fragaria vesca subsp. vesca
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                        258   3e-81   Glycine soja [wild soybean]
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   3e-81   Malus domestica [apple tree]
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   3e-81   Prunus mume [ume]
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   3e-81   Malus domestica [apple tree]
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    260   4e-81   Prunus mume [ume]
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    259   4e-81   Fragaria vesca subsp. vesca
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    259   4e-81   Prunus mume [ume]
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   4e-81   Malus domestica [apple tree]
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    259   4e-81   Prunus mume [ume]
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             259   4e-81   
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   4e-81   Elaeis guineensis
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   4e-81   Malus domestica [apple tree]
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   7e-81   Glycine max [soybeans]
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        259   8e-81   Glycine soja [wild soybean]
gb|KCW70545.1|  hypothetical protein EUGRSUZ_F03738                     256   9e-81   Eucalyptus grandis [rose gum]
gb|KJB64380.1|  hypothetical protein B456_010G046600                    256   1e-80   Gossypium raimondii
ref|XP_002302264.1|  galactosyltransferase family protein               258   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    258   2e-80   Populus euphratica
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    258   2e-80   Populus euphratica
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    258   2e-80   Populus euphratica
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    258   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        258   2e-80   Sesamum indicum [beniseed]
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    258   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    257   2e-80   Populus euphratica
gb|AFK45069.1|  unknown                                                 249   3e-80   Lotus japonicus
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        257   3e-80   Glycine max [soybeans]
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     256   4e-80   Eucalyptus grandis [rose gum]
gb|AFK48973.1|  unknown                                                 257   4e-80   Lotus japonicus
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    257   6e-80   Phoenix dactylifera
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    256   8e-80   Pyrus x bretschneideri [bai li]
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             256   8e-80   Phaseolus vulgaris [French bean]
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        256   1e-79   
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     256   1e-79   Ricinus communis
gb|ACF79671.1|  unknown                                                 256   1e-79   Zea mays [maize]
ref|NP_001131318.1|  uncharacterized protein LOC100192632               256   1e-79   
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    255   1e-79   Eucalyptus grandis [rose gum]
gb|KJB64379.1|  hypothetical protein B456_010G046600                    256   1e-79   Gossypium raimondii
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    255   1e-79   Eucalyptus grandis [rose gum]
gb|KJB64381.1|  hypothetical protein B456_010G046600                    256   1e-79   Gossypium raimondii
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    255   2e-79   Eucalyptus grandis [rose gum]
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    255   2e-79   Elaeis guineensis
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    255   2e-79   Eucalyptus grandis [rose gum]
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    256   3e-79   
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    255   3e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          254   4e-79   Gossypium arboreum [tree cotton]
ref|NP_001141176.1|  hypothetical protein                               251   6e-79   
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          254   6e-79   Amborella trichopoda
ref|XP_002306601.2|  galactosyltransferase family protein               254   7e-79   
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   9e-79   Setaria italica
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          253   1e-78   
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   1e-78   Cucumis melo [Oriental melon]
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   2e-78   Cucumis melo [Oriental melon]
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   2e-78   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       252   3e-78   Cucumis sativus [cucumbers]
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    252   3e-78   Oryza brachyantha
dbj|BAD17751.1|  putative avr9 elicitor response protein                252   3e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    252   3e-78   Vitis vinifera
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    252   3e-78   Vitis vinifera
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    252   4e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    251   5e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO80826.1|  hypothetical protein CISIN_1g015683mg                   248   5e-78   Citrus sinensis [apfelsine]
gb|ACG41551.1|  avr9 elicitor response protein                          251   5e-78   Zea mays [maize]
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         251   6e-78   
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    251   6e-78   Phoenix dactylifera
ref|XP_008778068.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    246   8e-78   Phoenix dactylifera
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        251   8e-78   Vitis vinifera
gb|ACJ84307.1|  unknown                                                 242   2e-77   Medicago truncatula
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    249   6e-77   Brachypodium distachyon [annual false brome]
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg             249   7e-77   Citrus clementina [clementine]
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                   249   7e-77   Citrus sinensis [apfelsine]
dbj|BAK03918.1|  predicted protein                                      249   8e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg             249   8e-77   Citrus clementina [clementine]
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                   249   8e-77   Citrus sinensis [apfelsine]
ref|NP_001141890.1|  hypothetical protein                               248   1e-76   Zea mays [maize]
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    248   2e-76   Citrus sinensis [apfelsine]
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    248   2e-76   Citrus sinensis [apfelsine]
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290          248   2e-76   
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410          248   3e-76   Amborella trichopoda
ref|XP_001779676.1|  predicted protein                                  247   4e-76   
ref|XP_006441805.1|  hypothetical protein CICLE_v10024512mg             247   4e-76   
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    247   4e-76   Nelumbo nucifera [Indian lotus]
ref|XP_002988781.1|  glycosyltransferase-like protein                   247   5e-76   Selaginella moellendorffii
ref|XP_004167799.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   5e-76   
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    246   6e-76   Elaeis guineensis
ref|XP_001781844.1|  predicted protein                                  245   6e-76   
ref|XP_009774684.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    242   8e-76   Nicotiana sylvestris
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360          246   1e-75   
ref|XP_006375531.1|  hypothetical protein POPTR_0014s15200g             243   1e-75   
ref|XP_011097092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    246   1e-75   Sesamum indicum [beniseed]
gb|ADE75915.1|  unknown                                                 241   1e-75   Picea sitchensis
ref|XP_006478362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    246   1e-75   
gb|ADE77778.1|  unknown                                                 243   1e-75   Picea sitchensis
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...    246   1e-75   Eucalyptus grandis [rose gum]
ref|XP_002970340.1|  glycosyltransferase-like protein                   245   1e-75   
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                    245   2e-75   Arabis alpina [alpine rockcress]
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    245   2e-75   Brachypodium distachyon [annual false brome]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    246   2e-75   Elaeis guineensis
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                    245   2e-75   Arabis alpina [alpine rockcress]
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 245   2e-75   Taraxacum brevicorniculatum
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    244   2e-75   Brassica rapa
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    244   2e-75   Brassica rapa
emb|CDX88390.1|  BnaC06g38340D                                          244   3e-75   
ref|XP_002968104.1|  glycosyltransferase-like protein                   244   3e-75   
gb|KDP39142.1|  hypothetical protein JCGZ_00899                         245   3e-75   Jatropha curcas
ref|XP_006660681.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    242   3e-75   
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   4e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006592811.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   5e-75   
ref|XP_002529902.1|  Beta-1,3-galactosyltransferase sqv-2, putative     239   5e-75   
ref|XP_001754566.1|  predicted protein                                  244   5e-75   
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   6e-75   Fragaria vesca subsp. vesca
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   6e-75   Fragaria vesca subsp. vesca
emb|CDP05735.1|  unnamed protein product                                244   7e-75   Coffea canephora [robusta coffee]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   7e-75   Cucumis melo [Oriental melon]
ref|NP_001063339.1|  Os09g0452900                                       243   7e-75   
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    244   7e-75   
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2          244   7e-75   Morus notabilis
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   7e-75   Cucumis sativus [cucumbers]
gb|KDP22716.1|  hypothetical protein JCGZ_01818                         241   7e-75   Jatropha curcas
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   8e-75   Eucalyptus grandis [rose gum]
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   8e-75   Eucalyptus grandis [rose gum]
ref|XP_009361001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   9e-75   Pyrus x bretschneideri [bai li]
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   9e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   1e-74   
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   1e-74   Phoenix dactylifera
emb|CAN63417.1|  hypothetical protein VITISV_007689                     242   1e-74   Vitis vinifera
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative     242   1e-74   
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    243   1e-74   Setaria italica
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg             243   1e-74   
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   1e-74   Populus euphratica
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Populus euphratica
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Fragaria vesca subsp. vesca
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Fragaria vesca subsp. vesca
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Solanum tuberosum [potatoes]
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Prunus mume [ume]
gb|KEH29682.1|  beta-1,3-galactosyltransferase-like protein             241   2e-74   Medicago truncatula
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g             243   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Prunus mume [ume]
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Nicotiana sylvestris
ref|XP_002320464.1|  galactosyltransferase family protein               243   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Nicotiana tomentosiformis
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...    243   2e-74   Malus domestica [apple tree]
ref|XP_006592810.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   2e-74   
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   2e-74   Malus domestica [apple tree]
ref|XP_006301157.1|  hypothetical protein CARUB_v10021555mg             242   3e-74   Capsella rubella
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   3e-74   Glycine max [soybeans]
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   3e-74   Nicotiana tomentosiformis
gb|KJB26942.1|  hypothetical protein B456_004G268200                    242   3e-74   Gossypium raimondii
ref|XP_006304048.1|  hypothetical protein CARUB_v10009858mg             239   3e-74   
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...    242   4e-74   Prunus mume [ume]
ref|NP_974164.2|  beta-1,3-galactosyltransferase 7                      241   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   5e-74   Cucumis sativus [cucumbers]
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   5e-74   Sesamum indicum [beniseed]
gb|AHL38868.1|  glycosyltransferase                                     241   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KDO54673.1|  hypothetical protein CISIN_1g015407mg                   238   6e-74   Citrus sinensis [apfelsine]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   6e-74   Pyrus x bretschneideri [bai li]
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   6e-74   Cicer arietinum [garbanzo]
ref|XP_002889162.1|  galactosyltransferase family protein               241   6e-74   
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg             241   6e-74   Prunus persica
ref|XP_009397181.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   6e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG51626.1|AC012193_8  putative (Avr9) elicitor response prote...    241   6e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg             241   7e-74   Prunus persica
ref|XP_006447567.1|  hypothetical protein CICLE_v10015443mg             238   7e-74   
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...    241   7e-74   Vitis vinifera
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   7e-74   Malus domestica [apple tree]
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2               241   7e-74   Glycine soja [wild soybean]
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   7e-74   Glycine max [soybeans]
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   7e-74   Glycine max [soybeans]
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   8e-74   Malus domestica [apple tree]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   8e-74   
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    241   8e-74   
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   8e-74   Elaeis guineensis
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   1e-73   Camelina sativa [gold-of-pleasure]
gb|ACL53751.1|  unknown                                                 241   1e-73   Zea mays [maize]
ref|NP_001149873.1|  LOC100283501                                       241   1e-73   
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   1e-73   Sesamum indicum [beniseed]
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg                241   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_002979099.1|  glycosyltransferase-like protein                   240   1e-73   
gb|KJB80505.1|  hypothetical protein B456_013G101400                    241   1e-73   Gossypium raimondii
gb|KJB80507.1|  hypothetical protein B456_013G101400                    241   1e-73   Gossypium raimondii
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   1e-73   Nicotiana sylvestris
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             240   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    241   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010428866.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    240   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_004970763.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   1e-73   
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Solanum tuberosum [potatoes]
ref|XP_004162968.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   2e-73   
ref|XP_002892271.1|  galactosyltransferase family protein               240   2e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010471981.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    240   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010471980.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    240   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g             239   2e-73   Phaseolus vulgaris [French bean]
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2             240   2e-73   
ref|XP_010428865.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    240   2e-73   Camelina sativa [gold-of-pleasure]
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2          240   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Vitis vinifera
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Cicer arietinum [garbanzo]
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2               238   2e-73   Glycine soja [wild soybean]
ref|XP_010231346.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Brachypodium distachyon [annual false brome]
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Elaeis guineensis
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g             240   2e-73   Phaseolus vulgaris [French bean]
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Solanum lycopersicum
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Solanum lycopersicum
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   2e-73   Vitis vinifera
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg             240   3e-73   Eutrema salsugineum [saltwater cress]
gb|KGN63249.1|  hypothetical protein Csa_2G418850                       240   3e-73   Cucumis sativus [cucumbers]
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   3e-73   
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    240   3e-73   
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...    240   3e-73   Glycine max [soybeans]
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g             239   3e-73   Phaseolus vulgaris [French bean]
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   3e-73   Vitis vinifera
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...    239   3e-73   Gossypium arboreum [tree cotton]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   3e-73   
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein             239   3e-73   Medicago truncatula
ref|XP_010416738.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    240   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   3e-73   Cucumis melo [Oriental melon]
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   4e-73   Vitis vinifera
ref|XP_010416737.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    240   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   4e-73   Citrus sinensis [apfelsine]
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg             239   4e-73   Citrus clementina [clementine]
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   4e-73   Glycine max [soybeans]
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg                239   5e-73   Erythranthe guttata [common monkey flower]
ref|XP_006342694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    238   5e-73   Solanum tuberosum [potatoes]
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   5e-73   Tarenaya hassleriana [spider flower]
emb|CDP10795.1|  unnamed protein product                                239   5e-73   Coffea canephora [robusta coffee]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   5e-73   Solanum lycopersicum
gb|EYU21104.1|  hypothetical protein MIMGU_mgv1a007738mg                238   7e-73   Erythranthe guttata [common monkey flower]
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1     238   7e-73   
gb|KDP22107.1|  hypothetical protein JCGZ_25938                         239   7e-73   Jatropha curcas
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2     238   8e-73   
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   9e-73   Solanum tuberosum [potatoes]
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...    239   9e-73   
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                   238   1e-72   Citrus sinensis [apfelsine]
emb|CBI16979.3|  unnamed protein product                                238   1e-72   Vitis vinifera
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg             238   1e-72   Citrus clementina [clementine]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   Solanum tuberosum [potatoes]
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   Citrus sinensis [apfelsine]
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   Camelina sativa [gold-of-pleasure]
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                   238   1e-72   Citrus sinensis [apfelsine]
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                   238   1e-72   Citrus sinensis [apfelsine]
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   
dbj|BAJ94062.1|  predicted protein                                      238   1e-72   
ref|XP_002977391.1|  glycosyltransferase-like protein                   238   1e-72   
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   
ref|XP_002974972.1|  glycosyltransferase-like protein                   238   1e-72   
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   1e-72   
ref|XP_008437459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   1e-72   
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                    238   1e-72   
ref|XP_001758882.1|  predicted protein                                  238   1e-72   
gb|EPS73703.1|  hypothetical protein M569_01053                         232   1e-72   
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...    239   1e-72   
gb|EAZ14356.1|  hypothetical protein OsJ_04276                          235   2e-72   
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   2e-72   
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4         238   2e-72   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    237   2e-72   
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    238   2e-72   
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    237   2e-72   
gb|KGN49967.1|  hypothetical protein Csa_5G146900                       237   3e-72   
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...    238   3e-72   
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                        237   3e-72   
ref|XP_007019713.1|  Galactosyltransferase family protein isoform 1     237   3e-72   
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...    237   3e-72   
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    237   3e-72   
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    237   4e-72   
ref|NP_001044974.1|  Os01g0877400                                       237   4e-72   
ref|XP_006439188.1|  hypothetical protein CICLE_v10020627mg             231   4e-72   
ref|XP_007019715.1|  Galactosyltransferase family protein isoform 3     237   4e-72   
ref|XP_006355190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    236   4e-72   
ref|XP_011006339.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    234   4e-72   
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    236   4e-72   
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    236   4e-72   
gb|KDO76779.1|  hypothetical protein CISIN_1g021312mg                   234   5e-72   
ref|XP_006439187.1|  hypothetical protein CICLE_v10020627mg             234   5e-72   
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    236   5e-72   
ref|XP_010927833.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    236   6e-72   
ref|NP_177904.3|  beta-1,3-galactosyltransferase 7                      236   6e-72   
ref|NP_174609.1|  putative beta-1,3-galactosyltransferase 8             236   6e-72   
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    236   6e-72   
emb|CDY46836.1|  BnaA10g03200D                                          236   7e-72   
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...    236   8e-72   
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...    236   8e-72   
gb|KDO78243.1|  hypothetical protein CISIN_1g015962mg                   233   9e-72   
ref|XP_010677261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    236   9e-72   
ref|XP_010677269.1|  PREDICTED: probable beta-1,3-galactosyltrans...    236   9e-72   
ref|XP_009607565.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    235   1e-71   
ref|NP_001185130.1|  putative beta-1,3-galactosyltransferase 8          236   1e-71   
gb|KDP25226.1|  hypothetical protein JCGZ_20382                         236   1e-71   
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2          236   1e-71   
ref|XP_011013418.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   1e-71   
ref|XP_004962000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   1e-71   
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1     236   1e-71   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   1e-71   
gb|AAF17702.1|AC009243_29  F28K19.2                                     235   1e-71   
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g             235   1e-71   
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   2e-71   
gb|KDO78242.1|  hypothetical protein CISIN_1g015962mg                   234   2e-71   
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   2e-71   
gb|EMS45879.1|  putative beta-1,3-galactosyltransferase 8               234   2e-71   
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   2e-71   
ref|XP_006646529.1|  PREDICTED: probable beta-1,3-galactosyltrans...    235   2e-71   
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   2e-71   
ref|XP_006449734.1|  hypothetical protein CICLE_v10015441mg             233   3e-71   
ref|XP_010542535.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...    235   3e-71   
ref|XP_010461176.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
ref|XP_006415086.1|  hypothetical protein EUTSA_v10007836mg             234   3e-71   
ref|XP_010542528.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
ref|XP_002893769.1|  galactosyltransferase family protein               234   3e-71   
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
ref|XP_010461174.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
ref|XP_007131321.1|  hypothetical protein PHAVU_011G003800g             233   3e-71   
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   3e-71   
ref|XP_006439190.1|  hypothetical protein CICLE_v10020627mg             233   3e-71   
gb|KJB59160.1|  hypothetical protein B456_009G242100                    233   4e-71   
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   4e-71   
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   4e-71   
emb|CDY48266.1|  BnaA05g10880D                                          234   4e-71   
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_008777928.1|  PREDICTED: probable beta-1,3-galactosyltrans...    232   5e-71   
emb|CDY12206.1|  BnaC04g12360D                                          234   5e-71   
ref|XP_010499892.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   5e-71   
ref|XP_003540564.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   5e-71   
emb|CDY49507.1|  BnaC05g03190D                                          234   5e-71   
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   5e-71   
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   6e-71   
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   6e-71   
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   6e-71   
emb|CDY67379.1|  BnaCnng54730D                                          233   6e-71   
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370          233   6e-71   
ref|XP_009151468.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   7e-71   
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   7e-71   
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   7e-71   
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg             233   7e-71   
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   7e-71   
ref|XP_009412887.1|  PREDICTED: uncharacterized protein LOC103994283    247   7e-71   
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   8e-71   
gb|EMT29794.1|  Beta-1,3-galactosyltransferase 7                        229   8e-71   
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative     233   9e-71   
ref|XP_006304768.1|  hypothetical protein CARUB_v10012254mg             233   9e-71   
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3             233   9e-71   
gb|KHN32455.1|  Putative beta-1,3-galactosyltransferase 8               232   1e-70   
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg             233   1e-70   
ref|XP_002300511.1|  hypothetical protein POPTR_0001s45420g             231   1e-70   
ref|XP_009602082.1|  PREDICTED: probable beta-1,3-galactosyltrans...    234   1e-70   
ref|XP_010471979.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    233   1e-70   
ref|NP_001141034.1|  hypothetical protein                               231   1e-70   
gb|KHG10489.1|  Beta-1,3-galactosyltransferase 7 -like protein          229   1e-70   
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   1e-70   
gb|KJB57752.1|  hypothetical protein B456_009G178900                    232   1e-70   
gb|EEC79262.1|  hypothetical protein OsI_20042                          233   2e-70   
ref|NP_001055606.1|  Os05g0427200                                       233   2e-70   
ref|XP_010112065.1|  putative beta-1,3-galactosyltransferase 8          233   2e-70   
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg             233   2e-70   
gb|KDP20741.1|  hypothetical protein JCGZ_21212                         232   2e-70   
ref|XP_010478768.1|  PREDICTED: probable beta-1,3-galactosyltrans...    232   2e-70   
ref|XP_006449733.1|  hypothetical protein CICLE_v10015441mg             232   2e-70   
ref|XP_006371368.1|  hypothetical protein POPTR_0019s09520g             232   2e-70   
gb|AAV25017.1|  putative galactosyltransferase                          232   2e-70   
ref|XP_002879388.1|  galactosyltransferase family protein               232   2e-70   
ref|XP_011095109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    232   2e-70   
ref|XP_007020793.1|  Galactosyltransferase family protein               232   2e-70   
ref|XP_011081357.1|  PREDICTED: probable beta-1,3-galactosyltrans...    232   3e-70   
ref|XP_010104914.1|  putative beta-1,3-galactosyltransferase 6          233   3e-70   
gb|KJB57747.1|  hypothetical protein B456_009G178900                    232   3e-70   
ref|XP_006371369.1|  hypothetical protein POPTR_0019s09520g             233   3e-70   
ref|XP_003564759.2|  PREDICTED: probable beta-1,3-galactosyltrans...    231   3e-70   
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g             231   3e-70   
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...    232   3e-70   
ref|XP_009757632.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   3e-70   
ref|XP_009757630.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   4e-70   
ref|XP_004506364.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   4e-70   
ref|XP_009757629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    233   4e-70   
gb|KJB62839.1|  hypothetical protein B456_009G440200                    230   4e-70   
ref|XP_009383802.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   4e-70   
ref|XP_010053046.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   4e-70   
gb|KJB62840.1|  hypothetical protein B456_009G440200                    230   4e-70   
ref|XP_008802930.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   4e-70   
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   4e-70   
ref|XP_008459501.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   5e-70   
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   6e-70   
ref|XP_003533526.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   6e-70   
gb|KJB69212.1|  hypothetical protein B456_011G013600                    229   6e-70   
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1         231   6e-70   
ref|XP_009383801.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   7e-70   
ref|XP_006452383.1|  hypothetical protein CICLE_v10008439mg             228   8e-70   
gb|KHN35737.1|  Putative beta-1,3-galactosyltransferase 2               222   8e-70   
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   9e-70   
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   9e-70   
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative     230   9e-70   
gb|KJB52408.1|  hypothetical protein B456_008G260300                    229   9e-70   
gb|KHN11643.1|  Putative beta-1,3-galactosyltransferase 8               230   1e-69   
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960          230   1e-69   
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   1e-69   
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase               230   1e-69   
gb|AAS90659.1|  putative galactosyltransferase                          233   1e-69   
emb|CDX93812.1|  BnaA09g24120D                                          229   2e-69   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   2e-69   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...    229   2e-69   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    230   2e-69   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...    229   2e-69   
gb|EMT06166.1|  Putative beta-1,3-galactosyltransferase 8               227   2e-69   
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                    229   2e-69   
gb|KJB62836.1|  hypothetical protein B456_009G440200                    229   2e-69   
ref|XP_002441135.1|  hypothetical protein SORBIDRAFT_09g021080          229   2e-69   
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...    229   2e-69   
ref|NP_001050543.1|  Os03g0577500                                       229   3e-69   
ref|XP_002893747.1|  galactosyltransferase family protein               229   3e-69   
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    231   3e-69   
emb|CDY54843.1|  BnaC05g51320D                                          230   3e-69   
gb|KJB52405.1|  hypothetical protein B456_008G260300                    229   3e-69   
gb|KJB13704.1|  hypothetical protein B456_002G089700                    228   3e-69   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    229   3e-69   
dbj|BAK07004.1|  predicted protein                                      229   3e-69   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...    229   4e-69   
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg             228   4e-69   
gb|KJB69211.1|  hypothetical protein B456_011G013600                    229   5e-69   
ref|XP_006654433.1|  PREDICTED: probable beta-1,3-galactosyltrans...    232   5e-69   
gb|KJB69210.1|  hypothetical protein B456_011G013600                    229   5e-69   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...    229   5e-69   
ref|XP_006587723.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   5e-69   
gb|KJB13705.1|  hypothetical protein B456_002G089700                    228   5e-69   
ref|NP_001183433.1|  uncharacterized protein LOC100501859               222   6e-69   
ref|XP_002317052.2|  galactosyltransferase family protein               228   6e-69   
ref|XP_006344003.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    228   7e-69   
ref|XP_009624798.1|  PREDICTED: probable beta-1,3-galactosyltrans...    227   7e-69   
ref|XP_004250812.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   7e-69   
emb|CDM85234.1|  unnamed protein product                                239   1e-68   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   1e-68   
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   1e-68   
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   1e-68   
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg             228   1e-68   
gb|KJB80508.1|  hypothetical protein B456_013G101400                    227   1e-68   
ref|XP_010539626.1|  PREDICTED: beta-1,3-galactosyltransferase 7        228   1e-68   
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    227   2e-68   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...    227   2e-68   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...    228   2e-68   
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...    227   3e-68   
gb|KJB13702.1|  hypothetical protein B456_002G089700                    227   3e-68   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg             226   3e-68   
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   3e-68   
gb|EYU22689.1|  hypothetical protein MIMGU_mgv1a007366mg                224   3e-68   
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                  226   3e-68   
ref|XP_007212259.1|  hypothetical protein PRUPE_ppa006626mg             226   4e-68   
ref|XP_006304002.1|  hypothetical protein CARUB_v10011446mg             226   4e-68   
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...    226   4e-68   
ref|NP_001149120.1|  beta-1,3-galactosyltransferase sqv-2               225   4e-68   
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   4e-68   
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   4e-68   
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   5e-68   
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   6e-68   
emb|CDP11534.1|  unnamed protein product                                226   6e-68   
gb|KCW70985.1|  hypothetical protein EUGRSUZ_F04094                     226   7e-68   
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   7e-68   
ref|NP_001045990.1|  Os02g0164300                                       218   7e-68   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2          226   8e-68   
ref|XP_010065074.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   9e-68   



>ref|XP_009601250.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   270 bits (689),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  190  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  249

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  250  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  309

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  310  EGEEALWNALF  320



>ref|XP_009786663.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=320

 Score =   269 bits (688),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  190  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  249

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  250  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  309

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  310  EGEEALWNALF  320



>ref|XP_006364961.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010312804.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=320

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  190  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  249

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  250  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  309

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  310  EGEEALWNALF  320



>ref|XP_011074895.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=372

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  242  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  301

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEK+KFVH++CG
Sbjct  302  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKMKFVHDQCG  361

Query  330  EGEETLWNALF  298
            EGEE LWNAL 
Sbjct  362  EGEEALWNALL  372



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  326  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  386  EGEEALWNALF  396



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  326  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  386  EGEEALWNALF  396



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  326  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  386  EGEEALWNALF  396



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQP+LHKYANEDVSLG
Sbjct  265  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+KFVHE+CG
Sbjct  325  AWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKFVHEQCG  384

Query  330  EGEETLWNALF  298
            EGEE LWNAL 
Sbjct  385  EGEEALWNALL  395



>ref|XP_004250351.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=396

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  326  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  386  EGEEALWNALF  396



>ref|XP_006364960.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=396

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDERTMCCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCG
Sbjct  326  AWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNALF
Sbjct  386  EGEEALWNALF  396



>emb|CDP18301.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  265  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER+MCC TPP+CEWKAQAGNVCVASFDWSCSGICKSVEKI+FVHE+CG
Sbjct  325  SWFIGLEVEHIDERSMCCATPPECEWKAQAGNVCVASFDWSCSGICKSVEKIRFVHERCG  384

Query  330  EGEETLWNALF  298
            EGEE +WNALF
Sbjct  385  EGEEAVWNALF  395



>ref|XP_010095510.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
 gb|EXB60484.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
Length=397

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSQKNVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG
Sbjct  327  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  386

Query  330  EGEETLWNALF  298
            EG+ T+W++LF
Sbjct  387  EGDGTVWSSLF  397



>gb|KDP32735.1| hypothetical protein JCGZ_12027 [Jatropha curcas]
Length=398

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQP+LHKYANEDVSLG
Sbjct  268  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHE+CG
Sbjct  328  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHERCG  387

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  388  EGDGAVWSALF  398



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGE+GNKYFRHATGQIYA+SKDLATYISINQ ILHKYANEDVSLG
Sbjct  266  LSQKNVKYHEPEYWKFGEDGNKYFRHATGQIYALSKDLATYISINQHILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDER MCCGTPPDCEWK+QAGNVC+ASFDWSCSGICKSVEK+KFVHE+CG
Sbjct  326  AWFIGLEVEHIDERNMCCGTPPDCEWKSQAGNVCIASFDWSCSGICKSVEKMKFVHEQCG  385

Query  330  EGEETLWNALF  298
            EGEE LWNAL 
Sbjct  386  EGEEALWNALL  396



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CG
Sbjct  326  AWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCG  385

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  386  EGDGAVWSALF  396



>ref|XP_006581562.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  267  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINKPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNALF  298
            EG+E +W+ALF
Sbjct  387  EGDEAVWSALF  397



>ref|XP_003526605.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
 gb|KHN09160.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=394

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  264  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINKPILHKYANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  324  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKYVHSKCG  383

Query  330  EGEETLWNALF  298
            EG+E +W+ALF
Sbjct  384  EGDEAVWSALF  394



>ref|XP_003601132.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71383.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=396

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  326  SWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  386  EGDGAVWSALF  396



>ref|XP_004515661.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cicer 
arietinum]
Length=392

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  262  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  321

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  322  SWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  381

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  382  EGDGAVWSALF  392



>ref|XP_003601133.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71384.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
 gb|AFK45036.1| unknown [Medicago truncatula]
Length=395

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  265  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  325  SWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  384

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  385  EGDGAVWSALF  395



>ref|XP_004515660.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cicer 
arietinum]
Length=393

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  263  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  323  SWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  382

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  383  EGDGAVWSALF  393



>gb|KHN47065.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=363

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  233  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  292

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  293  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  352

Query  330  EGEETLWNALF  298
            EG   +W+ALF
Sbjct  353  EGNGAVWSALF  363



>ref|XP_003523469.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
Length=394

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  264  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  324  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  383

Query  330  EGEETLWNALF  298
            EG   +W+ALF
Sbjct  384  EGNGAVWSALF  394



>ref|XP_007136194.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
 gb|ESW08188.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
Length=393

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  263  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  323  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  382

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  383  EGDGAVWSALF  393



>ref|XP_009367324.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Pyrus 
x bretschneideri]
Length=399

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  269  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  329  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  388

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  389  EGDAAVWSSLF  399



>ref|XP_009367323.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  270  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  329

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  330  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  389

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  390  EGDAAVWSSLF  400



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQ ILHKYANEDVSLG
Sbjct  263  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQHILHKYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSV+KI+FVH++CG
Sbjct  323  SWFIGLEVEHIDDRDMCCGTPPDCEWKAQAGNLCVASFDWSCSGICKSVDKIQFVHQQCG  382

Query  330  EGEETLWNALF  298
            EGE+ LWNAL 
Sbjct  383  EGEDALWNALI  393



>ref|XP_006578989.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNALF  298
            EG   +W+ALF
Sbjct  387  EGNGAVWSALF  397



>ref|XP_009367325.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Pyrus 
x bretschneideri]
Length=397

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  267  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  327  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  386

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  387  EGDAAVWSSLF  397



>ref|XP_011465327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK++KYHEPE WKFGE GNKYFRHATGQIYAIS+DLATYISINQPILHKYANEDVSLG
Sbjct  269  LAQKSLKYHEPEHWKFGEAGNKYFRHATGQIYAISRDLATYISINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHEKCG
Sbjct  329  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHEKCG  388

Query  330  EGEETLWNALF  298
            EG+  +W +LF
Sbjct  389  EGDAAVWGSLF  399



>gb|KHN26051.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=327

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+++VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  197  LSRRDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  256

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  257  AWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  316

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  317  EGDGAVWSAL  326



>ref|XP_008378523.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Malus 
domestica]
Length=398

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  268  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  328  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  387

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  388  EGDAAVWSSLF  398



>ref|XP_008233932.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Prunus 
mume]
Length=400

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  270  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  329

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCG
Sbjct  330  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCG  389

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  390  EGDAAVWSSLF  400



>ref|XP_009367326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Pyrus 
x bretschneideri]
Length=396

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  326  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_008378522.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Malus 
domestica]
Length=399

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  269  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  329  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  388

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  389  EGDAAVWSSLF  399



>ref|XP_008233934.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Prunus 
mume]
Length=397

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  267  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCG
Sbjct  327  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCG  386

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  387  EGDAAVWSSLF  397



>ref|XP_004300420.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=396

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK++KYHEPE WKFGE GNKYFRHATGQIYAIS+DLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKSLKYHEPEHWKFGEAGNKYFRHATGQIYAISRDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHEKCG
Sbjct  326  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W +LF
Sbjct  386  EGDAAVWGSLF  396



>ref|XP_008233933.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Prunus 
mume]
Length=399

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  269  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCG
Sbjct  329  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCG  388

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  389  EGDAAVWSSLF  399



>ref|XP_008378524.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X3 [Malus 
domestica]
Length=396

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  326  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_008233935.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Prunus 
mume]
Length=396

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCG
Sbjct  326  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_007222961.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
 gb|EMJ24160.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
Length=396

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCG
Sbjct  326  SWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_010916559.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE++K VH +CG
Sbjct  328  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERMKEVHARCG  387

Query  330  EGEETLWNALF  298
            EG++ +W+ALF
Sbjct  388  EGDDGVWSALF  398



>ref|XP_008378526.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Malus 
domestica]
Length=395

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  265  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  325  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCG  384

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  385  EGDAAVWSSLF  395



>ref|XP_006596309.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Glycine max]
Length=397

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  387  EGDGAVWSAL  396



>gb|KHN06134.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=397

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  387  EGDGAVWSAL  396



>gb|KCW70545.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=313

 Score =   256 bits (654),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  183  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  242

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  243  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  302

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  303  EGDAAVWDALI  313



>gb|KJB64380.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=322

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLG
Sbjct  192  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLG  251

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CG
Sbjct  252  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCG  311

Query  330  EGEETLWNALF  298
            EG++ +WN L 
Sbjct  312  EGDDAVWNTLL  322



>ref|XP_002302264.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE81537.1| galactosyltransferase family protein [Populus trichocarpa]
Length=390

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLG
Sbjct  260  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLG  319

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+ +MCCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCG
Sbjct  320  AWFIGLEVEHIDDHSMCCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCG  379

Query  330  EGEETLWNALF  298
            EG+ ++W+ALF
Sbjct  380  EGDGSVWSALF  390



>ref|XP_011027635.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Populus 
euphratica]
Length=393

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLG
Sbjct  263  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+ +MCCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCG
Sbjct  323  AWFIGLEVEHIDDHSMCCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCG  382

Query  330  EGEETLWNALF  298
            EG+ ++W+ALF
Sbjct  383  EGDGSVWSALF  393



>ref|XP_011027636.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Populus 
euphratica]
Length=392

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLG
Sbjct  262  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLG  321

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+ +MCCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCG
Sbjct  322  AWFIGLEVEHIDDHSMCCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCG  381

Query  330  EGEETLWNALF  298
            EG+ ++W+ALF
Sbjct  382  EGDGSVWSALF  392



>ref|XP_011027637.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Populus 
euphratica]
Length=390

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLG
Sbjct  260  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLG  319

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+ +MCCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCG
Sbjct  320  AWFIGLEVEHIDDHSMCCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCG  379

Query  330  EGEETLWNALF  298
            EG+ ++W+ALF
Sbjct  380  EGDGSVWSALF  390



>ref|XP_010277678.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nelumbo nucifera]
Length=395

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L QKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  265  LYQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HIDER MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK VH +CG
Sbjct  325  AWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKNVHSRCG  384

Query  330  EGEETLWNALF  298
            EG+  +WN L 
Sbjct  385  EGKGAIWNTLL  395



>ref|XP_011097468.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Sesamum indicum]
Length=395

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGE+GN YFRHATGQIYAISKDLA+YISINQPILHKYANEDVSLG
Sbjct  265  LAQKNVKYHEPEYWKFGEDGNNYFRHATGQIYAISKDLASYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLE++HID+R MCC TPPDCEWKAQAG++CVASFDWSCSGICKSVEK+KFVH++CG
Sbjct  325  SWFIGLEIEHIDDRNMCCSTPPDCEWKAQAGSMCVASFDWSCSGICKSVEKMKFVHQRCG  384

Query  330  EGEETLWNALF  298
            EGEE LWNAL 
Sbjct  385  EGEEALWNALL  395



>ref|XP_009414059.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLATYISIN PILHKYANEDVSLG
Sbjct  267  LSDKNVKYHEPEYWKFGEEGNKYFRHATGQIYAVSKDLATYISINHPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER+MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CG
Sbjct  327  SWFIGLEVEHIDERSMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCG  386

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  387  EGDGAVWSALF  397



>ref|XP_011027638.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Populus 
euphratica]
Length=389

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLG
Sbjct  259  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLG  318

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+ +MCCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCG
Sbjct  319  AWFIGLEVEHIDDHSMCCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCG  378

Query  330  EGEETLWNALF  298
            EG+ ++W+ALF
Sbjct  379  EGDGSVWSALF  389



>gb|AFK45069.1| unknown [Lotus japonicus]
Length=140

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  10   LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  69

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+HIDER+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  70   SWLIGLEVEHIDERSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  129

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  130  EGDGAVWSALL  140



>ref|XP_003542690.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Glycine max]
Length=397

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+++VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSRRDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  387  EGDGAVWSAL  396



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  226  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  285

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  286  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  345

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  346  EGDAAVWDALI  356



>gb|AFK48973.1| unknown [Lotus japonicus]
Length=394

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  264  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+HIDER+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  324  SWLIGLEVEHIDERSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  383

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  384  EGDGAVWSALL  394



>ref|XP_008802092.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATY+SINQPILHKYANEDVSLG
Sbjct  269  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYVSINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDW+CSGICKSVE++K VH +CG
Sbjct  329  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWTCSGICKSVERMKEVHTRCG  388

Query  330  EGEETLWNALF  298
            EG++ +W+ LF
Sbjct  389  EGDDGVWSTLF  399



>ref|XP_009367010.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Pyrus x bretschneideri]
Length=396

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCC TPPDCEWKAQAGN+CVASFDWSCSGICKSVE+IK VHEKCG
Sbjct  326  SWFIGLEVEHIDERNMCCRTPPDCEWKAQAGNMCVASFDWSCSGICKSVERIKSVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_007141114.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
 gb|ESW13108.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
Length=397

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+MCCGTPPDCEWKA+AGN+C ASFDWSCSGICKSVEKIK+VH KCG
Sbjct  327  AWFIGLEVEHIDDRSMCCGTPPDCEWKAEAGNICAASFDWSCSGICKSVEKIKYVHSKCG  386

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  387  EGDGAVWSAL  396



>ref|XP_008338811.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Malus domestica]
Length=396

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  266  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCC TPPDCEWKAQAGN+C+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  326  SWFIGLEVEHIDERNMCCRTPPDCEWKAQAGNMCIASFDWSCSGICKSVERIKSVHEKCG  385

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  386  EGDAAVWSSLF  396



>ref|XP_002513842.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF48425.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=396

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  266  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLE++HID+R MCCGTPPDCEWKAQAG+VCVASFDWSCSGICKSVEK+KFVHE+C 
Sbjct  326  SWFIGLEIEHIDDRNMCCGTPPDCEWKAQAGSVCVASFDWSCSGICKSVEKMKFVHERCS  385

Query  330  EGEETLWNALF  298
            EG+  +W AL 
Sbjct  386  EGDGAVWGALI  396



>gb|ACF79671.1| unknown [Zea mays]
 gb|AFW62682.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  388  EGDSAVWSALF  398



>ref|NP_001131318.1| uncharacterized protein LOC100192632 [Zea mays]
 gb|ACG38477.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNALF  298
            EG+  +W+ALF
Sbjct  388  EGDSAVWSALF  398



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  262  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  321

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  322  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  381

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  382  EGDAAVWDALI  392



>gb|KJB64379.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=397

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLG
Sbjct  267  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CG
Sbjct  327  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCG  386

Query  330  EGEETLWNALF  298
            EG++ +WN L 
Sbjct  387  EGDDAVWNTLL  397



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  261  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  320

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  321  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  380

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  381  EGDAAVWDALI  391



>gb|KJB64381.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=400

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLG
Sbjct  270  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLG  329

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CG
Sbjct  330  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCG  389

Query  330  EGEETLWNALF  298
            EG++ +WN L 
Sbjct  390  EGDDAVWNTLL  400



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  258  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  317

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  318  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  377

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  378  EGDAAVWDALI  388



>ref|XP_010943123.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=397

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS +NVKYHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LSNQNVKYHEPEFWKFGEEGNKYFRHATGQLYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+I+ VH KCG
Sbjct  327  AWFIGLDVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIRDVHAKCG  386

Query  330  EGEETLWNALF  298
            EG+  +WNA F
Sbjct  387  EGDGAVWNAFF  397



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG
Sbjct  259  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLG  318

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CG
Sbjct  319  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCG  378

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  379  EGDAAVWDALI  389



>ref|XP_008352694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Malus domestica]
Length=435

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG
Sbjct  305  LAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLG  364

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCC TPPDCEWKAQAGN+C+ASFDWSCSGICKSVE+IK VHEKCG
Sbjct  365  SWFIGLEVEHIDERNMCCRTPPDCEWKAQAGNMCIASFDWSCSGICKSVERIKSVHEKCG  424

Query  330  EGEETLWNALF  298
            EG+  +W++LF
Sbjct  425  EGDAAVWSSLF  435



>ref|XP_009401434.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQ ILHKYANEDVSLG
Sbjct  270  LSSKNVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAMYISINQAILHKYANEDVSLG  329

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CG
Sbjct  330  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCG  389

Query  330  EGEETLWNALF  298
            EG+ T+W+ LF
Sbjct  390  EGDGTVWSTLF  400



>gb|KHG03200.1| Beta-1,3-galactosyltransferase 7 -like protein [Gossypium arboreum]
Length=397

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLG
Sbjct  267  LSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VHE+CG
Sbjct  327  AWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHERCG  386

Query  330  EGEETLWNA  304
            EG++ +WN 
Sbjct  387  EGDDAVWNT  395



>ref|NP_001141176.1| hypothetical protein [Zea mays]
 gb|ACF85625.1| unknown [Zea mays]
 gb|AFW71912.1| hypothetical protein ZEAMMB73_862603 [Zea mays]
Length=300

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  170  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLG  229

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  230  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  289

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  290  EGDSAVWSAL  299



>ref|XP_006846610.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
 gb|ERN08285.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
Length=396

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK+VKYHEPE WKFGEEGNKYFRHA+GQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LSQKSVKYHEPEYWKFGEEGNKYFRHASGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R+ CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK VH +CG
Sbjct  326  AWFIGLEVEHIDDRSFCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKNVHTRCG  385

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  386  EGDGAVWSAL  395



>ref|XP_002306601.2| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE93597.2| galactosyltransferase family protein [Populus trichocarpa]
Length=399

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQ+N KYHEPE WKFG EGN YFRHATGQIYAISK+LATYISINQPILHKYANEDVSLG
Sbjct  269  LSQRNAKYHEPEYWKFGVEGNNYFRHATGQIYAISKELATYISINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+ ID+R MCCGTPPDCEWKA AGNVC+ASFDWSCSGICKSVEKIKFVHEKCG
Sbjct  329  AWFIGLEVELIDDRNMCCGTPPDCEWKALAGNVCIASFDWSCSGICKSVEKIKFVHEKCG  388

Query  330  EGEETLWNALF  298
            EG+E++W+ LF
Sbjct  389  EGDESVWSDLF  399



>ref|XP_004952712.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Setaria italica]
Length=398

 Score =   253 bits (647),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  388  EGDSAVWSALI  398



>ref|XP_002454032.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
 gb|EES07008.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
Length=398

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  388  EGDSAVWSALI  398



>ref|XP_010534616.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Tarenaya hassleriana]
Length=396

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKAQAGNVCVASFDWSCSGICKSVE++K VHE CG
Sbjct  326  SWFIGLEVEHIDDRNFCCGTPPDCAWKAQAGNVCVASFDWSCSGICKSVERMKPVHEMCG  385

Query  330  EGEETLWNALF  298
            EGE  +WNAL 
Sbjct  386  EGEGAVWNALL  396



>ref|XP_008444116.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cucumis 
melo]
Length=397

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYI++NQPILHKYANEDVSLG
Sbjct  267  LSSKSVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYIAVNQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCG
Sbjct  327  AWLIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCG  386

Query  330  EGEETLWNALF  298
            EG   +W+AL 
Sbjct  387  EGNGAVWSALI  397



>ref|XP_008444117.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cucumis 
melo]
Length=396

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYI++NQPILHKYANEDVSLG
Sbjct  266  LSSKSVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYIAVNQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCG
Sbjct  326  AWLIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCG  385

Query  330  EGEETLWNALF  298
            EG   +W+AL 
Sbjct  386  EGNGAVWSALI  396



>ref|XP_004142613.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
 ref|XP_004163674.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
Length=399

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATY+++NQPILHKYANEDVSLG
Sbjct  269  LSSKSVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYVAVNQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCG
Sbjct  329  AWLIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCG  388

Query  330  EGEETLWNALF  298
            EG   +W+AL 
Sbjct  389  EGNGAVWSALI  399



>gb|KGN54610.1| hypothetical protein Csa_4G377730 [Cucumis sativus]
Length=397

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATY+++NQPILHKYANEDVSLG
Sbjct  267  LSSKSVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYVAVNQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCG
Sbjct  327  AWLIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCG  386

Query  330  EGEETLWNALF  298
            EG   +W+AL 
Sbjct  387  EGNGAVWSALI  397



>ref|XP_006647402.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Oryza brachyantha]
Length=398

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDW+CSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWTCSGICKSVERIKEVHARCG  387

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  388  EGDSAVWSAL  397



>dbj|BAD17751.1| putative avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EAY86345.1| hypothetical protein OsI_07722 [Oryza sativa Indica Group]
 gb|EAZ23493.1| hypothetical protein OsJ_07189 [Oryza sativa Japonica Group]
Length=400

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  270  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  329

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  330  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKEVHARCG  389

Query  330  EGEETLWNALF  298
            EG+  +W+AL 
Sbjct  390  EGDSAVWSALI  400



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYIS+NQPILHKYANEDVSLG
Sbjct  267  LSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  327  AWFIGLEVEHIDDRNLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCG  386

Query  330  EGEETLWNALF  298
            EG+  +W+  F
Sbjct  387  EGDGAIWSTPF  397



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYIS+NQPILHKYANEDVSLG
Sbjct  266  LSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  326  AWFIGLEVEHIDDRNLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCG  385

Query  330  EGEETLWNALF  298
            EG+  +W+  F
Sbjct  386  EGDGAIWSTPF  396



>ref|XP_010672316.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  268  LAQKNVKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVEK+KFVHEKCG
Sbjct  328  SWFIGLDVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICQSVEKLKFVHEKCG  387

Query  330  EGEETLW  310
            EG++ +W
Sbjct  388  EGDDGIW  394



>ref|XP_010672363.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QKNVKYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  265  LAQKNVKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R MCCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVEK+KFVHEKCG
Sbjct  325  SWFIGLDVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICQSVEKLKFVHEKCG  384

Query  330  EGEETLW  310
            EG++ +W
Sbjct  385  EGDDGIW  391



>gb|KDO80826.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=300

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  170  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  229

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCG
Sbjct  230  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCG  289

Query  330  EGEETLW  310
            E +  +W
Sbjct  290  EEDSAIW  296



>gb|ACG41551.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  388  EGDSAVWSAL  397



>ref|XP_008681428.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34486.1| unknown [Zea mays]
 gb|AFW71914.1| avr9 elicitor response protein isoform 1 [Zea mays]
 gb|AFW71915.1| avr9 elicitor response protein isoform 2 [Zea mays]
Length=398

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  268  LADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLEVNHIDERNMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCG  387

Query  330  EGEETLWNAL  301
            EG+  +W+AL
Sbjct  388  EGDSAVWSAL  397



>ref|XP_008782246.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKY EPE WKFGEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  269  LSQKNVKYREPEYWKFGEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGICKS E++K VH++CG
Sbjct  329  SWLIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSDERMKEVHKRCG  388

Query  330  EGEETLWNALF  298
            EG++ +W+ALF
Sbjct  389  EGDDGVWSALF  399



>ref|XP_008778068.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=234

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYI+INQPILHKYANEDVSLG
Sbjct  104  LSNKNVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYITINQPILHKYANEDVSLG  163

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HIDER MCC TPPDCE KA+AGNVC+ASFDWSCSGICKSVE+IK VH KCG
Sbjct  164  AWFIGLDVEHIDERNMCCKTPPDCEGKARAGNVCIASFDWSCSGICKSVERIKDVHAKCG  223

Query  330  EGEETLWNALF  298
            EG+  +WNA F
Sbjct  224  EGDGAVWNAFF  234



>ref|XP_002285826.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Vitis vinifera]
 emb|CBI19088.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  266  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGIC SVEKIK VH +CG
Sbjct  326  SWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICNSVEKIKDVHARCG  385

Query  330  EGEETLWNALF  298
            EG+  +W+   
Sbjct  386  EGDGAVWSDFL  396



>gb|ACJ84307.1| unknown [Medicago truncatula]
Length=157

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K+VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  7    LSRKDVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  66

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCG
Sbjct  67   SWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCG  126

Query  330  EGE  322
            EG+
Sbjct  127  EGD  129



>ref|XP_003575190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Brachypodium 
distachyon]
Length=397

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KN+KYHEPESWKFGE+GNKYFRHATGQIYAISKDLATY+SINQ ILHKYANEDVSLG
Sbjct  267  LADKNLKYHEPESWKFGEDGNKYFRHATGQIYAISKDLATYVSINQHILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HIDER+MCCGTPPDCEWK QAGNVCVASFDWSCSGICKSV+++K VH +CG
Sbjct  327  SWFIGLEVNHIDERSMCCGTPPDCEWKGQAGNVCVASFDWSCSGICKSVDRLKDVHARCG  386

Query  330  EGEETLWNALF  298
            EG+ ++W+AL 
Sbjct  387  EGDSSVWSALI  397



>ref|XP_006434095.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47335.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=394

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  264  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCG
Sbjct  324  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCG  383

Query  330  EGEETLW  310
            E +  +W
Sbjct  384  EEDSAIW  390



>gb|KDO80824.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=394

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  264  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCG
Sbjct  324  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCG  383

Query  330  EGEETLW  310
            E +  +W
Sbjct  384  EEDSAIW  390



>dbj|BAK03918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KN+KYHEPE+WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  267  LADKNMKYHEPEAWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HI ER MCCGTPPDCEWK QAGN+CVASFDWSCSGICKSVE++K VH +CG
Sbjct  327  SWFIGLEVNHIGERNMCCGTPPDCEWKGQAGNMCVASFDWSCSGICKSVERLKDVHARCG  386

Query  330  EGEETLWNALF  298
            EG+ ++W+AL 
Sbjct  387  EGDSSVWSALI  397



>ref|XP_006434096.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47336.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=402

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  272  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  331

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCG
Sbjct  332  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCG  391

Query  330  EGEETLW  310
            E +  +W
Sbjct  392  EEDSAIW  398



>gb|KDO80825.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=402

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  272  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  331

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCG
Sbjct  332  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCG  391

Query  330  EGEETLW  310
            E +  +W
Sbjct  392  EEDSAIW  398



>ref|NP_001141890.1| hypothetical protein [Zea mays]
 gb|ACF87243.1| unknown [Zea mays]
 tpg|DAA61737.1| TPA: hypothetical protein ZEAMMB73_056797 [Zea mays]
 gb|AIG52083.1| pyrabactin resistance-like protein [Zea mays]
Length=398

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KN KYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LSDKNAKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKAQAGNVC+ASFDW CSG+C  VE+IK+VH +CG
Sbjct  328  AWFIGLDVEHIDDRDMCCGTPPDCEWKAQAGNVCIASFDWRCSGVCNPVERIKYVHSRCG  387

Query  330  EGEETLWNALF  298
            EG++ +W+A F
Sbjct  388  EGQDAIWSASF  398



>ref|XP_006472694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Citrus 
sinensis]
Length=402

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  272  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  331

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVE+I+ VHEKCG
Sbjct  332  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIRSVHEKCG  391

Query  330  EGEETLW  310
            E +  +W
Sbjct  392  EEDAAIW  398



>ref|XP_006472695.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Citrus 
sinensis]
Length=394

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG
Sbjct  264  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLG  323

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R MCC TPPDCEWKAQAGNVCVASFDWSCSGICKSVE+I+ VHEKCG
Sbjct  324  SWFIGLEVEHIDDRNMCCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIRSVHEKCG  383

Query  330  EGEETLW  310
            E +  +W
Sbjct  384  EEDAAIW  390



>ref|XP_006836897.1| hypothetical protein AMTR_s00099p00123290 [Amborella trichopoda]
 gb|ERM99750.1| hypothetical protein AMTR_s00099p00123290 [Amborella trichopoda]
Length=419

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG
Sbjct  289  LSQKGVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLAAYISINSPILHRYANEDVSLG  348

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW +GLEV+H+D+RTMCCGTPPDCEWK QAGNVCVASFDWSCSGICKSV+K+K VH  CG
Sbjct  349  AWLLGLEVEHVDDRTMCCGTPPDCEWKVQAGNVCVASFDWSCSGICKSVDKMKDVHNSCG  408

Query  330  EGEETLWNALF  298
            EGE  +WNA+ 
Sbjct  409  EGETAVWNAII  419



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH++CG
Sbjct  335  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHQRCG  394

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  395  EGEHALWSAVF  405



>ref|XP_001779676.1| predicted protein [Physcomitrella patens]
 gb|EDQ55472.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYI +N+P+LHKYANEDVSLG
Sbjct  267  LAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYIDVNRPLLHKYANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGL+VDHID+R+MCCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH++CG
Sbjct  327  AWIIGLDVDHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKDVHQRCG  386

Query  330  EGEETLWNA  304
            EG++ LW+ 
Sbjct  387  EGDDALWST  395



>ref|XP_006441805.1| hypothetical protein CICLE_v10024512mg [Citrus clementina]
 gb|ESR55045.1| hypothetical protein CICLE_v10024512mg [Citrus clementina]
Length=410

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG
Sbjct  280  LSQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLAAYISINLPILHRYANEDVSLG  339

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+H+D+R+MCCGTPPDCEWKA+AGN CVASFDWSCSGICKSVE++K VH  CG
Sbjct  340  SWFIGLEVEHVDDRSMCCGTPPDCEWKAKAGNACVASFDWSCSGICKSVERMKIVHNSCG  399

Query  330  EGEETLWNALF  298
            EG++T+WN  F
Sbjct  400  EGDDTVWNVDF  410



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATY+SINQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYMSINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CG
Sbjct  335  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSAERIKEVHQRCG  394

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  395  EGENALWSAVF  405



>ref|XP_002988781.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10043.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=399

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GN+YFRHATGQ+YAIS+DLATYISINQPILHKYANEDVSLG
Sbjct  269  LAQKGVKYHEPEYWKFGEDGNRYFRHATGQVYAISRDLATYISINQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R+ CCGTPPDCEWKAQAG+VCV SFDW+CSGIC+SVE++ FVH++CG
Sbjct  329  SWFIGLDVDHIDDRSFCCGTPPDCEWKAQAGSVCVGSFDWTCSGICRSVERLGFVHQRCG  388

Query  330  EGEETLWNALF  298
            EG+  +WNA+ 
Sbjct  389  EGDSAVWNAVL  399



>ref|XP_004167799.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=187

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ ILHKYANEDVSLG
Sbjct  57   LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLG  116

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E++K VH +CG
Sbjct  117  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCG  176

Query  330  EGEETLWNALF  298
            EGE  L +A+F
Sbjct  177  EGENALLSAVF  187



>ref|XP_010911041.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK+VKYHEPE WKFGE+GNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG
Sbjct  268  LSQKDVKYHEPEYWKFGEDGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HIDER MCCGTPPDCEWKAQAGNVC+ASFDWSCSGIC+S E++  VH+KC 
Sbjct  328  AWLIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICESDERMMEVHKKCS  387

Query  330  EGEETLWNALF  298
            EG++ LW AL 
Sbjct  388  EGDDGLWRALL  398



>ref|XP_001781844.1| predicted protein [Physcomitrella patens]
 gb|EDQ53299.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAIS+DLA YIS+NQP+LHK+ANEDVSLG
Sbjct  240  LAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLANYISVNQPLLHKFANEDVSLG  299

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGL+VDHID+R+MCCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE+I+ VH++CG
Sbjct  300  AWIIGLDVDHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERIQEVHQRCG  359

Query  330  EGEETLWNALF  298
            EG+  +W+A+F
Sbjct  360  EGDGAVWSAVF  370



>ref|XP_009774684.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nicotiana sylvestris]
Length=279

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L  KNVKYHEPE WKFGE GNKYFRHATGQIYAISKDLATYI+ N+PILHKYANEDVSLG
Sbjct  149  LYHKNVKYHEPEFWKFGEAGNKYFRHATGQIYAISKDLATYIANNRPILHKYANEDVSLG  208

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HIDER+MCCGTPP+CEWKAQAGNVCVASF+WSCSGIC+SVE+IK VH KCG
Sbjct  209  AWLIGLEVEHIDERSMCCGTPPECEWKAQAGNVCVASFEWSCSGICRSVERIKHVHAKCG  268

Query  330  EGEETLWNALF  298
            E   TLW AL 
Sbjct  269  ETAATLWGALL  279



>ref|XP_002462477.1| hypothetical protein SORBIDRAFT_02g026360 [Sorghum bicolor]
 gb|EER98998.1| hypothetical protein SORBIDRAFT_02g026360 [Sorghum bicolor]
Length=410

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KN KYHEPE WKFGE+GNKYFRHATGQ+YAISKDLATYISINQPILHKYANEDVSLG
Sbjct  280  LSDKNAKYHEPEFWKFGEDGNKYFRHATGQLYAISKDLATYISINQPILHKYANEDVSLG  339

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKAQAGNVCVASFDW CSG+C  VE++K+VH +C 
Sbjct  340  AWFIGLDVEHIDDRDMCCGTPPDCEWKAQAGNVCVASFDWQCSGVCNPVERLKYVHSRCS  399

Query  330  EGEETLWNALF  298
            EGE+ +W+A F
Sbjct  400  EGEDAIWSASF  410



>ref|XP_006375531.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53328.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=303

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  173  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLG  232

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  233  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  292

Query  330  EGEETLWNALF  298
            EGE+ LW A F
Sbjct  293  EGEKALWRATF  303



>ref|XP_011097092.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=396

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L QKNVKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YISINQPILHKYANEDV+LG
Sbjct  266  LYQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVTLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGLEV HID+R MCCGTPPDCEWKAQAGN+CVA+FDWSCSGIC SVE+IK VH KCG
Sbjct  326  AWFIGLEVMHIDDRNMCCGTPPDCEWKAQAGNICVATFDWSCSGICNSVERIKIVHVKCG  385

Query  330  EGEETLWNALF  298
            E   TL N+L 
Sbjct  386  EDVTTLRNSLL  396



>gb|ADE75915.1| unknown [Picea sitchensis]
Length=246

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGN+YFRHATGQIYAIS+DLATYISIN PILH+YANEDVSLG
Sbjct  116  LAQKGVKYHEPEYWKFGEEGNRYFRHATGQIYAISRDLATYISINSPILHRYANEDVSLG  175

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HIDER+MCCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH  C 
Sbjct  176  AWFIGLDVEHIDERSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKEVHRTCS  235

Query  330  EGEETLWNALF  298
            EG+  +W+ L 
Sbjct  236  EGDGAVWSTLI  246



>ref|XP_006478362.1| PREDICTED: probable beta-1,3-galactosyltransferase 8-like [Citrus 
sinensis]
Length=428

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG
Sbjct  298  LSQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLAGYISINLPILHRYANEDVSLG  357

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+H+D+R+MCCGTPPDCEWKA+AGN CVASFDWSCSGICKSVE++K VH  CG
Sbjct  358  SWFIGLEVEHVDDRSMCCGTPPDCEWKAKAGNACVASFDWSCSGICKSVERMKIVHNSCG  417

Query  330  EGEETLWNALF  298
            EG++T+WN  F
Sbjct  418  EGDDTVWNVDF  428



>gb|ADE77778.1| unknown [Picea sitchensis]
Length=335

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGN+YFRHATGQIYAIS+DLATYISIN PILH+YANEDVSLG
Sbjct  205  LAQKGVKYHEPEYWKFGEEGNRYFRHATGQIYAISRDLATYISINSPILHRYANEDVSLG  264

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HIDER+MCCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH  C 
Sbjct  265  AWFIGLDVEHIDERSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKEVHRTCS  324

Query  330  EGEETLWNALF  298
            EG+  +W+ L 
Sbjct  325  EGDGAVWSTLI  335



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  276  LSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+SVE+IK VH +CG
Sbjct  336  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVERIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  396  EGENALWSATF  406



>ref|XP_002970340.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ28470.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=397

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYI+INQPILH++ANEDVSLG
Sbjct  267  LAQKGVKYHEPEYWKFGEDGNRYFRHATGQLYAISKDLATYIAINQPILHQFANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+H+DER+ CCGT PDC+W+AQAGNVCVASFDWSCSGICKSVE++K VHEKCG
Sbjct  327  AWFIGLDVNHVDERSFCCGTSPDCDWQAQAGNVCVASFDWSCSGICKSVERMKIVHEKCG  386

Query  330  EGEETLWNALF  298
            EG+  +WNA+F
Sbjct  387  EGDRAVWNAVF  397



>gb|KFK42176.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=389

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  259  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYISVNQPILHKYANEDVSLG  318

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  319  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  378

Query  330  EGEETLWNALF  298
            EGEE +WNAL 
Sbjct  379  EGEEAVWNALL  389



>ref|XP_003576598.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Brachypodium 
distachyon]
Length=398

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KN KYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYIS+NQP+LHKYANEDVSLG
Sbjct  268  LSDKNSKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISVNQPLLHKYANEDVSLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+H+D+R MCCGTPPDCEWKAQAGNVCVASFDW CSG+C  VE++K+VH +CG
Sbjct  328  AWFIGLDVEHVDDRDMCCGTPPDCEWKAQAGNVCVASFDWRCSGVCNPVERLKYVHSRCG  387

Query  330  EGEETLWNA  304
            EG+E +W A
Sbjct  388  EGDEAIWGA  396



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGNKYFRHATGQIYAISKDLATYISINQ +LH+YANEDVSLG
Sbjct  281  LARKGVRYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQHVLHRYANEDVSLG  340

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CG
Sbjct  341  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIREVHRRCG  400

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  401  EGENALWSAIF  411



>gb|KFK42175.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=386

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  256  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYISVNQPILHKYANEDVSLG  315

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  316  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  375

Query  330  EGEETLWNALF  298
            EGEE +WNAL 
Sbjct  376  EGEEAVWNALL  386



>gb|AGZ15279.1| putative Avr9 elicitor response protein, partial [Taraxacum brevicorniculatum]
Length=392

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQKNVKYHEPE WKFGEEGNKYFRHATGQIYAIS DLA YIS NQPILHK+ANEDVSLG
Sbjct  262  LSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISNDLAAYISTNQPILHKFANEDVSLG  321

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKA+AGNVC+ASFDWSCSGIC+SVE++K VH++CG
Sbjct  322  AWFIGLDVEHIDDRNMCCGTPPDCEWKAEAGNVCIASFDWSCSGICRSVERLKDVHKRCG  381

Query  330  EGEETLWNALF  298
            E    LW+AL+
Sbjct  382  EDPAALWSALY  392



>ref|XP_009106423.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Brassica 
rapa]
Length=386

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLA YIS+NQPILHKYANEDVSLG
Sbjct  256  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAVSKDLAKYISVNQPILHKYANEDVSLG  315

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  316  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  375

Query  330  EGEETLWNALF  298
            EGE+ +WNAL 
Sbjct  376  EGEDAVWNALL  386



>ref|XP_009106424.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Brassica 
rapa]
 emb|CDX87501.1| BnaA07g33720D [Brassica napus]
Length=383

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYA+SKDLA YIS+NQPILHKYANEDVSLG
Sbjct  253  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAVSKDLAKYISVNQPILHKYANEDVSLG  312

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  313  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  372

Query  330  EGEETLWNALF  298
            EGE+ +WNAL 
Sbjct  373  EGEDAVWNALL  383



>emb|CDX88390.1| BnaC06g38340D [Brassica napus]
Length=382

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  252  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLG  311

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  312  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  371

Query  330  EGEETLWNALF  298
            EGE+ +WNAL 
Sbjct  372  EGEDAVWNALL  382



>ref|XP_002968104.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ30358.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=397

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GN+YFRHATGQ+Y ISKDLATYISINQPILH++ANEDVSLG
Sbjct  267  LAQKGVKYHEPEYWKFGEDGNRYFRHATGQLYVISKDLATYISINQPILHQFANEDVSLG  326

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+H DER+ CCGT PDCEW+AQAGNVCVASFDWSCSGICKSVE++K VHEKCG
Sbjct  327  AWFIGLDVNHFDERSFCCGTSPDCEWQAQAGNVCVASFDWSCSGICKSVERMKIVHEKCG  386

Query  330  EGEETLWNALF  298
            EG+  +WNA+F
Sbjct  387  EGDRAVWNAVF  397



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQ+YAIS DLATY+SINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISNDLATYVSINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSV++IK VH +CG
Sbjct  334  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVDRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSAEF  404



>ref|XP_006660681.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Oryza brachyantha]
Length=317

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KN KYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  187  LADKNAKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLG  246

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKAQAGNVC+ASFDW CSG+C  VE++K+VH +C 
Sbjct  247  AWFIGLDVEHIDDRDMCCGTPPDCEWKAQAGNVCIASFDWKCSGVCNPVERLKYVHSRCS  306

Query  330  EGEETLWNALF  298
            EG++ +W+A F
Sbjct  307  EGDDAIWSASF  317



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFG++GNKYFRHATGQ+YAIS+DLATYISINQ +LHKYANEDVSLG
Sbjct  269  LAQKGVRYHEPEHWKFGDDGNKYFRHATGQLYAISRDLATYISINQHVLHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSG+CKSVE++K VH +CG
Sbjct  329  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGVCKSVERMKEVHRRCG  388

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  389  EGEKALWSATF  399



>ref|XP_006592811.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Glycine max]
Length=371

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG
Sbjct  241  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLG  300

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CG
Sbjct  301  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCG  360

Query  330  EGEETLWNALF  298
            EGE+ LWNA F
Sbjct  361  EGEKALWNASF  371



>ref|XP_002529902.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF32456.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=238

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ K VKYHEPE WKFGEEGNKYFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG
Sbjct  108  LAHKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISNDLATYISINQHVLHKYANEDVSLG  167

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVE+IK VH +CG
Sbjct  168  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVERIKEVHGRCG  227

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  228  EGENALWSAEF  238



>ref|XP_001754566.1| predicted protein [Physcomitrella patens]
 gb|EDQ80536.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYI +N+P+LHKYANEDVSLG
Sbjct  261  LAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYIDVNRPLLHKYANEDVSLG  320

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGL+VDHID+R+MCCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++  VH++CG
Sbjct  321  AWIIGLDVDHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERMNDVHQRCG  380

Query  330  EGEETLWNA  304
            EG++ LW+ 
Sbjct  381  EGDDALWST  389



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E+IK VH +CG
Sbjct  334  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSASF  404



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSASF  407



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  273  LAQKGVRYHEPEHWKFGEYGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  332

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDW CSGIC SVE+IK VH +CG
Sbjct  333  SWFIGLDVEHIDDRQLCCGTPPDCEWKAQAGNICVASFDWRCSGICNSVERIKEVHRRCG  392

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  393  EGENALWNAVF  403



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE TLW+A F
Sbjct  397  EGENTLWSATF  407



>ref|NP_001063339.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAD38021.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 dbj|BAF25253.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAG90885.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84687.1| hypothetical protein OsI_31612 [Oryza sativa Indica Group]
 gb|EEE69834.1| hypothetical protein OsJ_29598 [Oryza sativa Japonica Group]
Length=393

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+ KNVKYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG
Sbjct  263  LADKNVKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKAQAGN+CVASFDW CSG+C  VE++K+VH +C 
Sbjct  323  AWFIGLDVEHIDDRDMCCGTPPDCEWKAQAGNICVASFDWKCSGVCNPVERLKYVHSRCS  382

Query  330  EGEETLWNALF  298
            EG++ +W+A F
Sbjct  383  EGDDAIWSASF  393



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE TLW+A F
Sbjct  397  EGENTLWSATF  407



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GNKYFRHATGQ+YAISKDLATYISINQ +LH+YANEDVSLG
Sbjct  274  LAQKGVRYHEPEHWKFGEDGNKYFRHATGQLYAISKDLATYISINQHVLHRYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVE++K VH +CG
Sbjct  334  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSVERMKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSAEF  404



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE TLW+A F
Sbjct  397  EGENTLWSATF  407



>gb|KDP22716.1| hypothetical protein JCGZ_01818 [Jatropha curcas]
Length=303

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  173  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  232

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGICKS ++IK VH +CG
Sbjct  233  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSADRIKEVHRRCG  292

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  293  EGENVLWSATF  303



>ref|XP_010063020.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70193.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=402

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGN+YFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  272  LAQKGVRYHEPEHWKFGEEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  331

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE++K VH +CG
Sbjct  332  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCG  391

Query  330  EGEETLWNALF  298
            EGE  LW+  F
Sbjct  392  EGENVLWSTAF  402



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGN+YFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  273  LAQKGVRYHEPEHWKFGEEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  332

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE++K VH +CG
Sbjct  333  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCG  392

Query  330  EGEETLWNALF  298
            EGE  LW+  F
Sbjct  393  EGENVLWSTAF  403



>ref|XP_009361001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=365

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG
Sbjct  235  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLG  294

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+ +D+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CG
Sbjct  295  SWFIGLDVEQVDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCG  354

Query  330  EGEETLWNALF  298
            EGE  LWNA F
Sbjct  355  EGENALWNAAF  365



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEQGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V+HID+R +CCGTPPDCEWKAQAGNVC ASFDWSCSGIC+S E+IK VH++CG
Sbjct  334  AWFIGVDVEHIDDRRLCCGTPPDCEWKAQAGNVCAASFDWSCSGICRSAERIKEVHQRCG  393

Query  330  EGEETLWNALF  298
            EGE+ LW+A+F
Sbjct  394  EGEKALWSAVF  404



>ref|XP_010252349.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Nelumbo 
nucifera]
Length=397

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA Y+SIN PILH+YANEDVSLG
Sbjct  263  LSQKGVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLAAYVSINAPILHRYANEDVSLG  322

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+HID+R+MCCGTPPDCEWK QAGNVCVASFDWSCSG+CKSVE++K VH  CG
Sbjct  323  SWLIGLEVEHIDDRSMCCGTPPDCEWKTQAGNVCVASFDWSCSGVCKSVERMKDVHNTCG  382

Query  330  EGEETLWNA  304
            EGE  +WN 
Sbjct  383  EGERAVWNV  391



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGN+YFRHATGQIYAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  281  LARKGVRYHEPEYWKFGEEGNRYFRHATGQIYAISKDLATYISINQHVLHKYANEDVSLG  340

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+++ VH +CG
Sbjct  341  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERVREVHRRCG  400

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  401  EGENALWSATF  411



>emb|CAN63417.1| hypothetical protein VITISV_007689 [Vitis vinifera]
Length=373

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  243  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  302

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CG
Sbjct  303  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCG  362

Query  330  EGEETLWNALF  298
            EGE  +W+A+F
Sbjct  363  EGENAVWSAVF  373



>ref|XP_002524194.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF38209.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=374

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  244  LNQKGVRYHEPEFWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  303

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  304  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  363

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  364  EGENALWSATF  374



>ref|XP_004956987.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Setaria italica]
Length=392

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS KN KYHEPE WKFGE+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG
Sbjct  262  LSDKNAKYHEPEFWKFGEDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  321

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R MCCGTPPDCEWKAQAG+VCVASFDW CSG+C  VE++K+VH +C 
Sbjct  322  AWFIGLDVEHIDDRDMCCGTPPDCEWKAQAGSVCVASFDWKCSGVCNPVERLKYVHSRCS  381

Query  330  EGEETLWNALF  298
            EGE+ +W+  F
Sbjct  382  EGEDAIWSTSF  392



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+ ID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CG
Sbjct  334  SWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  394  EGENALWNAVF  404



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  278  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  338  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE+ LW A F
Sbjct  398  EGEKALWRATF  408



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  275  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  335  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE+ LW A F
Sbjct  395  EGEKALWRATF  405



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAIS+DLATYISINQ +LHKY NEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W +GL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  337  SWLLGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  397  EGENALWSAVF  407



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAIS+DLATYISINQ +LHKY NEDVSLG
Sbjct  276  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W +GL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CG
Sbjct  336  SWLLGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  396  EGENALWSAVF  406



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GNKYFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG
Sbjct  265  LAQKGVRYHEPEHWKFGEDGNKYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R MCCGTPPDCEWKAQ GN+CVASFDWSCSGICKSV++IK VH +CG
Sbjct  325  SWFIGLDVEHIDDRKMCCGTPPDCEWKAQTGNICVASFDWSCSGICKSVDRIKEVHRRCG  384

Query  330  EGEETLWNALF  298
            EGE  LW+ +F
Sbjct  385  EGENALWSTVF  395



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  273  LARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  332

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+ ID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGICKS E+IK VH +CG
Sbjct  333  SWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCG  392

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  393  EGENALWNAVF  403



>gb|KEH29682.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=349

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYIS NQ +LHKYANEDVS+G
Sbjct  219  LSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIG  278

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  279  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  338

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  339  EGENALWSASF  349



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  278  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  338  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE+ LW A F
Sbjct  398  EGEKALWRATF  408



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+ ID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGICKS E+IK VH +CG
Sbjct  334  SWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  394  EGENALWNAVF  404



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG
Sbjct  279  LAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLG  338

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CG
Sbjct  339  SWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCG  398

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  399  EGENALWNAVF  409



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  275  LNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  335  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE+ LW A F
Sbjct  395  EGEKALWRATF  405



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG
Sbjct  279  LAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLG  338

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CG
Sbjct  339  SWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCG  398

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  399  EGENALWNAVF  409



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGICKS E+IK VH +CG
Sbjct  337  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSATF  407



>ref|XP_006592810.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=383

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG
Sbjct  253  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLG  312

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CG
Sbjct  313  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCG  372

Query  330  EGEETLWNALF  298
            EGE+ LWNA F
Sbjct  373  EGEKALWNASF  383



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGICKS E+IK VH +CG
Sbjct  334  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSAERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSATF  404



>ref|XP_006301157.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
 gb|EOA34055.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
Length=395

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG
Sbjct  265  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  325  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  384

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  385  EGEGAVWNTLL  395



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CG
Sbjct  337  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCG  396

Query  330  EGEETLWNALF  298
            EGE+ LWNA F
Sbjct  397  EGEKALWNASF  407



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH +CG
Sbjct  337  SWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSARF  407



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH +CG
Sbjct  334  SWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSARF  404



>ref|XP_009612460.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=398

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG
Sbjct  268  LAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCE KAQAGN+CVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLDVEHIDDRKLCCGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHSRCG  387

Query  330  EGEETLWNALF  298
            EGE  LW+A+F
Sbjct  388  EGENALWSAIF  398



>gb|KJB26942.1| hypothetical protein B456_004G268200 [Gossypium raimondii]
Length=391

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LS+K VKYHEPE WKFGE+GNKYFRHATGQIY ISKDLA YISIN PILH+YANEDVSLG
Sbjct  261  LSEKGVKYHEPEYWKFGEDGNKYFRHATGQIYGISKDLAAYISINSPILHRYANEDVSLG  320

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+H+D+R+MCCGTPPDCEWKAQAGN+CVASFDWSCSG+CKSVEK+K+VH  CG
Sbjct  321  SWLIGLEVEHVDDRSMCCGTPPDCEWKAQAGNICVASFDWSCSGVCKSVEKMKYVHNSCG  380

Query  330  EGEETLWNALF  298
            EG+  +W + F
Sbjct  381  EGDSGIWKSDF  391



>ref|XP_006304048.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
 gb|EOA36946.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
Length=303

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  173  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  232

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWK QAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  233  AWFIGIDVKHIDDRRLCCGTPPDCEWKTQAGNICVASFDWSCSGICRSADRIKEVHRRCG  292

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  293  EGEKALWSATF  303



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LH+YANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHRYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSASF  407



>ref|NP_974164.2| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 gb|AEE36030.1| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
Length=384

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG
Sbjct  254  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLG  313

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  314  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  373

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  374  EGEGAVWNTLL  384



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ ILHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E++K VH +CG
Sbjct  337  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  L +A+F
Sbjct  397  EGENALLSAVF  407



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+Q+ V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YIS+NQ +LHKYANEDVSLG
Sbjct  275  LAQRGVRYHEPEHWKFGEPGNKYFRHATGQLYAISKDLASYISVNQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SV++IK VH +CG
Sbjct  335  SWFIGLDVRHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSVDRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE+ +W A+F
Sbjct  395  EGEDAIWKAVF  405



>gb|AHL38868.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG
Sbjct  257  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLG  316

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  317  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  376

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  377  EGEGAVWNTLL  387



>gb|KDO54673.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=303

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GN+YFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG
Sbjct  173  LNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLG  232

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  233  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  292

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  293  EGENALWSATF  303



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG
Sbjct  273  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLG  332

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+ +D+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CG
Sbjct  333  SWFIGLDVEQVDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCG  392

Query  330  EGEETLWNALF  298
            EGE  LWNA F
Sbjct  393  EGENALWNAAF  403



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA YIS N+ +LHKYANEDVSLG
Sbjct  278  LSQKGVRYHEPEHWKFGENGNKYFRHATGQLYAISKDLAAYISTNKHVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+VDHID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH+KCG
Sbjct  338  AWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKKCG  397

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  398  EGEKALWSASF  408



>ref|XP_002889162.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65421.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG
Sbjct  265  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVSLG  324

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  325  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  384

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  385  EGEGAVWNTLL  395



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  334  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSASF  404



>ref|XP_009397181.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC S E+IK VH +CG
Sbjct  335  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE+T+W A+F
Sbjct  395  EGEKTVWKAVF  405



>gb|AAG51626.1|AC012193_8 putative (Avr9) elicitor response protein; 70358-68256 [Arabidopsis 
thaliana]
Length=390

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG
Sbjct  260  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLG  319

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  320  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  379

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  380  EGEGAVWNTLL  390



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  337  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSASF  407



>ref|XP_006447567.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 gb|ESR60807.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=303

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GN+YFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG
Sbjct  173  LNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLG  232

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  233  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  292

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  293  EGENALWSATF  303



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CG
Sbjct  335  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE  +W+A+F
Sbjct  395  EGENAVWSAVF  405



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATY+SINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYVSINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH +CG
Sbjct  337  SWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSARF  407



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG
Sbjct  276  LSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  336  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  396  EGENVLWSASF  406



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSASF  407



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG
Sbjct  276  LSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  336  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  396  EGENVLWSASF  406



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATY+SINQ +LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYVSINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH +CG
Sbjct  334  SWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSARF  404



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  275  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  335  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  395  EGEKALWSATF  405



>ref|XP_006475058.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475059.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO62742.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=367

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLA+YISINQ +LHK+ANEDVSLG
Sbjct  237  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLG  296

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E++K VH +CG
Sbjct  297  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCG  356

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  357  EGENALWSAAF  367



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ ILHKYANEDVSLG
Sbjct  282  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLG  341

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E++K VH +CG
Sbjct  342  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCG  401

Query  330  EGEETLWNALF  298
            EGE  L +A+F
Sbjct  402  EGENALLSAVF  412



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  282  LAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  341

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN CVASFDWSCSGICKS E+I+ VH +CG
Sbjct  342  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICKSAERIRDVHRRCG  401

Query  330  EGEETLWNALF  298
            EGE  LW A F
Sbjct  402  EGENALWGANF  412



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  278  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  338  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  398  EGEKALWSATF  408



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  276  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  336  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  396  EGEKALWSATF  406



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  279  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  338

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  339  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  398

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  399  EGEKALWSATF  409



>gb|ACL53751.1| unknown [Zea mays]
 gb|AFW84406.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=412

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFG+EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLG
Sbjct  282  LSQKGVKYHEPEYWKFGDEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLG  341

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+H+D+R+MCC TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CG
Sbjct  342  AWLIGLEVEHVDDRSMCCATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACG  401

Query  330  EGEETLWNA  304
            EGE  +WNA
Sbjct  402  EGEGAVWNA  410



>ref|NP_001149873.1| LOC100283501 [Zea mays]
 gb|ACG37060.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=415

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFG+EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLG
Sbjct  285  LSQKGVKYHEPEYWKFGDEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLG  344

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+H+D+R+MCC TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CG
Sbjct  345  AWLIGLEVEHVDDRSMCCATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACG  404

Query  330  EGEETLWNA  304
            EGE  +WNA
Sbjct  405  EGEGAVWNA  413



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEHGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC S ++IK VH +CG
Sbjct  335  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE  LWN+ F
Sbjct  395  EGETVLWNSAF  405



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GNKYFRHATGQ+YAIS+DLATYIS NQ  LHKYANEDVSLG
Sbjct  274  LAQKGVRYHEPEYWKFGEQGNKYFRHATGQLYAISRDLATYISKNQHFLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDWSCSGIC S ++IK VH +CG
Sbjct  334  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICNSADRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE TLWN  F
Sbjct  394  EGEHTLWNTAF  404



>ref|XP_002979099.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ20056.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=387

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+Y ISKDLATYIS N+PILHKYANEDVSLG
Sbjct  246  LAQKGVRYHEPEYWKFGEQGNRYFRHATGQLYVISKDLATYISANEPILHKYANEDVSLG  305

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+RTMCCGTPPDCEWKAQAGN CVASFDWSCSGICKS E+I  VH +CG
Sbjct  306  AWFIGLDVEHIDDRTMCCGTPPDCEWKAQAGNACVASFDWSCSGICKSAERIHEVHSRCG  365

Query  330  EGEETLWN  307
            EGE+ LWN
Sbjct  366  EGEQALWN  373



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YISINQ +LHKYANEDVSLG
Sbjct  274  LSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+H+D+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  334  SWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGENALWSATF  404



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YISINQ +LHKYANEDVSLG
Sbjct  275  LSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+H+D+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  335  SWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  395  EGENALWSATF  405



>ref|XP_009782227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG
Sbjct  268  LAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLG  327

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+H+D+R +CCGTPPDCE KAQAGN+CVASFDWSCSGICKSVE+IK VH +CG
Sbjct  328  SWFIGLDVEHVDDRKLCCGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHRRCG  387

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  388  EGENALWSAAF  398



>ref|XP_006390051.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
 gb|ESQ27337.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
Length=388

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLA YISINQ ILHKYANEDVSLG
Sbjct  258  LAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLAKYISINQQILHKYANEDVSLG  317

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VH+ C 
Sbjct  318  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHQVCS  377

Query  330  EGEETLWNALF  298
            EGE  +WNAL 
Sbjct  378  EGEGAVWNALL  388



>ref|XP_009398227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYIS+NQ +LHKYANEDVSLG
Sbjct  283  LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISMNQHVLHKYANEDVSLG  342

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC S E+IK VH +CG
Sbjct  343  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCG  402

Query  330  EGEETLWNALF  298
            EG+  L NA+F
Sbjct  403  EGKNALLNAVF  413



>ref|XP_010428866.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Camelina 
sativa]
Length=396

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  326  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  385

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  386  EGEGAVWNTLL  396



>ref|XP_004970763.1| PREDICTED: probable beta-1,3-galactosyltransferase 8-like [Setaria 
italica]
Length=402

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFG+EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLG
Sbjct  272  LSQKGVKYHEPEYWKFGDEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLG  331

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+H+D+R+MCC TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CG
Sbjct  332  AWLIGLEVEHVDDRSMCCATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACG  391

Query  330  EGEETLWN  307
            EGE  +WN
Sbjct  392  EGEGAVWN  399



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE+GN+YFRHATGQ+YAISKDLATYIS+NQ +LHKY NEDVSLG
Sbjct  278  LAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISLNQHVLHKYVNEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CG
Sbjct  338  SWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE  LWNA F
Sbjct  398  EGENALWNASF  408



>ref|XP_004162968.1| PREDICTED: probable beta-1,3-galactosyltransferase 6-like, partial 
[Cucumis sativus]
Length=199

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQIYAISKDLATYIS+N+PILHK+ANEDVSLG
Sbjct  69   LAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRPILHKFANEDVSLG  128

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R++CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CG
Sbjct  129  SWFIGLDVEHIDDRSLCCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCG  188

Query  330  EGEETLWNALF  298
            EG+E +W+  F
Sbjct  189  EGDEAIWHTSF  199



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  337  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  397  EGEKALWSATF  407



>ref|XP_010471981.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X5 [Camelina 
sativa]
Length=396

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  266  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLG  325

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  326  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  385

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  386  EGEGAVWNTLL  396



>ref|XP_010471980.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Camelina 
sativa]
Length=399

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  269  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  329  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  388

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  389  EGEGAVWNTLL  399



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  250  LAQKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYISINQDVLHKYANEDVSLG  309

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDH+D+R MCCGTPPDCEWKAQAGNVCVASFDW CSGIC+SVE++K VH +CG
Sbjct  310  SWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNVCVASFDWKCSGICRSVERMKEVHLRCG  369

Query  330  EGEETLWNA  304
            E E  LW+A
Sbjct  370  EDENALWSA  378



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  274  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  334  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  394  EGEKALWSATF  404



>ref|XP_010428865.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Camelina 
sativa]
Length=399

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG
Sbjct  269  LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLG  328

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGLEV+HID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C 
Sbjct  329  SWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCS  388

Query  330  EGEETLWNALF  298
            EGE  +WN L 
Sbjct  389  EGEGAVWNTLL  399



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  337  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  397  EGEKALWSATF  407



>ref|XP_010655390.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI23239.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK VKYHEPE WKFGEEGNKYFRHATGQ+YAISK+LATYISIN+ +LHKYANEDVSLG
Sbjct  278  LAQKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISKNLATYISINRHVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKA+AGNVCVASFDWSCSGIC+S E++K VH++CG
Sbjct  338  SWFIGLDVEHIDDRRLCCGTPPDCEWKAEAGNVCVASFDWSCSGICRSSERMKDVHQRCG  397

Query  330  EGEETLWNALF  298
            EG+  LW+A+F
Sbjct  398  EGKNALWSAVF  408



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYIS NQ +LHKYANEDVS+G
Sbjct  278  LSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH++CG
Sbjct  338  AWFIGLDVEHIDDRRICCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHKRCG  397

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  398  EGENALWSASF  408



>gb|KHN03478.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=334

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAIS+DLATYISINQ +LHKYANEDVSLG
Sbjct  204  LAQKGVRYHEPEYWKFGEVGNKYFRHATGQLYAISQDLATYISINQGMLHKYANEDVSLG  263

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDH+D+R MCCGTPPDCEWKAQAGN+CVASFDW CSGIC+SVE++K VH++CG
Sbjct  264  SWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNICVASFDWKCSGICRSVERMKEVHQRCG  323

Query  330  EGEETLWNALF  298
            E E  LW+  F
Sbjct  324  EDENALWSGTF  334



>ref|XP_010231346.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Brachypodium 
distachyon]
Length=405

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPESWKFG+EGNKYFRHATGQIYAIS+DLA+YISINQPILH++ANEDVSLG
Sbjct  274  LSQKGVKYHEPESWKFGDEGNKYFRHATGQIYAISRDLASYISINQPILHRFANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AW IGLEV+HID+R++CC TPPDCEWK QAGNVC ASFDWSCSGICKSV++++ +H  CG
Sbjct  334  AWLIGLEVEHIDDRSLCCATPPDCEWKKQAGNVCAASFDWSCSGICKSVDRMRAIHSACG  393

Query  330  EGEETLWN  307
            EG+  +WN
Sbjct  394  EGDGAVWN  401



>ref|XP_010910268.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Elaeis 
guineensis]
Length=409

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK VKYHEPE WKFGEE NKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG
Sbjct  279  LSQKGVKYHEPEFWKFGEEKNKYFRHATGQIYAISKDLAAYISINAPILHRYANEDVSLG  338

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGLEV+HID+R MCCGTPPDCEWK QAGNVCVASFDWSCSG+CKSVE++K VH  CG
Sbjct  339  SWLIGLEVEHIDDRMMCCGTPPDCEWKMQAGNVCVASFDWSCSGVCKSVERMKDVHNSCG  398

Query  330  EGEETLWNALF  298
            EG+  +WN + 
Sbjct  399  EGDGAIWNVVI  409



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG
Sbjct  276  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISNDLATYISINQDVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  336  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCG  395

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  396  EGENALWSASF  406



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQIYAISKDLA+YIS+NQ +LHKYANEDVSLG
Sbjct  276  LAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLG  335

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+SV+++K VH++CG
Sbjct  336  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCG  395

Query  330  EGEETLWNA  304
            EGE+ LW A
Sbjct  396  EGEKALWKA  404



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YISINQ +LHKYANEDVSLG
Sbjct  275  LSQKGVRYHEPEFWKFGESGNKYFRHATGQLYAISKDLASYISINQNVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  335  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE  LW + F
Sbjct  395  EGENALWRSAF  405



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQIYAISKDLA+YIS+NQ +LHKYANEDVSLG
Sbjct  278  LAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V HID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+SV+++K VH++CG
Sbjct  338  AWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCG  397

Query  330  EGEETLWNA  304
            EGE+ LW A
Sbjct  398  EGEKALWKA  406



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YISINQ +LHKYANEDVSLG
Sbjct  278  LSQKGVRYHEPEFWKFGESGNKYFRHATGQLYAISKDLASYISINQNVLHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CG
Sbjct  338  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE  LW + F
Sbjct  398  EGENALWRSAF  408



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG
Sbjct  277  LAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLARYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGN CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  337  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  397  EGENALWNAVF  407



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQIYAIS+DLA+YISINQ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIG++V HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  337  AWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  396

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  397  EGENALWSATF  407



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQ+ V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG
Sbjct  279  LSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLG  338

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CG
Sbjct  339  SWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCG  398

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  399  EGENVLWSATF  409



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQ+ V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG
Sbjct  278  LSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CG
Sbjct  338  SWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  398  EGENVLWSATF  408



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L++K V+YHEPE WKFGEEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG
Sbjct  281  LARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLG  340

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            AWFIGL+V+HID+R +CCGTPPDCEWKAQAGN CVASFDWSCSGICKS E+I+ VH +CG
Sbjct  341  AWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICKSAERIREVHRRCG  400

Query  330  EGEETLWNALF  298
            EG+  LW+A F
Sbjct  401  EGKNALWSANF  411



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CG
Sbjct  337  SWFIGLDVNHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCG  396

Query  330  EGEETLWNALF  298
            EGE+ LWNA F
Sbjct  397  EGEKALWNASF  407



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG
Sbjct  277  LSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLG  336

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+VDHID+R +CCGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CG
Sbjct  337  SWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCG  396

Query  330  EGEETLWNALF  298
            EGE+ LW+A F
Sbjct  397  EGEKALWSASF  407



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            L+QK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG
Sbjct  275  LAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLARYISINQHVLHKYANEDVSLG  334

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+ +HID+R +CCGTPPDCEWKAQAGN CVASFDWSCSGIC+S E+IK VH +CG
Sbjct  335  SWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRCG  394

Query  330  EGEETLWNALF  298
            EGE  LWNA+F
Sbjct  395  EGENALWNAVF  405



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQK V+YHEPE WKFGE GNKYFRHATGQ+YAISKDLA+YISIN+ +LHKYANEDVSLG
Sbjct  274  LSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISINRHVLHKYANEDVSLG  333

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +WFIGL+V+HID+R +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CG
Sbjct  334  SWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCG  393

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  394  EGETALWSATF  404



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LSQKNVKYHEPESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG  511
            LSQ+ V+YHEPE WKFGE GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG
Sbjct  278  LSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLG  337

Query  510  AWFIGLEVDHIDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCG  331
            +W IGL+V+HID+R +CCGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CG
Sbjct  338  SWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCG  397

Query  330  EGEETLWNALF  298
            EGE  LW+A F
Sbjct  398  EGENVLWSATF  408



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520