BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040I14

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB80507.1|  hypothetical protein B456_013G101400                    299   3e-96   Gossypium raimondii
gb|KJB80505.1|  hypothetical protein B456_013G101400                    299   3e-96   Gossypium raimondii
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...    299   5e-96   Nicotiana tomentosiformis
emb|CDP10795.1|  unnamed protein product                                298   2e-95   Coffea canephora [robusta coffee]
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    297   2e-95   Nicotiana sylvestris
ref|XP_006592811.1|  PREDICTED: probable beta-1,3-galactosyltrans...    295   3e-95   
ref|XP_006375531.1|  hypothetical protein POPTR_0014s15200g             293   6e-95   
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...    296   7e-95   Camelina sativa [gold-of-pleasure]
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    296   7e-95   Solanum tuberosum [potatoes]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...    296   8e-95   Camelina sativa [gold-of-pleasure]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    296   9e-95   Solanum tuberosum [potatoes]
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...    296   9e-95   Camelina sativa [gold-of-pleasure]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...    295   9e-95   Camelina sativa [gold-of-pleasure]
ref|XP_006304048.1|  hypothetical protein CARUB_v10009858mg             292   1e-94   
ref|XP_006447567.1|  hypothetical protein CICLE_v10015443mg             291   1e-94   
gb|KDO54673.1|  hypothetical protein CISIN_1g015407mg                   291   1e-94   Citrus sinensis [apfelsine]
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    295   1e-94   Populus euphratica
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2          295   2e-94   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2             295   2e-94   
gb|KDP22716.1|  hypothetical protein JCGZ_01818                         291   2e-94   Jatropha curcas
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    295   2e-94   Populus euphratica
ref|XP_002892271.1|  galactosyltransferase family protein               295   2e-94   Arabidopsis lyrata subsp. lyrata
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...    295   2e-94   Gossypium arboreum [tree cotton]
ref|XP_006592810.1|  PREDICTED: probable beta-1,3-galactosyltrans...    294   2e-94   
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...    295   2e-94   Glycine max [soybeans]
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...    294   3e-94   Glycine max [soybeans]
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...    294   3e-94   Solanum lycopersicum
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...    294   3e-94   Sesamum indicum [beniseed]
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    294   3e-94   Solanum lycopersicum
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g             294   4e-94   Populus trichocarpa [western balsam poplar]
ref|XP_002320464.1|  galactosyltransferase family protein               294   5e-94   Populus trichocarpa [western balsam poplar]
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg                293   6e-94   Erythranthe guttata [common monkey flower]
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   1e-93   Citrus sinensis [apfelsine]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   1e-93   Citrus sinensis [apfelsine]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg             293   1e-93   Citrus clementina [clementine]
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                   293   1e-93   Citrus sinensis [apfelsine]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                   293   1e-93   Citrus sinensis [apfelsine]
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                   293   1e-93   Citrus sinensis [apfelsine]
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg             293   1e-93   Eutrema salsugineum [saltwater cress]
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    292   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   2e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   2e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    291   5e-93   Tarenaya hassleriana [spider flower]
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...    291   5e-93   
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative     290   5e-93   
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                    291   6e-93   Arabis alpina [alpine rockcress]
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg             291   7e-93   Prunus persica
ref|XP_009397181.1|  PREDICTED: probable beta-1,3-galactosyltrans...    291   7e-93   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   8e-93   Sesamum indicum [beniseed]
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   8e-93   Tarenaya hassleriana [spider flower]
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...    291   8e-93   Solanum tuberosum [potatoes]
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg             291   8e-93   Prunus persica
ref|XP_009361001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   1e-92   Pyrus x bretschneideri [bai li]
emb|CDY12206.1|  BnaC04g12360D                                          290   1e-92   Brassica napus [oilseed rape]
gb|KEH29682.1|  beta-1,3-galactosyltransferase-like protein             288   1e-92   Medicago truncatula
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   1e-92   Glycine max [soybeans]
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2               290   1e-92   Glycine soja [wild soybean]
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   1e-92   Prunus mume [ume]
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   1e-92   Prunus mume [ume]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   1e-92   Elaeis guineensis
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   1e-92   Cucumis melo [Oriental melon]
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    290   1e-92   
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Tarenaya hassleriana [spider flower]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Cucumis sativus [cucumbers]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Nicotiana tomentosiformis
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Nicotiana sylvestris
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Phoenix dactylifera
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...    290   2e-92   Eucalyptus grandis [rose gum]
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   2e-92   Fragaria vesca subsp. vesca
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   2e-92   
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   3e-92   Solanum lycopersicum
gb|KDP39142.1|  hypothetical protein JCGZ_00899                         289   3e-92   Jatropha curcas
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   3e-92   Nelumbo nucifera [Indian lotus]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   3e-92   Fragaria vesca subsp. vesca
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g             289   3e-92   Phaseolus vulgaris [French bean]
emb|CDY48266.1|  BnaA05g10880D                                          289   3e-92   Brassica napus [oilseed rape]
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   4e-92   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   4e-92   Brassica rapa
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   4e-92   Brassica rapa
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410          289   4e-92   Amborella trichopoda
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...    289   4e-92   Cicer arietinum [garbanzo]
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2          289   4e-92   
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg             288   5e-92   
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   5e-92   Glycine max [soybeans]
emb|CAN63417.1|  hypothetical protein VITISV_007689                     287   5e-92   Vitis vinifera
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   6e-92   Populus euphratica
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   6e-92   Populus euphratica
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg             288   6e-92   Eutrema salsugineum [saltwater cress]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   6e-92   Pyrus x bretschneideri [bai li]
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g             288   7e-92   Populus trichocarpa [western balsam poplar]
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   7e-92   Prunus mume [ume]
emb|CDP05735.1|  unnamed protein product                                288   1e-91   Coffea canephora [robusta coffee]
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg                288   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   1e-91   Vitis vinifera
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   1e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   1e-91   Vitis vinifera
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   1e-91   Brassica rapa
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    287   1e-91   Nelumbo nucifera [Indian lotus]
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...    287   1e-91   Vitis vinifera
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...    288   1e-91   Brassica rapa
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg             287   1e-91   Citrus clementina [clementine]
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein             287   1e-91   Medicago truncatula
emb|CDY46836.1|  BnaA10g03200D                                          287   2e-91   Brassica napus [oilseed rape]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...    287   2e-91   Citrus sinensis [apfelsine]
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg             287   2e-91   Capsella rubella
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   2e-91   Nicotiana sylvestris
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g             286   3e-91   Phaseolus vulgaris [French bean]
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   3e-91   Nicotiana sylvestris
emb|CDY49507.1|  BnaC05g03190D                                          286   3e-91   Brassica napus [oilseed rape]
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   3e-91   Malus domestica [apple tree]
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   3e-91   Malus domestica [apple tree]
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...    286   3e-91   Vitis vinifera
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   4e-91   Pyrus x bretschneideri [bai li]
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...    286   4e-91   Pyrus x bretschneideri [bai li]
ref|XP_004167799.1|  PREDICTED: probable beta-1,3-galactosyltrans...    278   6e-91   
ref|XP_002529902.1|  Beta-1,3-galactosyltransferase sqv-2, putative     280   6e-91   
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   7e-91   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB80508.1|  hypothetical protein B456_013G101400                    285   8e-91   Gossypium raimondii
gb|KGN63249.1|  hypothetical protein Csa_2G418850                       285   9e-91   Cucumis sativus [cucumbers]
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   9e-91   Camelina sativa [gold-of-pleasure]
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2          285   9e-91   Morus notabilis
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   9e-91   Malus domestica [apple tree]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   9e-91   
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Cucumis melo [Oriental melon]
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Malus domestica [apple tree]
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Camelina sativa [gold-of-pleasure]
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Fragaria vesca subsp. vesca
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Fragaria vesca subsp. vesca
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   1e-90   Setaria italica
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   2e-90   
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    285   2e-90   
gb|EPS73703.1|  hypothetical protein M569_01053                         278   2e-90   Genlisea aurea
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...    284   2e-90   Solanum tuberosum [potatoes]
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...    284   3e-90   Camelina sativa [gold-of-pleasure]
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...    284   3e-90   Camelina sativa [gold-of-pleasure]
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...    284   3e-90   Camelina sativa [gold-of-pleasure]
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    284   3e-90   
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   4e-90   Eucalyptus grandis [rose gum]
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   4e-90   Eucalyptus grandis [rose gum]
ref|XP_009624798.1|  PREDICTED: probable beta-1,3-galactosyltrans...    282   5e-90   Nicotiana tomentosiformis
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   5e-90   Solanum lycopersicum
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   5e-90   Solanum lycopersicum
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   5e-90   Cicer arietinum [garbanzo]
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    283   6e-90   
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   7e-90   Pyrus x bretschneideri [bai li]
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   8e-90   Nicotiana tomentosiformis
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   8e-90   Pyrus x bretschneideri [bai li]
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    283   8e-90   Nicotiana tomentosiformis
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3             283   9e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879388.1|  galactosyltransferase family protein               283   9e-90   Arabidopsis lyrata subsp. lyrata
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    282   1e-89   Nicotiana sylvestris
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2               280   2e-89   Glycine soja [wild soybean]
ref|XP_006351966.1|  PREDICTED: probable beta-1,3-galactosyltrans...    281   3e-89   Solanum tuberosum [potatoes]
ref|XP_006351967.1|  PREDICTED: probable beta-1,3-galactosyltrans...    281   3e-89   Solanum tuberosum [potatoes]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g             280   4e-89   Phaseolus vulgaris [French bean]
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...    280   4e-89   Glycine max [soybeans]
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...    281   4e-89   Cucumis sativus [cucumbers]
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    280   8e-89   Nicotiana tomentosiformis
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    280   8e-89   
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...    280   1e-88   Elaeis guineensis
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...    280   2e-88   Vitis vinifera
ref|NP_001141034.1|  hypothetical protein                               278   2e-88   Zea mays [maize]
ref|XP_007020793.1|  Galactosyltransferase family protein               278   4e-88   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...    279   4e-88   Gossypium arboreum [tree cotton]
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960          278   4e-88   Sorghum bicolor [broomcorn]
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                  278   5e-88   Medicago truncatula
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1         278   9e-88   Zea mays [maize]
ref|XP_006452383.1|  hypothetical protein CICLE_v10008439mg             274   1e-87   
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    277   1e-87   Oryza brachyantha
gb|KJB57752.1|  hypothetical protein B456_009G178900                    276   1e-87   Gossypium raimondii
gb|KJB13704.1|  hypothetical protein B456_002G089700                    276   1e-87   Gossypium raimondii
gb|KDP20741.1|  hypothetical protein JCGZ_21212                         276   2e-87   Jatropha curcas
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1     277   2e-87   
ref|NP_001050543.1|  Os03g0577500                                       276   2e-87   
gb|KJB57747.1|  hypothetical protein B456_009G178900                    276   2e-87   Gossypium raimondii
gb|KJB13705.1|  hypothetical protein B456_002G089700                    275   2e-87   Gossypium raimondii
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...    275   3e-87   Cicer arietinum [garbanzo]
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...    276   3e-87   Sesamum indicum [beniseed]
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative     275   3e-87   Ricinus communis
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...    276   4e-87   Gossypium arboreum [tree cotton]
gb|EPS64555.1|  hypothetical protein M569_10226                         275   5e-87   Genlisea aurea
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...    275   7e-87   Brachypodium distachyon [annual false brome]
gb|KJB13702.1|  hypothetical protein B456_002G089700                    275   1e-86   Gossypium raimondii
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2          275   1e-86   Morus notabilis
gb|KJB69212.1|  hypothetical protein B456_011G013600                    273   1e-86   Gossypium raimondii
gb|KDO78242.1|  hypothetical protein CISIN_1g015962mg                   273   1e-86   Citrus sinensis [apfelsine]
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    274   2e-86   Vitis vinifera
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg             275   2e-86   
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    274   2e-86   Vitis vinifera
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...    274   2e-86   Tarenaya hassleriana [spider flower]
gb|KDO78243.1|  hypothetical protein CISIN_1g015962mg                   271   2e-86   Citrus sinensis [apfelsine]
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...    274   2e-86   Gossypium arboreum [tree cotton]
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...    274   3e-86   
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    275   4e-86   
ref|XP_006449734.1|  hypothetical protein CICLE_v10015441mg             271   4e-86   
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...    273   6e-86   Citrus sinensis [apfelsine]
ref|NP_001183433.1|  uncharacterized protein LOC100501859               266   6e-86   
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...    272   7e-86   Citrus sinensis [apfelsine]
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2     273   8e-86   
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                272   8e-86   Erythranthe guttata [common monkey flower]
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1     272   9e-86   
gb|KCW70545.1|  hypothetical protein EUGRSUZ_F03738                     269   1e-85   Eucalyptus grandis [rose gum]
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                271   1e-85   Erythranthe guttata [common monkey flower]
gb|KJB69211.1|  hypothetical protein B456_011G013600                    272   1e-85   Gossypium raimondii
gb|KJB69210.1|  hypothetical protein B456_011G013600                    272   2e-85   Gossypium raimondii
ref|XP_006449733.1|  hypothetical protein CICLE_v10015441mg             272   2e-85   
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...    271   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative     271   2e-85   Ricinus communis
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4         272   2e-85   
ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    268   2e-85   Nicotiana tomentosiformis
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    268   3e-85   Nicotiana sylvestris
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     269   4e-85   Eucalyptus grandis [rose gum]
ref|NP_001149120.1|  beta-1,3-galactosyltransferase sqv-2               270   4e-85   
gb|KDP25226.1|  hypothetical protein JCGZ_20382                         271   4e-85   Jatropha curcas
ref|XP_002977391.1|  glycosyltransferase-like protein                   271   4e-85   Selaginella moellendorffii
ref|XP_006364961.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    268   4e-85   Solanum tuberosum [potatoes]
gb|KHN35737.1|  Putative beta-1,3-galactosyltransferase 2               261   4e-85   Glycine soja [wild soybean]
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   5e-85   Sesamum indicum [beniseed]
ref|XP_001781844.1|  predicted protein                                  269   6e-85   
ref|XP_002974972.1|  glycosyltransferase-like protein                   270   6e-85   Selaginella moellendorffii
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400          270   7e-85   Sorghum bicolor [broomcorn]
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        270   8e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    270   8e-85   Nicotiana tomentosiformis
ref|XP_001758882.1|  predicted protein                                  270   1e-84   
ref|NP_001045990.1|  Os02g0164300                                       262   1e-84   
ref|XP_006439187.1|  hypothetical protein CICLE_v10020627mg             266   1e-84   
gb|KDO76779.1|  hypothetical protein CISIN_1g021312mg                   266   1e-84   Citrus sinensis [apfelsine]
emb|CAA06925.1|  Avr9 elicitor response protein                         269   1e-84   Nicotiana tabacum [American tobacco]
ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    269   1e-84   Nicotiana sylvestris
emb|CAB36540.1|  Avr9 elicitor response like protein                    269   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439188.1|  hypothetical protein CICLE_v10020627mg             263   2e-84   
ref|XP_002867534.1|  galactosyltransferase family protein               269   2e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    269   2e-84   Eucalyptus grandis [rose gum]
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    269   2e-84   Eucalyptus grandis [rose gum]
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4             269   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...    269   2e-84   Populus euphratica
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         269   2e-84   Jatropha curcas
gb|KJB62840.1|  hypothetical protein B456_009G440200                    268   2e-84   Gossypium raimondii
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    268   2e-84   Eucalyptus grandis [rose gum]
gb|KJB62839.1|  hypothetical protein B456_009G440200                    268   2e-84   Gossypium raimondii
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    269   2e-84   Elaeis guineensis
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    269   2e-84   Setaria italica
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    269   2e-84   
gb|KJB64380.1|  hypothetical protein B456_010G046600                    266   2e-84   Gossypium raimondii
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    268   2e-84   Eucalyptus grandis [rose gum]
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          268   2e-84   Amborella trichopoda
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   268   3e-84   Morus notabilis
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...    269   3e-84   Nicotiana tomentosiformis
ref|XP_001779676.1|  predicted protein                                  268   4e-84   
dbj|BAJ89733.1|  predicted protein                                      268   4e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    268   4e-84   Solanum lycopersicum
dbj|BAJ89822.1|  predicted protein                                      268   4e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    268   4e-84   Solanum tuberosum [potatoes]
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                        266   5e-84   Glycine soja [wild soybean]
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    268   5e-84   Elaeis guineensis
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2               268   6e-84   Triticum urartu
ref|XP_003601132.1|  Avr9 elicitor response protein                     267   6e-84   Medicago truncatula
ref|XP_003601133.1|  Avr9 elicitor response protein                     267   7e-84   Medicago truncatula
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    267   7e-84   Glycine max [soybeans]
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             267   7e-84   Phaseolus vulgaris [French bean]
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    267   7e-84   Cicer arietinum [garbanzo]
ref|XP_006439190.1|  hypothetical protein CICLE_v10020627mg             266   7e-84   
ref|XP_002300511.1|  hypothetical protein POPTR_0001s45420g             266   7e-84   
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    267   8e-84   Glycine max [soybeans]
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    267   8e-84   Cicer arietinum [garbanzo]
ref|XP_004162968.1|  PREDICTED: probable beta-1,3-galactosyltrans...    260   8e-84   
ref|XP_002979099.1|  glycosyltransferase-like protein                   266   1e-83   
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...    267   1e-83   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...    267   1e-83   Nicotiana sylvestris
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    267   1e-83   Glycine max [soybeans]
gb|KJB62836.1|  hypothetical protein B456_009G440200                    267   1e-83   Gossypium raimondii
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    267   1e-83   
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_010104914.1|  putative beta-1,3-galactosyltransferase 6          268   1e-83   
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    267   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_006413124.1|  hypothetical protein EUTSA_v10025360mg             267   1e-83   Eutrema salsugineum [saltwater cress]
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   1e-83   Glycine max [soybeans]
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   1e-83   
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   1e-83   
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   1e-83   
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             266   1e-83   
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   1e-83   
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   1e-83   
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   2e-83   
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    266   2e-83   
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   2e-83   
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   2e-83   
ref|XP_007212259.1|  hypothetical protein PRUPE_ppa006626mg             266   2e-83   
emb|CDP18301.1|  unnamed protein product                                266   2e-83   
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   2e-83   
gb|KJB64379.1|  hypothetical protein B456_010G046600                    266   2e-83   
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    266   2e-83   
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    266   2e-83   
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          266   2e-83   
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g             266   2e-83   
gb|EPS60081.1|  hypothetical protein M569_14722                         262   2e-83   
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2               266   2e-83   
ref|XP_007045661.1|  Galactosyltransferase family protein               267   2e-83   
gb|KJB64381.1|  hypothetical protein B456_010G046600                    266   3e-83   
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    266   3e-83   
gb|ADE77778.1|  unknown                                                 264   3e-83   
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    266   3e-83   
gb|ADE75915.1|  unknown                                                 260   3e-83   
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 265   4e-83   
dbj|BAD25162.1|  putative Avr9 elicitor response protein                265   4e-83   
gb|EAY84604.1|  hypothetical protein OsI_05972                          265   4e-83   
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360          266   4e-83   
ref|XP_001754566.1|  predicted protein                                  265   4e-83   
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                    265   4e-83   
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   4e-83   
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase               265   4e-83   
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   5e-83   
gb|ACF79671.1|  unknown                                                 265   5e-83   
ref|NP_001131318.1|  uncharacterized protein LOC100192632               265   5e-83   
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                        263   5e-83   
ref|NP_001141890.1|  hypothetical protein                               265   5e-83   
ref|XP_008437459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   5e-83   
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   5e-83   
ref|XP_002988781.1|  glycosyltransferase-like protein                   265   6e-83   
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   6e-83   
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        265   6e-83   
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   7e-83   
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   7e-83   
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   7e-83   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       265   7e-83   
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   7e-83   
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   8e-83   
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   8e-83   
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...    264   8e-83   
ref|XP_009109161.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   8e-83   
gb|KGN49967.1|  hypothetical protein Csa_5G146900                       265   8e-83   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   9e-83   
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        264   9e-83   
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...    265   9e-83   
ref|XP_002893747.1|  galactosyltransferase family protein               265   9e-83   
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    265   9e-83   
emb|CDX97371.1|  BnaC08g12360D                                          265   1e-82   
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    264   1e-82   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    264   1e-82   
emb|CDY54843.1|  BnaC05g51320D                                          265   1e-82   
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290          265   2e-82   
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg             264   2e-82   
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    264   2e-82   
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        263   2e-82   
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    263   2e-82   
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2               263   2e-82   
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...    263   3e-82   
ref|XP_006828867.1|  hypothetical protein AMTR_s00001p00171620          263   3e-82   
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    263   3e-82   
emb|CDY46675.1|  BnaA03g48330D                                          263   3e-82   
ref|NP_001141176.1|  hypothetical protein                               260   3e-82   
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        263   3e-82   
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        263   3e-82   
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             263   3e-82   
ref|XP_004295272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   4e-82   
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg             263   4e-82   
ref|XP_006389613.1|  hypothetical protein POPTR_0021s00630g             263   5e-82   
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    263   5e-82   
dbj|BAD17751.1|  putative avr9 elicitor response protein                263   5e-82   
ref|XP_002302264.1|  galactosyltransferase family protein               262   5e-82   
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...    263   6e-82   
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    262   6e-82   
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   6e-82   
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   7e-82   
gb|KJB52408.1|  hypothetical protein B456_008G260300                    261   7e-82   
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    262   7e-82   
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   8e-82   
dbj|BAJ94062.1|  predicted protein                                      262   8e-82   
ref|XP_010053046.1|  PREDICTED: probable beta-1,3-galactosyltrans...    260   8e-82   
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   9e-82   
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    262   9e-82   
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   9e-82   
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   9e-82   
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    262   9e-82   
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          262   9e-82   
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   9e-82   
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    263   9e-82   
emb|CDX93812.1|  BnaA09g24120D                                          261   1e-81   
ref|XP_011081357.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   1e-81   
ref|XP_002970340.1|  glycosyltransferase-like protein                   262   1e-81   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   1e-81   
ref|XP_008778068.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    256   1e-81   
ref|XP_006660681.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   1e-81   
ref|NP_001063339.1|  Os09g0452900                                       261   1e-81   
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     261   1e-81   
gb|KDO80826.1|  hypothetical protein CISIN_1g015683mg                   258   2e-81   
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                        261   2e-81   
ref|XP_011047978.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   2e-81   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   2e-81   
ref|XP_011047977.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   2e-81   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   2e-81   
gb|ACL53751.1|  unknown                                                 261   2e-81   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...    261   2e-81   
ref|NP_001149873.1|  LOC100283501                                       261   2e-81   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...    262   2e-81   
ref|XP_004970763.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   2e-81   
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    261   2e-81   
ref|XP_002968104.1|  glycosyltransferase-like protein                   261   3e-81   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg             261   3e-81   
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         261   3e-81   
ref|XP_008777928.1|  PREDICTED: probable beta-1,3-galactosyltrans...    259   3e-81   
gb|ACG41551.1|  avr9 elicitor response protein                          261   3e-81   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...    261   3e-81   
ref|XP_006441805.1|  hypothetical protein CICLE_v10024512mg             261   3e-81   
gb|KJB52405.1|  hypothetical protein B456_008G260300                    260   3e-81   
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    260   3e-81   
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...    260   4e-81   
ref|XP_011037627.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    260   6e-81   
ref|XP_002305569.1|  hypothetical protein POPTR_0004s01390g             259   7e-81   
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    259   7e-81   
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    259   7e-81   
ref|NP_174609.1|  putative beta-1,3-galactosyltransferase 8             259   8e-81   
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...    259   8e-81   
gb|EAZ14356.1|  hypothetical protein OsJ_04276                          257   8e-81   
gb|AFK48973.1|  unknown                                                 259   9e-81   
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   9e-81   
ref|XP_010686831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    259   1e-80   
ref|XP_003564759.2|  PREDICTED: probable beta-1,3-galactosyltrans...    259   1e-80   
ref|XP_006478362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    260   1e-80   
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    259   1e-80   
ref|NP_001185130.1|  putative beta-1,3-galactosyltransferase 8          259   1e-80   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...    259   1e-80   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    259   2e-80   
ref|NP_001044974.1|  Os01g0877400                                       259   2e-80   
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                   258   2e-80   
emb|CDX92791.1|  BnaC07g40490D                                          258   2e-80   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   2e-80   
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   2e-80   
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg             258   2e-80   
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg             258   3e-80   
ref|XP_006415086.1|  hypothetical protein EUTSA_v10007836mg             258   3e-80   
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                   258   3e-80   
emb|CDY67379.1|  BnaCnng54730D                                          258   4e-80   
ref|XP_002893769.1|  galactosyltransferase family protein               258   4e-80   
ref|XP_009151468.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   4e-80   
ref|XP_010461176.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   4e-80   
gb|KJB26942.1|  hypothetical protein B456_004G268200                    257   4e-80   
ref|XP_010461174.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   4e-80   
ref|XP_009357459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   4e-80   
ref|XP_008439989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    258   5e-80   
ref|XP_004962000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    257   6e-80   
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             257   6e-80   
gb|EMS67042.1|  putative beta-1,3-galactosyltransferase 2               256   7e-80   
ref|XP_010542535.1|  PREDICTED: probable beta-1,3-galactosyltrans...    257   7e-80   
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370          257   7e-80   
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                    256   7e-80   
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                    256   7e-80   
ref|XP_010542528.1|  PREDICTED: probable beta-1,3-galactosyltrans...    257   8e-80   
ref|XP_006344003.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    257   8e-80   
ref|XP_006304768.1|  hypothetical protein CARUB_v10012254mg             257   8e-80   
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...    258   8e-80   
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    256   1e-79   
ref|XP_007039334.1|  Beta-1,3-galactosyltransferase 6 isoform 3         256   1e-79   
emb|CBI16979.3|  unnamed protein product                                256   1e-79   
ref|XP_010499892.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   1e-79   
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    256   1e-79   
gb|KEH28821.1|  beta-1,3-galactosyltransferase-like protein             256   1e-79   
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   1e-79   
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    256   2e-79   
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   2e-79   
gb|KJB57750.1|  hypothetical protein B456_009G178900                    258   2e-79   
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    256   2e-79   
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    255   2e-79   
ref|XP_010677269.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   2e-79   
ref|XP_010677261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   2e-79   
ref|XP_007019713.1|  Galactosyltransferase family protein isoform 1     256   2e-79   
ref|XP_009602082.1|  PREDICTED: probable beta-1,3-galactosyltrans...    257   2e-79   
ref|XP_006646529.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   2e-79   
ref|XP_007019715.1|  Galactosyltransferase family protein isoform 3     256   3e-79   
gb|KDP22107.1|  hypothetical protein JCGZ_25938                         257   3e-79   
ref|XP_010927833.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    255   3e-79   
gb|KJB59160.1|  hypothetical protein B456_009G242100                    255   3e-79   
emb|CDX88390.1|  BnaC06g38340D                                          255   3e-79   
gb|EMT12895.1|  Putative beta-1,3-galactosyltransferase 2               255   3e-79   
ref|XP_009757632.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   4e-79   
ref|XP_009757629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   4e-79   
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...    256   4e-79   
ref|XP_011097092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    255   4e-79   
ref|XP_009757630.1|  PREDICTED: probable beta-1,3-galactosyltrans...    256   5e-79   
ref|XP_010231346.1|  PREDICTED: probable beta-1,3-galactosyltrans...    255   5e-79   
ref|XP_006301157.1|  hypothetical protein CARUB_v10021555mg             254   7e-79   
ref|XP_002306601.2|  galactosyltransferase family protein               254   9e-79   
ref|XP_010471981.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    254   1e-78   
emb|CDM85234.1|  unnamed protein product                                267   1e-78   
ref|XP_010428866.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    254   1e-78   
dbj|BAK03918.1|  predicted protein                                      254   1e-78   
ref|NP_974164.2|  beta-1,3-galactosyltransferase 7                      253   1e-78   
gb|AAG51626.1|AC012193_8  putative (Avr9) elicitor response prote...    253   1e-78   
ref|XP_010428865.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    254   1e-78   
ref|XP_010471980.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    254   1e-78   
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   2e-78   
ref|XP_010478768.1|  PREDICTED: probable beta-1,3-galactosyltrans...    253   2e-78   
ref|XP_002889162.1|  galactosyltransferase family protein               253   2e-78   
gb|AHL38868.1|  glycosyltransferase                                     253   2e-78   
ref|XP_002437448.1|  hypothetical protein SORBIDRAFT_10g027290          253   2e-78   
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    253   2e-78   
ref|XP_004155605.1|  PREDICTED: probable beta-1,3-galactosyltrans...    253   2e-78   
ref|XP_004134762.1|  PREDICTED: probable beta-1,3-galactosyltrans...    253   2e-78   



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +NPRVYIGCMKSGPVLSQKGVRYHEPE+WKFGETGNKYFRHATGQLYAISKDLA+YIS N
Sbjct  260  KNPRVYIGCMKSGPVLSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  320  QHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  380  CRSADRIKEVHRRCGEGENALWSATF  405


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRK P
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKNP  262



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +NPRVYIGCMKSGPVLSQKGVRYHEPE+WKFGETGNKYFRHATGQLYAISKDLA+YIS N
Sbjct  259  KNPRVYIGCMKSGPVLSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  QHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  379  CRSADRIKEVHRRCGEGENALWSATF  404


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRK P
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKNP  261



>ref|XP_009598546.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
tomentosiformis]
Length=410

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  265  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  324

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDVHH+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  325  QHVLHKYANEDVSLGAWFIGLDVHHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  384

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVHRRCGEGE  LW AA 
Sbjct  385  CRSVDRLKEVHRRCGEGENALWKAAI  410


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETLARHRKKP
Sbjct  239  AEYYVKVDDDVHVNIGTLAETLARHRKKP  267



>emb|CDP10795.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  264  KKPRIYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISVN  323

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  324  QHVLHKYANEDVSLGSWFIGLDVLHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  383

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHRRCGEGE  +W AAF
Sbjct  384  CRSVDRIKEVHRRCGEGENAIWTAAF  409


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLG+TLARHRKKP
Sbjct  238  AEYYVKVDDDVHVNIATLGDTLARHRKKP  266



>ref|XP_009770915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=410

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  265  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  324

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            +HVLHKYANEDVSLGAWFIGLDVHH+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  325  KHVLHKYANEDVSLGAWFIGLDVHHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  384

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVHRRCGEGE  LW AA 
Sbjct  385  CRSVDRLKEVHRRCGEGENTLWKAAI  410


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETLARHRKKP
Sbjct  239  AEYYVKVDDDVHVNIGTLAETLARHRKKP  267



>ref|XP_006592811.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Glycine max]
Length=371

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  228  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKH  287

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR
Sbjct  288  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICR  347

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGEK LWNA+F
Sbjct  348  SAERIKEVHKRCGEGEKALWNASF  371


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG+TL RHR KP
Sbjct  200  ADFYIKVDDDVHVNIATLGQTLLRHRSKP  228



>ref|XP_006375531.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53328.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=303

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  158  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  217

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QH+LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  218  QHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  277

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW A F
Sbjct  278  CRSADRIKEVHRRCGEGEKALWRATF  303


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  132  ADFYVKVDDDVHVNIATLGETLVRHRKKP  160



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  383  CRSADRIKEVHRRCGEGEKALWSATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_006366586.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=408

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGLDVLHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  383  CRSVDRLKEVHKRCGEGEKALWKAAI  408


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETLARHRKKP
Sbjct  237  AEYYVKVDDDVHVNIGTLAETLARHRKKP  265



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  261  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  320

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  321  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  380

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  381  CRSADRIKEVHRRCGEGEKALWSATF  406


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  235  ADFYVKVDDDVHVNIATLGETLVRHRKKP  263



>ref|XP_006366587.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=406

 Score =   296 bits (757),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  261  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  320

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  321  QHVLHKYANEDVSLGAWFIGLDVLHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  380

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  381  CRSVDRLKEVHKRCGEGEKALWKAAI  406


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETLARHRKKP
Sbjct  235  AEYYVKVDDDVHVNIGTLAETLARHRKKP  263



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score =   296 bits (757),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  264  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  323

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  324  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  383

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  384  CRSADRIKEVHRRCGEGEKALWSATF  409


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  238  ADFYVKVDDDVHVNIATLGETLVRHRKKP  266



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score =   295 bits (756),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  260  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  380  CRSADRIKEVHRRCGEGEKALWSATF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_006304048.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
 gb|EOA36946.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
Length=303

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  158  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  217

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWK QAGNICVASFDW+CSGI
Sbjct  218  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKTQAGNICVASFDWSCSGI  277

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  278  CRSADRIKEVHRRCGEGEKALWSATF  303


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  132  ADFYVKVDDDVHVNIATLGETLVRHRKKP  160



>ref|XP_006447567.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 gb|ESR60807.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=303

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  159  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  218

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  219  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  278

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  279  RSADRIKEVHRRCGEGENALWSATF  303


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++++KVDDDVHVNI TLG+TL RHR KP
Sbjct  132  ADFFVKVDDDVHVNIATLGQTLVRHRSKP  160



>gb|KDO54673.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=303

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  159  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  218

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  219  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  278

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  279  RSADRIKEVHRRCGEGENALWSATF  303


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG+TL RHR KP
Sbjct  132  ADFYVKVDDDVHVNIATLGQTLVRHRSKP  160



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  260  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW A F
Sbjct  380  CRSADRIKEVHRRCGEGEKALWRATF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  262  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  382  CRSADRIKEVHRRCGEGEKALWSATF  407


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKKP  264



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  259  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  379  CRSADRIKEVHRRCGEGEKALWSATF  404


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKKP  261



>gb|KDP22716.1| hypothetical protein JCGZ_01818 [Jatropha curcas]
Length=303

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  RVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  158  KKQRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  217

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  218  QHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  277

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ DRIKEVHRRCGEGE VLW+A F
Sbjct  278  CKSADRIKEVHRRCGEGENVLWSATF  303


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  132  ADFYVKVDDDVHVNIATLGETLVRHRKK  159



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  263  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW A F
Sbjct  383  CRSADRIKEVHRRCGEGEKALWRATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  262  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  382  CRSADRIKEVHRRCGEGEKALWSATF  407


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKKP  264



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGETGNKYFRHATGQLYAISKDLA+YIS N
Sbjct  259  KKPRVYIGCMKSGPVLSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            +HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  RHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  379  CRSADRIKEVHRRCGEGETALWSATF  404


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKKP  261



>ref|XP_006592810.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=383

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  240  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKH  299

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR
Sbjct  300  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICR  359

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGEK LWNA+F
Sbjct  360  SAERIKEVHKRCGEGEKALWNASF  383


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG+TL RHR KP
Sbjct  212  ADFYIKVDDDVHVNIATLGQTLLRHRSKP  240



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  264  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGEK LWNA+F
Sbjct  384  SAERIKEVHKRCGEGEKALWNASF  407


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG+TL RHR KP
Sbjct  236  ADFYIKVDDDVHVNIATLGQTLLRHRSKP  264



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  264  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV+H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVNHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGEK LWNA+F
Sbjct  384  SAERIKEVHKRCGEGEKALWNASF  407


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG+TL RHR KP
Sbjct  236  ADFYIKVDDDVHVNIATLGQTLVRHRSKP  264



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  RVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  263  KKSRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  383  CRSVDRLKEVHKRCGEGEKALWKAAI  408


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETL RHRKK 
Sbjct  237  AEYYVKVDDDVHVNIGTLAETLTRHRKKS  265



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  261  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEHGNKYFRHATGQLYAISKDLATYISINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  321  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
             + DRIKEVHRRCGEGE VLWN+AF
Sbjct  381  NSADRIKEVHRRCGEGETVLWNSAF  405


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  234  ADFYVKVDDDVHVNIATLGATLARHRSKP  262



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  RVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQ+YAISKDLA+YIS N
Sbjct  261  KKSRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQIYAISKDLASYISVN  320

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  321  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  380

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  381  CRSVDRLKEVHKRCGEGEKALWKAAI  406


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNIGTL ETL RHRKK 
Sbjct  235  AEYYVKVDDDVHVNIGTLAETLTRHRKKS  263



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  263  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QH+LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW A F
Sbjct  383  CRSADRIKEVHRRCGEGEKALWRATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  260  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QH+LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW A F
Sbjct  380  CRSADRIKEVHRRCGEGEKALWRATF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>gb|EYU34029.1| hypothetical protein MIMGU_mgv1a007633mg [Erythranthe guttata]
Length=401

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQ+GVRYHEPE+WKFGETGNKYFRHATGQLYAISKDLA+YIS N
Sbjct  256  KKPRVYIGCMKSGPVLSQRGVRYHEPEFWKFGETGNKYFRHATGQLYAISKDLASYISVN  315

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHK+ANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  316  QHVLHKFANEDVSLGSWFIGLDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  375

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHRRCGEGE  +W A F
Sbjct  376  CRSVDRIKEVHRRCGEGEDAVWKATF  401


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLGETLARHRKKP
Sbjct  230  AEYYVKVDDDVHVNIATLGETLARHRKKP  258



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  261  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  321  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  381  RSADRIKEVHRRCGEGENALWSATF  405


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++++KVDDDVHVNI TLG+TL RHR KP
Sbjct  234  ADFFVKVDDDVHVNIATLGQTLVRHRSKP  262



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  260  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  319

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  320  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  379

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  380  RSADRIKEVHRRCGEGENALWSATF  404


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++++KVDDDVHVNI TLG+TL RHR KP
Sbjct  233  ADFFVKVDDDVHVNIATLGQTLVRHRSKP  261



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  263  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  323  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  383  RSADRIKEVHRRCGEGENALWSATF  407


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++++KVDDDVHVNI TLG+TL RHR KP
Sbjct  236  ADFFVKVDDDVHVNIATLGQTLVRHRSKP  264



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  260  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  319

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  320  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  379

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  380  RSADRIKEVHRRCGEGENALWSATF  404


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG+TL RHR KP
Sbjct  233  ADFYVKVDDDVHVNIATLGQTLVRHRSKP  261



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  261  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  321  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  381  RSADRIKEVHRRCGEGENALWSATF  405


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG+TL RHR KP
Sbjct  234  ADFYVKVDDDVHVNIATLGQTLVRHRSKP  262



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLA YIS NQ
Sbjct  263  KPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISKDLAAYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC
Sbjct  323  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DRIKEVHRRCGEGE  LW+A F
Sbjct  383  RSADRIKEVHRRCGEGENALWSATF  407


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG+TL RHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGQTLVRHRSKP  264



>ref|XP_010457599.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X4 [Camelina sativa]
Length=405

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  260  KKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  380  CRSADRIKEVHRRCGEGEKALWSATF  405


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  262  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  382  CRSADRIKEVHRRCGEGENALWSATF  407


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKKP  264



>ref|XP_010457598.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Camelina sativa]
Length=408

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  383  CRSADRIKEVHRRCGEGEKALWSATF  408


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_010457596.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=441

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  296  KKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  355

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  356  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  415

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  416  CRSADRIKEVHRRCGEGEKALWSATF  441



>ref|XP_010457597.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=438

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  293  KKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  352

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  353  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  412

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  413  CRSADRIKEVHRRCGEGEKALWSATF  438



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAISKDLA+YIS N
Sbjct  260  KKPRVYIGCMKSGPVLSQKGVRYHEPEFWKFGESGNKYFRHATGQLYAISKDLASYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q+VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW +AF
Sbjct  380  CRSADRIKEVHRRCGEGENALWRSAF  405


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RH+KKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLIRHQKKP  262



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAISKDLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLSQKGVRYHEPEFWKFGESGNKYFRHATGQLYAISKDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q+VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW +AF
Sbjct  383  CRSADRIKEVHRRCGEGENALWRSAF  408


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RH+KKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLIRHQKKP  265



>ref|XP_002524194.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF38209.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=374

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  229  KKSRLYIGCMKSGPVLNQKGVRYHEPEFWKFGEAGNKYFRHATGQLYAISKDLATYISIN  288

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  289  QHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  348

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  349  CRSADRIKEVHRRCGEGENALWSATF  374


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKK 
Sbjct  203  ADFYVKVDDDVHVNIATLGETLVRHRKKS  231



>gb|KFK42855.1| hypothetical protein AALP_AA1G047700 [Arabis alpina]
Length=408

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLYQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  383  CRSADRIKEVHRRCGEGENALWSATF  408


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  259  KKQRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  379  CRSADRIKEVHRRCGEGENALWSASF  404


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLG TL RHRKK
Sbjct  233  ADFYVKVDDDVHVNIATLGGTLVRHRKK  260



>ref|XP_009397181.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYISANQH
Sbjct  262  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISANQH  321

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC 
Sbjct  322  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICN  381

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGEK +W A F
Sbjct  382  SAERIKEVHRRCGEGEKTVWKAVF  405


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TLA+HR KP
Sbjct  234  ADFYIKVDDDVHVNIATLGATLAKHRSKP  262



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   290 bits (743),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+Q+GVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLA+YIS N
Sbjct  260  KKPRVYIGCMKSGPVLAQRGVRYHEPEHWKFGEPGNKYFRHATGQLYAISKDLASYISVN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGI
Sbjct  320  QHVLHKYANEDVSLGSWFIGLDVRHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHRRCGEGE  +W A F
Sbjct  380  CRSVDRIKEVHRRCGEGEDAIWKAVF  405


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLGETLARHRKKP
Sbjct  234  AEYYVKVDDDVHVNIATLGETLARHRKKP  262



>ref|XP_010557003.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Tarenaya hassleriana]
Length=405

 Score =   290 bits (743),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  260  KKSRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISRDLASYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  320  QHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW++ F
Sbjct  380  CRSADRIKEVHRRCGEGETALWSSTF  405


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKK  261



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score =   291 bits (744),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS NQ
Sbjct  264  KPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISLNQ  323

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  324  HVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  383

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+VDRIKEVHRRCGEGE  LWNA+F
Sbjct  384  RSVDRIKEVHRRCGEGENALWNASF  408


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNIG LG TLARH  KP
Sbjct  237  ADFYIKVDDDVHVNIGALGATLARHHSKP  265



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score =   291 bits (744),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  262  KKQRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  382  CRSADRIKEVHRRCGEGENALWSASF  407


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLG TL RHRKK
Sbjct  236  ADFYVKVDDDVHVNIATLGGTLVRHRKK  263



>ref|XP_009361001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=365

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  222  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQH  281

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKY NEDVSLG+WFIGLDV  VDDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  282  VLHKYVNEDVSLGSWFIGLDVEQVDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  341

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE  LWNAAF
Sbjct  342  SSERIKEVHRRCGEGENALWNAAF  365


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  194  ADFYVKVDDDVHVNIGTLGATLARHRPKP  222



>emb|CDY12206.1| BnaC04g12360D [Brassica napus]
Length=409

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+Y+S N
Sbjct  264  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYVSIN  323

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  324  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  383

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGE EK +W A F
Sbjct  384  CRSADRIKEVHRRCGEPEKAIWKATF  409


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  238  ADFYVKVDDDVHVNIATLGETLVRHRKKP  266



>gb|KEH29682.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=349

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            R+YIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+V
Sbjct  207  RIYIGCMKSGPVLSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISNDLATYISTNQNV  266

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVS+GAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+
Sbjct  267  LHKYANEDVSIGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRS  326

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             DRIKEVHRRCGEGE  LW+A+F
Sbjct  327  ADRIKEVHRRCGEGENALWSASF  349


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHR K
Sbjct  178  ADFYVKVDDDVHVNIATLGETLVRHRSK  205



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+
Sbjct  263  PRIYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQN  322

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  323  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A+F
Sbjct  383  SAERIKEVHRRCGEGENVLWSASF  406


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHR KP
Sbjct  235  ADFYVKVDDDVHVNIATLGETLVRHRSKP  263



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+
Sbjct  263  PRIYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQN  322

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  323  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A+F
Sbjct  383  SAERIKEVHRRCGEGENVLWSASF  406


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHR KP
Sbjct  235  ADFYVKVDDDVHVNIATLGETLVRHRSKP  263



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
            NPRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  260  NPRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  319

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC
Sbjct  320  HVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGIC  379

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVHRRCGEGE  LWNA F
Sbjct  380  KSSERIKEVHRRCGEGENALWNAVF  404


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR  P
Sbjct  233  ADFYVKVDDDVHVNIGTLGATLARHRSNP  261



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
            NPRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  259  NPRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  318

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC
Sbjct  319  HVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGIC  378

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVHRRCGEGE  LWNA F
Sbjct  379  KSSERIKEVHRRCGEGENALWNAVF  403


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR  P
Sbjct  232  ADFYVKVDDDVHVNIGTLGATLARHRSNP  260



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
            NPRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  267  NPRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  326

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLH+YANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  327  HVLHRYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  386

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +RI+EVHRRCGEGE  LW+A F
Sbjct  387  RSAERIREVHRRCGEGENALWSAIF  411


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TLARHR  P
Sbjct  240  ADFYIKVDDDVHVNIATLGTTLARHRSNP  268



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  263  KPRVYIGCMKSGPVLSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  323  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +RIKEVHRRCGEGE  LW+A F
Sbjct  383  RSAERIKEVHRRCGEGENTLWSATF  407


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHR KP
Sbjct  236  ADFYIKVDDDVHVNIATLGETLVRHRSKP  264



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  264  PRVYIGCMKSGPVLSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE  LW+A F
Sbjct  384  SAERIKEVHRRCGEGENTLWSATF  407


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHR KP
Sbjct  236  ADFYIKVDDDVHVNIATLGETLVRHRSKP  264



>ref|XP_010557001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557002.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=408

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKSRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISRDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW + F
Sbjct  383  CRSADRIKEVHRRCGEGETALWRSTF  408


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKK  264



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  264  PRVYIGCMKSGPVLSQKGVRYHEPEHWKFGEFGNKYFRHATGQLYAISKDLATYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE  LW+A F
Sbjct  384  SAERIKEVHRRCGEGENTLWSATF  407


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHR KP
Sbjct  236  ADFYIKVDDDVHVNIATLGETLVRHRSKP  264



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS NQ
Sbjct  265  KPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINQ  324

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  325  HVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  384

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+VDRIKEVHRRCGEGE  LWNA F
Sbjct  385  RSVDRIKEVHRRCGEGENALWNAVF  409


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIG LG TLARHR KP
Sbjct  238  ADFYVKVDDDVHVNIGALGATLARHRSKP  266



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS NQ
Sbjct  265  KPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINQ  324

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  325  HVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  384

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+VDRIKEVHRRCGEGE  LWNA F
Sbjct  385  RSVDRIKEVHRRCGEGENALWNAVF  409


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIG LG TLARHR KP
Sbjct  238  ADFYVKVDDDVHVNIGALGATLARHRSKP  266



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
            NPRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GN+YFRHATGQ+YAISKDLATYIS NQ
Sbjct  267  NPRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNRYFRHATGQIYAISKDLATYISINQ  326

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  327  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  386

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +R++EVHRRCGEGE  LW+A F
Sbjct  387  RSAERVREVHRRCGEGENALWSATF  411


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDD+HVNIGTLG TLARHR  P
Sbjct  240  ADFYVKVDDDIHVNIGTLGLTLARHRSNP  268



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVYIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAISKDLATYIS NQHV
Sbjct  264  RVYIGCMKSGPVLSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISKDLATYISINQHV  323

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+
Sbjct  324  LHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRS  383

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
            V+RIKEVHRRCGEGE  LW+A F
Sbjct  384  VERIKEVHRRCGEGENALWSATF  406


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHR K
Sbjct  235  ADFYVKVDDDVHVNIATLGETLVRHRPK  262



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  259  KKSRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  379  CRSAERIKEVHRRCGEGENALWSASF  404


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKK 
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKKS  261



>ref|XP_006475058.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475059.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO62742.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=367

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  224  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  283

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR
Sbjct  284  VLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICR  343

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +R+KEVHRRCGEGE  LW+AAF
Sbjct  344  SAERMKEVHRRCGEGENALWSAAF  367


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  196  ADFYVKVDDDVHVNIATLGATLARHRSKP  224



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  265  PRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNKYFRHATGQLYAISKDLATYISLNQH  324

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKY NEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  325  VLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  384

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDRI EVHRRCGEGE  LWNA+F
Sbjct  385  SVDRIMEVHRRCGEGENALWNASF  408


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNIG LG TLARH  KP
Sbjct  237  ADFYIKVDDDVHVNIGALGATLARHHSKP  265



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAIS DLATY+S NQH
Sbjct  261  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISNDLATYVSINQH  320

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC+
Sbjct  321  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICK  380

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDRIKEVHRRCGEGE  LW+A F
Sbjct  381  SVDRIKEVHRRCGEGENALWSAEF  404


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  233  ADFYVKVDDDVHVNIATLGATLARHRSKP  261



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  260  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEQGNKYFRHATGQLYAISKDLATYISINQ  319

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGN+C ASFDW+CSGIC
Sbjct  320  HVLHKYANEDVSLGAWFIGVDVEHIDDRRLCCGTPPDCEWKAQAGNVCAASFDWSCSGIC  379

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +RIKEVH+RCGEGEK LW+A F
Sbjct  380  RSAERIKEVHQRCGEGEKALWSAVF  404


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TLARHR KP
Sbjct  233  ADFYIKVDDDVHVNIATLGMTLARHRSKP  261



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  262  KKSRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  382  CRSAERIKEVHRRCGEGENALWSASF  407


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKK 
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKKS  264



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+HV
Sbjct  265  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHV  324

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+
Sbjct  325  LHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRS  384

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             +RIKEVH+RCGEGEK LW+A+F
Sbjct  385  AERIKEVHKRCGEGEKALWSASF  407


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++YIKVDDDVHVNI TLG+TL RHR K
Sbjct  236  ADFYIKVDDDVHVNIATLGQTLVRHRSK  263



>emb|CDY48266.1| BnaA05g10880D [Brassica napus]
Length=409

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  264  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  323

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  324  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  383

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGE E  +W A F
Sbjct  384  CRSADRIKEVHRRCGEPENAIWKATF  409


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  238  ADFYIKVDDDVHVNIATLGETLVRHRKKP  266



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QKGVRYHEPE+WKFG+ GNKYFRHATGQLYAIS+DLATYIS NQ
Sbjct  255  KPRLYIGCMKSGPVLAQKGVRYHEPEHWKFGDDGNKYFRHATGQLYAISRDLATYISINQ  314

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSG+C
Sbjct  315  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGVC  374

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+KEVHRRCGEGEK LW+A F
Sbjct  375  KSVERMKEVHRRCGEGEKALWSATF  399


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLG TL RHR KP
Sbjct  228  AEFYVKVDDDVHVNIATLGATLIRHRSKP  256



>ref|XP_009143989.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Brassica rapa]
Length=406

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  261  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  320

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  321  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  380

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGE E  +W A F
Sbjct  381  CRSADRIKEVHRRCGEPENAIWKATF  406


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  235  ADFYIKVDDDVHVNIATLGETLVRHRKKP  263



>ref|XP_009143988.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Brassica rapa]
Length=409

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  264  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISIN  323

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  324  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  383

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGE E  +W A F
Sbjct  384  CRSADRIKEVHRRCGEPENAIWKATF  409


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  238  ADFYIKVDDDVHVNIATLGETLVRHRKKP  266



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  261  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  321  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVH+RCGEGE  LW+A F
Sbjct  381  KSAERIKEVHQRCGEGEHALWSAVF  405


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TL RHR KP
Sbjct  234  ADFYIKVDDDVHVNIATLGTTLVRHRAKP  262



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLA YIS N+H
Sbjct  265  PRVYIGCMKSGPVLSQKGVRYHEPEHWKFGENGNKYFRHATGQLYAISKDLAAYISTNKH  324

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR
Sbjct  325  VLHKYANEDVSLGAWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICR  384

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH++CGEGEK LW+A+F
Sbjct  385  SAERIKEVHKKCGEGEKALWSASF  408


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHR KP
Sbjct  237  ADFYIKVDDDVHVNIATLGETLVRHRSKP  265



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  277  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISNDLATYISINQH  336

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  337  VLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  396

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVHRRCGEGE  LW+++F
Sbjct  397  SADRIKEVHRRCGEGENALWSSSF  420


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLGETL RHR KP
Sbjct  249  ADFYVKVDDDVHVNIGTLGETLNRHRLKP  277



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
            NPRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  260  NPRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  319

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  320  HVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  379

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVHRRCGEGE  LWNA F
Sbjct  380  KSSERIKEVHRRCGEGENALWNAVF  404


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR  P
Sbjct  233  ADFYVKVDDDVHVNIGTLGATLARHRSNP  261



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+
Sbjct  264  PRIYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNRYFRHATGQLYAISNDLATYISINQN  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE  LW+A+F
Sbjct  384  SAERIKEVHRRCGEGENALWSASF  407


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG+TL RHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGQTLVRHRSKP  264



>emb|CAN63417.1| hypothetical protein VITISV_007689 [Vitis vinifera]
Length=373

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  229  KPRIYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  288

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  289  HVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  348

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +RI+EVHRRCGEGE  +W+A F
Sbjct  349  RSSERIREVHRRCGEGENAVWSAVF  373


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  202  ADFYVKVDDDVHVNIATLGATLARHRSKP  230



>ref|XP_011048788.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  263  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLAKYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  323  QHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  383  CRSADRIKEVHRRCGEGENALWSATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_011048789.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  260  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLAKYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  380  CRSADRIKEVHRRCGEGENALWSATF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_006410375.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
 gb|ESQ51828.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
Length=408

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISTN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A F
Sbjct  383  CRSADRIKEVHKRCGEPENAIWKATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  259  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  318

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+WFIGLDV  VDDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  319  HVLHKYVNEDVSLGSWFIGLDVEQVDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  378

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVHRRCGEGE  LWNAAF
Sbjct  379  KSSERIKEVHRRCGEGENALWNAAF  403


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  232  ADFYVKVDDDVHVNIGTLGATLARHRPKP  260



>ref|XP_002302876.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
 gb|EEE82149.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
Length=405

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  260  KKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLAKYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  320  QHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  380  CRSADRIKEVHRRCGEGENALWSATF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  ADFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  262  KKQRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLH+YANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHRYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  382  CRSAERIKEVHRRCGEGENALWSASF  407


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKK  263



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  651  VRNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISA  472
            +  PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS 
Sbjct  257  LSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEYGNKYFRHATGQLYAISKDLATYISI  316

Query  471  NQHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSG  292
            NQHVLHKYANEDVSLG+WFIGLDV H+DDR+LCCGTPPDCEWKAQAGNICVASFDW CSG
Sbjct  317  NQHVLHKYANEDVSLGSWFIGLDVEHIDDRQLCCGTPPDCEWKAQAGNICVASFDWRCSG  376

Query  291  ICRTVDRIKEVHRRCGEGEKVLWNAAF  211
            IC +V+RIKEVHRRCGEGE  LWNA F
Sbjct  377  ICNSVERIKEVHRRCGEGENALWNAVF  403


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TL+RH  KP
Sbjct  232  ADFYVKVDDDVHVNIGTLGATLSRHLSKP  260



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS NQH 
Sbjct  262  RVYIGCMKSGPVLAQKGVRYHEPEYWKFGEQGNKYFRHATGQLYAISRDLATYISKNQHF  321

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC +
Sbjct  322  LHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICNS  381

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             DRIKEVHRRCGEGE  LWN AF
Sbjct  382  ADRIKEVHRRCGEGEHTLWNTAF  404


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLG TLARHR K
Sbjct  233  ADFYVKVDDDVHVNIATLGATLARHRSK  260



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  262  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLARYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  382  CRSSERIKEVHRRCGEGENALWNAVF  407


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  236  AEFYIKVDDDVHVNIATLGETLVRHRKKP  264



>ref|XP_009398227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  270  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISMNQH  329

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC 
Sbjct  330  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICN  389

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEG+  L NA F
Sbjct  390  SAERIKEVHRRCGEGKNALLNAVF  413


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TLA+HR KP
Sbjct  242  ADFYIKVDDDVHVNIATLGATLAKHRSKP  270



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  259  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLARYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  379  CRSSERIKEVHRRCGEGENALWNAVF  404


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  233  AEFYIKVDDDVHVNIATLGETLVRHRKKP  261



>ref|XP_009119198.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Brassica rapa]
Length=408

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLYQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DR+KEVHRRC EGE  LW+A F
Sbjct  383  CRSADRLKEVHRRCSEGENALWSATF  408


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATY+S NQ
Sbjct  261  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYMSINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  321  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ +RIKEVH+RCGEGE  LW+A F
Sbjct  381  KSAERIKEVHQRCGEGENALWSAVF  405


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  234  ADFYVKVDDDVHVNIATLGTTLARHRSKP  262



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA YIS N
Sbjct  260  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLARYISIN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGI
Sbjct  320  QHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  380  CRSSERIKEVHRRCGEGENALWNAVF  405


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVNI TLGETL RHRKKP
Sbjct  234  AEFYIKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_009119197.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Brassica rapa]
Length=411

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  266  KKPRVYIGCMKSGPVLYQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  325

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  326  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  385

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DR+KEVHRRC EGE  LW+A F
Sbjct  386  CRSADRLKEVHRRCSEGENALWSATF  411


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  240  ADFYVKVDDDVHVNIATLGETLVRHRKKP  268



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQ
Sbjct  263  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  323  HVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +R+KEVHRRCGEGE  LW+AAF
Sbjct  383  RSAERMKEVHRRCGEGENALWSAAF  407


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGATLARHRSKP  264



>gb|KEH29683.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=407

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            R+YIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+V
Sbjct  265  RIYIGCMKSGPVLSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISNDLATYISTNQNV  324

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVS+GAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+
Sbjct  325  LHKYANEDVSIGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRS  384

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             DRIKEVHRRCGEGE  LW+A+F
Sbjct  385  ADRIKEVHRRCGEGENALWSASF  407


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHR K
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRSK  263



>emb|CDY46836.1| BnaA10g03200D [Brassica napus]
Length=407

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  262  KKPRVYIGCMKSGPVLYQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DR+KEVHRRC EGE  LW+A F
Sbjct  382  CRSADRLKEVHRRCSEGENTLWSATF  407


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKKP  264



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQ
Sbjct  262  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQ  321

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  322  HVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  381

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +R+KEVHRRCGEGE  LW+AAF
Sbjct  382  RSAERMKEVHRRCGEGENALWSAAF  406


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  235  ADFYVKVDDDVHVNIATLGATLARHRSKP  263



>ref|XP_006294322.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
 gb|EOA27220.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
Length=408

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A F
Sbjct  383  CRSADRIKEVHKRCGEPENAIWKARF  408


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  AEYYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_009775718.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana sylvestris]
Length=404

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYIS N
Sbjct  262  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISVN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHRRCGEGE  LW AAF
Sbjct  379  CRSVDRIKEVHRRCGEGENALWKAAF  404


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLGETLARHRKKP
Sbjct  236  AEYYIKVDDDVHVNIATLGETLARHRKKP  264



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQ 
Sbjct  263  PRIYIGCMKSGPVLSQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISNDLATYISINQD  322

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR
Sbjct  323  VLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICR  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE  LW+A+F
Sbjct  383  SAERIKEVHRRCGEGENALWSASF  406


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHR KP
Sbjct  235  ADFYVKVDDDVHVNIATLGETLVRHRSKP  263



>ref|XP_009775717.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=405

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYIS N
Sbjct  263  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISVN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  320  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHRRCGEGE  LW AAF
Sbjct  380  CRSVDRIKEVHRRCGEGENALWKAAF  405


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLGETLARHRKKP
Sbjct  237  AEYYIKVDDDVHVNIATLGETLARHRKKP  265



>emb|CDY49507.1| BnaC05g03190D [Brassica napus]
Length=410

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA+YIS N
Sbjct  265  KKPRVYIGCMKSGPVLYQKGVRYHEPEYWKFGENGNKYFRHATGQIYAISRDLASYISIN  324

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  325  QHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  384

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DR+KEVHRRC EGE  LW+A F
Sbjct  385  CRSADRLKEVHRRCSEGENALWSATF  410


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  239  ADFYVKVDDDVHVNIATLGETLVRHRKKP  267



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +   +YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  259  KKQHLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  379  CKSAERIKEVHRRCGEGENALWSATF  404


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKK  260



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +   +YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  262  KKQHLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  322  QHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  382  CKSAERIKEVHRRCGEGENALWSATF  407


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKK  263



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ
Sbjct  261  KPRIYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQ  320

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC
Sbjct  321  HVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +RI+EVHRRCGEGE  +W+A F
Sbjct  381  RSSERIREVHRRCGEGENAVWSAVF  405


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  234  ADFYVKVDDDVHVNIATLGATLARHRSKP  262



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  262  KKKRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  382  CKSAERIKEVHRRCGEGENALWSARF  407


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKK  263



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N
Sbjct  259  KKKRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  379  CKSAERIKEVHRRCGEGENALWSARF  404


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKK  260



>ref|XP_004167799.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=187

 Score =   278 bits (711),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVY+GCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+
Sbjct  45   RVYMGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHI  104

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++
Sbjct  105  LHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKS  164

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             +R+KEVHRRCGEGE  L +A F
Sbjct  165  AERMKEVHRRCGEGENALLSAVF  187



>ref|XP_002529902.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF32456.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=238

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+ KGV+YHEPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  95   PRVYIGCMKSGPVLAHKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISNDLATYISINQH  154

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC+
Sbjct  155  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICK  214

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RIKEVH RCGEGE  LW+A F
Sbjct  215  SVERIKEVHGRCGEGENALWSAEF  238


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  67   ADFYVKVDDDVHVNIATLGTTLARHRSKP  95



>ref|XP_009408655.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS DLA YIS NQH
Sbjct  263  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEDGNKYFRHATGQLYAISNDLAAYISMNQH  322

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC 
Sbjct  323  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICN  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RI EVHRRCGEGEK++W+A F
Sbjct  383  SAERINEVHRRCGEGEKMVWDAVF  406


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLG TLA+HR KP
Sbjct  235  ADFYIKVDDDVHVNIATLGTTLAKHRSKP  263



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score =   285 bits (730),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +NPRVYIGCMKSGPVLSQKGVRYHEPE+WKFGETGNKYFRHATGQLYAISKDLA+YIS N
Sbjct  259  KNPRVYIGCMKSGPVLSQKGVRYHEPEHWKFGETGNKYFRHATGQLYAISKDLASYISIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  QHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGE  241
            CR+ DRIKEVHRRCGE
Sbjct  379  CRSADRIKEVHRRCGE  394


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLGETL RHRK P
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKNP  261



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score =   285 bits (730),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQ+GVRYHEPE+WKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  266  PRVYIGCMKSGPVLSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQH  325

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC+
Sbjct  326  ILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICK  385

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A F
Sbjct  386  SAERIKEVHRRCGEGENVLWSATF  409


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLGETLARHR KP
Sbjct  238  ADFYVKVDDDVHVNIGTLGETLARHRSKP  266



>ref|XP_010469587.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   285 bits (730),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  260  KKPRLYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  320  QRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A+F
Sbjct  380  CRSADRIKEVHKRCGEPENAIWKASF  405


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  AEFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS NQHV
Sbjct  262  RVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNKYFRHATGQLYAISKDLATYISINQHV  321

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LH+YANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+
Sbjct  322  LHRYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRS  381

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
            V+R+KEVHRRCGEGE  LW+A F
Sbjct  382  VERMKEVHRRCGEGENALWSAEF  404


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR K 
Sbjct  233  ADFYVKVDDDVHVNIATLGATLARHRDKS  261



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   285 bits (730),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATY+S N
Sbjct  259  KKKRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYVSIN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  319  QHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  379  CKSAERIKEVHRRCGEGENALWSARF  404


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  233  ADFYVKVDDDVHVNIATLGETLVRHRKK  260



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   285 bits (730),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQ+GVRYHEPE+WKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  265  PRVYIGCMKSGPVLSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQH  324

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC+
Sbjct  325  ILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICK  384

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A F
Sbjct  385  SAERIKEVHRRCGEGENVLWSATF  408


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLGETLARHR KP
Sbjct  237  ADFYVKVDDDVHVNIGTLGETLARHRSKP  265



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQ+GVRYHEPE+WKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  265  PRVYIGCMKSGPVLSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQH  324

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC+
Sbjct  325  ILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICK  384

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A F
Sbjct  385  SAERIKEVHRRCGEGENVLWSATF  408


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLGETLARHR KP
Sbjct  237  ADFYVKVDDDVHVNIGTLGETLARHRSKP  265



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            +  R+YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATY+S N
Sbjct  262  KKKRLYIGCMKSGPVLAQKGVRYHEPEYWKFGEPGNKYFRHATGQLYAISKDLATYVSIN  321

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGI
Sbjct  322  QHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGI  381

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            C++ +RIKEVHRRCGEGE  LW+A F
Sbjct  382  CKSAERIKEVHRRCGEGENALWSARF  407


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  236  ADFYVKVDDDVHVNIATLGETLVRHRKK  263



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQ+GVRYHEPE+WKFGE GNKYFRHATGQLYAIS DLATYIS NQH
Sbjct  265  PRVYIGCMKSGPVLSQRGVRYHEPEHWKFGEAGNKYFRHATGQLYAISNDLATYISINQH  324

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+W IGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC+
Sbjct  325  ILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICK  384

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVHRRCGEGE VLW+A F
Sbjct  385  SAERIKEVHRRCGEGENVLWSATF  408


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLGETLARHR KP
Sbjct  237  ADFYVKVDDDVHVNIGTLGETLARHRSKP  265



>ref|XP_010469586.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRLYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A+F
Sbjct  383  CRSADRIKEVHKRCGEPENAIWKASF  408


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  AEFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ
Sbjct  263  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRDLATYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+W +GLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  323  HVLHKYVNEDVSLGSWLLGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVHRRCGEGE  LW+A F
Sbjct  383  KSVERIKEVHRRCGEGENALWSAVF  407


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNIGTLG TL RHR KP
Sbjct  236  AEFYVKVDDDVHVNIGTLGTTLGRHRLKP  264



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ
Sbjct  262  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRDLATYISINQ  321

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+W +GLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  322  HVLHKYVNEDVSLGSWLLGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  381

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVHRRCGEGE  LW+A F
Sbjct  382  KSVERIKEVHRRCGEGENALWSAVF  406


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNIGTLG TL RHR KP
Sbjct  235  AEFYVKVDDDVHVNIGTLGTTLGRHRLKP  263



>ref|XP_004982530.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=405

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVY+GCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YI+ NQH
Sbjct  262  PRVYVGCMKSGPVLAQKGVRYHEPEYWKFGEWGNKYFRHATGQLYAISKDLASYIALNQH  321

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  322  VLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  381

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVH+RCGE E  +WNA F
Sbjct  382  SADRIKEVHQRCGESENAIWNAKF  405


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLG TL+RHR KP
Sbjct  234  AEYYIKVDDDVHVNIATLGNTLSRHRSKP  262



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFG  GNKYFRHATGQLYAISKDLA YIS NQH
Sbjct  269  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGAEGNKYFRHATGQLYAISKDLANYISNNQH  328

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  329  VLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  388

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGE  LWNAAF
Sbjct  389  SSERIKEVHKRCGEGENALWNAAF  412


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  241  ADFYVKVDDDVHVNIGTLGATLARHRSKP  269



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFG  GNKYFRHATGQLYAISKDLA YIS NQH
Sbjct  268  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGAEGNKYFRHATGQLYAISKDLANYISNNQH  327

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  328  VLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  387

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGE  LWNAAF
Sbjct  388  SSERIKEVHKRCGEGENALWNAAF  411


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  240  ADFYVKVDDDVHVNIGTLGATLARHRSKP  268



>gb|EPS73703.1| hypothetical protein M569_01053, partial [Genlisea aurea]
Length=221

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAIS+DLA YIS NQH
Sbjct  79   PRVYIGCMKSGPVLAQKGVRYHEPEFWKFGEQGNKYFRHATGQLYAISRDLAAYISINQH  138

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC 
Sbjct  139  VLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICN  198

Query  282  TVDRIKEVHRRCGEGEKVLWNAA  214
            + DRIKEVHRRCGEG+  LWN++
Sbjct  199  SADRIKEVHRRCGEGDTALWNSS  221


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+GTLG TL RHR  P
Sbjct  51   ADFYVKVDDDVHVNVGTLGATLFRHRSMP  79



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  252  PRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNKYFRHATGQLYAISKDLATYISINRH  311

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDV+LG+WFIGLDV H+DDR++CCGTPPDCEWKAQ GNICVASFDW+CSGIC+
Sbjct  312  ILHKYANEDVTLGSWFIGLDVEHIDDRKMCCGTPPDCEWKAQTGNICVASFDWSCSGICK  371

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDRIKEVHRRCGEGE  LW+  F
Sbjct  372  SVDRIKEVHRRCGEGENALWSTVF  395


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTL  TLA HR KP
Sbjct  224  ADFYVKVDDDVHVNIGTLAATLATHRSKP  252



>ref|XP_010413996.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  260  KKPRLYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  319

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  320  QRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  379

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A F
Sbjct  380  CRSADRIKEVHKRCGEPENAIWKARF  405


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  234  AEFYVKVDDDVHVNIATLGETLVRHRKKP  262



>ref|XP_010413995.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRLYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A F
Sbjct  383  CRSADRIKEVHKRCGEPENAIWKARF  408


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  AEFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_010510018.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Camelina 
sativa]
Length=408

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS N
Sbjct  263  KKPRLYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLN  322

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  323  QRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  382

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+ DRIKEVH+RCGE E  +W A F
Sbjct  383  CRSADRIKEVHKRCGEPENAIWKARF  408


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLGETL RHRKKP
Sbjct  237  AEFYVKVDDDVHVNIATLGETLVRHRKKP  265



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFG  GNKYFRHATGQLYAISKDLA YIS NQH
Sbjct  264  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGAEGNKYFRHATGQLYAISKDLANYISNNQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  324  VLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGE  LWNAAF
Sbjct  384  SSERIKEVHKRCGEGENALWNAAF  407


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIGTLGATLARHRXKP  264



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS NQ
Sbjct  259  KPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEEGNRYFRHATGQLYAISKDLATYISINQ  318

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  319  HVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  378

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+K VHRRCGEGE VLW+ AF
Sbjct  379  KSVERMKVVHRRCGEGENVLWSTAF  403


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TL RHR KP
Sbjct  232  ADFYVKVDDDVHVNIATLGATLMRHRSKP  260



>ref|XP_010063020.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70193.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=402

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS NQ
Sbjct  258  KPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEEGNRYFRHATGQLYAISKDLATYISINQ  317

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  318  HVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  377

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+K VHRRCGEGE VLW+ AF
Sbjct  378  KSVERMKVVHRRCGEGENVLWSTAF  402


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TL RHR KP
Sbjct  231  ADFYVKVDDDVHVNIATLGATLMRHRSKP  259



>ref|XP_009624798.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=365

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLA+YIS N
Sbjct  223  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLASYISVN  279

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  280  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  339

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHR CGEGE  LW AAF
Sbjct  340  CRSVDRIKEVHRHCGEGENALWKAAF  365


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLGETLARHRKKP
Sbjct  197  AEYYIKVDDDVHVNIATLGETLARHRKKP  225



>ref|XP_004251520.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=397

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYISAN
Sbjct  255  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISAN  311

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  312  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  371

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVHR CGEGE  LW AAF
Sbjct  372  CRSVDRMKEVHRHCGEGENALWKAAF  397


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TL ETL RH KKP
Sbjct  229  AEYYIKVDDDVHVNIATLAETLVRHSKKP  257



>ref|XP_010313672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=395

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYISAN
Sbjct  253  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISAN  309

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGI
Sbjct  310  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGI  369

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDR+KEVHR CGEGE  LW AAF
Sbjct  370  CRSVDRMKEVHRHCGEGENALWKAAF  395


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TL ETL RH KKP
Sbjct  227  AEYYIKVDDDVHVNIATLAETLVRHSKKP  255



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   283 bits (725),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            R+YIGCMKSGPVLSQKGVRYHEPE+WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+V
Sbjct  266  RIYIGCMKSGPVLSQKGVRYHEPEHWKFGESGNKYFRHATGQLYAISNDLATYISTNQNV  325

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVS+GAWFIGLDV H+DDRR+CCGTPPDCEWKAQAGNICVASFDW+CSGICR+
Sbjct  326  LHKYANEDVSIGAWFIGLDVEHIDDRRICCGTPPDCEWKAQAGNICVASFDWSCSGICRS  385

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             +RIKEVH+RCGEGE  LW+A+F
Sbjct  386  AERIKEVHKRCGEGENALWSASF  408


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            A++Y+KVDDDVHVNI TLGETL RHR K
Sbjct  237  ADFYVKVDDDVHVNIATLGETLVRHRSK  264



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL++KGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH
Sbjct  268  PRVYIGCMKSGPVLARKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQH  327

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC+
Sbjct  328  VLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICK  387

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RI+EVHRRCGEG+  LW+A F
Sbjct  388  SAERIREVHRRCGEGKNALWSANF  411


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A +YIKVDDDVHVNI TLG TLARHR KP
Sbjct  240  AYFYIKVDDDVHVNIATLGATLARHRSKP  268



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score =   283 bits (724),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPV++QKGVRYHEPEYWKFG  GNKYFRHATGQLYAISKDLA YIS NQH
Sbjct  268  PRVYIGCMKSGPVIAQKGVRYHEPEYWKFGAEGNKYFRHATGQLYAISKDLANYISNNQH  327

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  328  VLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  387

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGE  LWNAAF
Sbjct  388  SSERIKEVHKRCGEGENALWNAAF  411


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  240  ADFYVKVDDDVHVNIGTLGATLARHRSKP  268



>ref|XP_009624797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=402

 Score =   283 bits (723),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLA+YIS N
Sbjct  260  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLASYISVN  316

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  317  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  376

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHR CGEGE  LW AAF
Sbjct  377  CRSVDRIKEVHRHCGEGENALWKAAF  402


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLGETLARHRKKP
Sbjct  234  AEYYIKVDDDVHVNIATLGETLARHRKKP  262



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPV++QKGVRYHEPEYWKFG  GNKYFRHATGQLYAISKDLA YIS NQH
Sbjct  267  PRVYIGCMKSGPVIAQKGVRYHEPEYWKFGAEGNKYFRHATGQLYAISKDLANYISNNQH  326

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV  +DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  327  VLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  386

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH+RCGEGE  LWNAAF
Sbjct  387  SSERIKEVHKRCGEGENALWNAAF  410


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIGTLG TLARHR KP
Sbjct  239  ADFYVKVDDDVHVNIGTLGATLARHRSKP  267



>ref|XP_009624796.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana tomentosiformis]
Length=404

 Score =   283 bits (723),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 3/146 (2%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLA+YIS N
Sbjct  262  KKPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLASYISVN  318

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            QHVLHKY NEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI
Sbjct  319  QHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  378

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+VDRIKEVHR CGEGE  LW AAF
Sbjct  379  CRSVDRIKEVHRHCGEGENALWKAAF  404


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLGETLARHRKKP
Sbjct  236  AEYYIKVDDDVHVNIATLGETLARHRKKP  264



>ref|NP_180802.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 sp|Q9ZV71.1|B3GT3_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAC69935.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08684.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38822.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=409

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVY+GCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHV
Sbjct  267  RVYLGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISLNQHV  326

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+
Sbjct  327  LHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRS  386

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             DRIKEVH+RCGE E  +W A F
Sbjct  387  ADRIKEVHKRCGEPENAIWKARF  409


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            AE+Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  238  AEFYVKVDDDVHVNIATLGETLVRHRKK  265



>ref|XP_002879388.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55647.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVYIGCMKSGPVLSQKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA+YI+ NQHV
Sbjct  267  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYIALNQHV  326

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDV+LGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+
Sbjct  327  LHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRS  386

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             DRIKEVH+RCGE E  +W A F
Sbjct  387  ADRIKEVHKRCGEPENAIWKARF  409


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKK  644
            AE+Y+KVDDDVHVNI TLGETL RHRKK
Sbjct  238  AEFYVKVDDDVHVNIATLGETLVRHRKK  265



>ref|XP_009782227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            P VYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS N+H
Sbjct  255  PMVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINRH  314

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDV+LG+WFIGLDV HVDDR+LCCGTPPDCE KAQAGNICVASFDW+CSGIC+
Sbjct  315  ILHKYANEDVTLGSWFIGLDVEHVDDRKLCCGTPPDCELKAQAGNICVASFDWSCSGICK  374

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RIKEVHRRCGEGE  LW+AAF
Sbjct  375  SVERIKEVHRRCGEGENALWSAAF  398


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+GTL  TLAR+R KP
Sbjct  227  ADFYVKVDDDVHVNLGTLAATLARNRSKP  255



>gb|KHN03478.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=334

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS N
Sbjct  189  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEVGNKYFRHATGQLYAISQDLATYISIN  248

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q +LHKYANEDVSLG+WFIGLDV HVDDRR+CCGTPPDCEWKAQAGNICVASFDW CSGI
Sbjct  249  QGMLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNICVASFDWKCSGI  308

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+R+KEVH+RCGE E  LW+  F
Sbjct  309  CRSVERMKEVHQRCGEDENALWSGTF  334


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL+ HRKKP
Sbjct  163  AEFYVKVDDDVHVNLATLGLTLSMHRKKP  191



>ref|XP_006351966.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=397

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 3/145 (2%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYISANQ
Sbjct  256  KPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISANQ  312

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC
Sbjct  313  HVLHKYTNEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGIC  372

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+VDR+KEVHR CGEGE  LW AAF
Sbjct  373  RSVDRMKEVHRHCGEGENALWKAAF  397


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TL ETLARHR KP
Sbjct  229  AEYYIKVDDDVHVNIATLVETLARHRTKP  257



>ref|XP_006351967.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=395

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 3/145 (2%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVLS+KGVRYHEPEYWKFG   +KYFRHATGQ+YAISKDLATYISANQ
Sbjct  254  KPRIYIGCMKSGPVLSRKGVRYHEPEYWKFG---DKYFRHATGQIYAISKDLATYISANQ  310

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC
Sbjct  311  HVLHKYTNEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGIC  370

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+VDR+KEVHR CGEGE  LW AAF
Sbjct  371  RSVDRMKEVHRHCGEGENALWKAAF  395


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TL ETLARHR KP
Sbjct  227  AEYYIKVDDDVHVNIATLVETLARHRTKP  255



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVY+GCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ 
Sbjct  237  PRVYVGCMKSGPVLAQKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYISINQD  296

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRR+CCGTPPDCEWKAQAGN+CVASFDW CSGICR
Sbjct  297  VLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNVCVASFDWKCSGICR  356

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+KEVH RCGE E  LW+AA 
Sbjct  357  SVERMKEVHLRCGEDENALWSAAL  380


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL+ HR KP
Sbjct  209  AEFYVKVDDDVHVNLATLGLTLSMHRMKP  237



>ref|XP_003550487.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Glycine max]
 ref|XP_006600308.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=374

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS N
Sbjct  229  KKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEVGNKYFRHATGQLYAISQDLATYISIN  288

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q +LHKYANEDVSLG+WFIGLDV HVDDRR+CCGTPPDCEWKAQAGNICVASFDW CSGI
Sbjct  289  QGMLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNICVASFDWKCSGI  348

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+R+KEVH+RCGE E  LW+  F
Sbjct  349  CRSVERMKEVHQRCGEDENALWSGTF  374


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL+ HRKKP
Sbjct  203  AEFYVKVDDDVHVNLATLGLTLSMHRKKP  231



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVY+GCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+
Sbjct  265  RVYMGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHI  324

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++
Sbjct  325  LHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKS  384

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             +R+KEVHRRCGEGE  L +A F
Sbjct  385  AERMKEVHRRCGEGENALLSAVF  407



>ref|XP_009612460.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=398

 Score =   280 bits (716),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GN+YFRHATGQLYAISKDLATYIS N+
Sbjct  254  TPRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEDGNRYFRHATGQLYAISKDLATYISINR  313

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDV+LG+WFIGLDV H+DDR+LCCGTPPDCE KAQAGNICVASFDW+CSGIC
Sbjct  314  HILHKYANEDVTLGSWFIGLDVEHIDDRKLCCGTPPDCELKAQAGNICVASFDWSCSGIC  373

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH RCGEGE  LW+A F
Sbjct  374  KSVERIKEVHSRCGEGENALWSAIF  398


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNIG L  TLARHR  P
Sbjct  227  ADFYVKVDDDVHVNIGALAATLARHRSTP  255



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  639  RVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHV  460
            RVY+GCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+
Sbjct  270  RVYMGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISINQHI  329

Query  459  LHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRT  280
            LHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++
Sbjct  330  LHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKS  389

Query  279  VDRIKEVHRRCGEGEKVLWNAAF  211
             +R+KEVHRRCGEGE  L +A F
Sbjct  390  AERMKEVHRRCGEGENALLSAVF  412



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  636  VYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHVL  457
            +YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVL
Sbjct  271  LYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVL  330

Query  456  HKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTV  277
            HKYANEDVSLGAWFIGLDV H+DDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC++ 
Sbjct  331  HKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICKSA  390

Query  276  DRIKEVHRRCGEGEKVLWNAAF  211
            +RI++VHRRCGEGE  LW A F
Sbjct  391  ERIRDVHRRCGEGENALWGANF  412



>ref|XP_010655390.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI23239.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAISK+LATYIS N+
Sbjct  264  QPRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISKNLATYISINR  323

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKA+AGN+CVASFDW+CSGIC
Sbjct  324  HVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAEAGNVCVASFDWSCSGIC  383

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ +R+K+VH+RCGEG+  LW+A F
Sbjct  384  RSSERMKDVHQRCGEGKNALWSAVF  408



>ref|NP_001141034.1| hypothetical protein [Zea mays]
 gb|ACF85234.1| unknown [Zea mays]
 gb|AFW68304.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
 gb|AFW68305.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=361

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR Y+GCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHA+GQLYAISKDLA+YI+ NQ
Sbjct  217  KPRAYVGCMKSGPVLAQKGVRYHEPEYWKFGEWGNRYFRHASGQLYAISKDLASYIALNQ  276

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC
Sbjct  277  HVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGIC  336

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ DRIKEVH+RCGE E  +WNA F
Sbjct  337  KSADRIKEVHQRCGESENAIWNAEF  361


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLG TLARHR KP
Sbjct  190  AEYYVKVDDDVHVNIATLGNTLARHRSKP  218



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQ
Sbjct  263  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGNICVASFDWTCSGIC
Sbjct  323  HVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAGNICVASFDWTCSGIC  381

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+KEVHRRCGEG+  LW+AAF
Sbjct  382  KSVERMKEVHRRCGEGKNALWSAAF  406


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGATLARHRSKP  264



>gb|KHG10854.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=418

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYI  N
Sbjct  255  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYILIN  314

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNICVASFDW CSGI
Sbjct  315  QDVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWKCSGI  374

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH RCGE +  LW A F
Sbjct  375  CRSVERIMEVHERCGEDKNALWTANF  400


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TLA HRKKP
Sbjct  229  AEFYVKVDDDVHVNLATLGMTLAEHRKKP  257



>ref|XP_002464309.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
 gb|EER91307.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
Length=409

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YI+ NQH
Sbjct  266  PRAYIGCMKSGPVLAQKGVRYHEPEYWKFGEWGNKYFRHATGQLYAISKDLASYIALNQH  325

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC+
Sbjct  326  VLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTTPDCEWKAQAGNVCAASFDWSCSGICK  385

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVH+RCGE E  +WNA F
Sbjct  386  SADRIKEVHQRCGESENAIWNAKF  409


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLG  LARHR KP
Sbjct  238  AEYYIKVDDDVHVNIATLGNVLARHRSKP  266



>ref|XP_003596979.1| hypothetical protein MTR_2g088270 [Medicago truncatula]
 gb|AES67230.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=402

 Score =   278 bits (711),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGETGNKYFRHATGQLYA+SKDLATYI+ N++
Sbjct  260  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGETGNKYFRHATGQLYAVSKDLATYIATNKN  319

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV H+DDRRLCCGT  DCEWKAQAGN CVASFDWTCSGICR
Sbjct  320  VLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGT-TDCEWKAQAGNACVASFDWTCSGICR  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + +RIKEVH++CGEGEK LW+A+F
Sbjct  379  SAERIKEVHKKCGEGEKALWSASF  402


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVNI TLGETL RHR KP
Sbjct  232  ADFYIKVDDDVHVNIATLGETLIRHRSKP  260



>ref|XP_008681412.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68303.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=416

 Score =   278 bits (710),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR Y+GCMKSGPVL+QKGVRYHEPEYWKFGE GN+YFRHA+GQLYAISKDLA+YI+ NQ
Sbjct  272  KPRAYVGCMKSGPVLAQKGVRYHEPEYWKFGEWGNRYFRHASGQLYAISKDLASYIALNQ  331

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC
Sbjct  332  HVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGIC  391

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++ DRIKEVH+RCGE E  +WNA F
Sbjct  392  KSADRIKEVHQRCGESENAIWNAEF  416


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVNI TLG TLARHR KP
Sbjct  245  AEYYVKVDDDVHVNIATLGNTLARHRSKP  273



>ref|XP_006452383.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65623.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=313

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  160  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  219

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR
Sbjct  220  VLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICR  279

Query  282  TVDRIKEVHRRCGEGEK  232
            + +R+KEVHRRCGEG K
Sbjct  280  SAERMKEVHRRCGEGGK  296


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  132  ADFYVKVDDDVHVNIATLGATLARHRSKP  160



>ref|XP_006650268.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=405

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  262  PRAYIGCMKSGPVLAQKGVRYHEPEYWKFGEWGNKYFRHATGQLYAISKDLASYISINQH  321

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC+
Sbjct  322  VLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTQPDCEWKAQAGNVCAASFDWSCSGICK  381

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DR+KEVH+RCGE    +WNA F
Sbjct  382  SADRMKEVHQRCGENGSAIWNAKF  405


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLG  LA+HR KP
Sbjct  234  AEYYIKVDDDVHVNIATLGNILAKHRSKP  262



>gb|KJB57752.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=373

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYI  N
Sbjct  220  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYIFIN  279

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q+VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  280  QNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWRCSGI  339

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH RCGE +  LW+A F
Sbjct  340  CRSVERIMEVHERCGEDKNALWSANF  365


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDD+HVN+ TLG TLARH KKP
Sbjct  194  AEFYVKVDDDIHVNLATLGVTLARHSKKP  222



>gb|KJB13704.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=368

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  226  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  285

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR
Sbjct  286  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICR  344

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDR+K+VHRRCGEG+  L  A F
Sbjct  345  SVDRMKDVHRRCGEGKNALRTATF  368


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  198  ADFYVKVDDDVHVNIATLGATLARHRSKP  226



>gb|KDP20741.1| hypothetical protein JCGZ_21212 [Jatropha curcas]
Length=386

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+++GVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ 
Sbjct  243  PRVYIGCMKSGPVLARRGVRYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYISINQR  302

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ GNIC ASFDW CSGIC+
Sbjct  303  VLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGNICAASFDWKCSGICK  362

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RI EVH+RCGE E  LW A F
Sbjct  363  SVERIMEVHKRCGEDENALWTARF  386



>ref|XP_007026088.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28710.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=415

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS NQ+
Sbjct  264  PRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYISINQN  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNICVASFDW CSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICVASFDWRCSGICR  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RI EVH RCGE +  LW+  F
Sbjct  384  SVERIIEVHERCGEDKNALWSTNF  407


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TLA H  KP
Sbjct  236  AEFYVKVDDDVHVNLATLGSTLAGHSNKP  264



>ref|NP_001050543.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|AAT76370.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 gb|ABF97265.1| Galactosyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12457.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|EAY90748.1| hypothetical protein OsI_12348 [Oryza sativa Indica Group]
 gb|EAZ27579.1| hypothetical protein OsJ_11528 [Oryza sativa Japonica Group]
Length=406

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR YIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  263  PRAYIGCMKSGPVLAQKGVRYHEPEYWKFGEWGNKYFRHATGQLYAISKDLASYISINQH  322

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC+
Sbjct  323  VLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTQPDCEWKAQAGNVCAASFDWSCSGICK  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DR+KEVH+RCGE +  +W+A F
Sbjct  383  SADRMKEVHQRCGENDSAIWSAKF  406


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYYIKVDDDVHVNI TLG  LA+HR KP
Sbjct  235  AEYYIKVDDDVHVNIATLGNILAKHRSKP  263



>gb|KJB57747.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=406

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYI  N
Sbjct  253  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYIFIN  312

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q+VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  313  QNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWRCSGI  372

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH RCGE +  LW+A F
Sbjct  373  CRSVERIMEVHERCGEDKNALWSANF  398


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDD+HVN+ TLG TLARH KKP
Sbjct  227  AEFYVKVDDDIHVNLATLGVTLARHSKKP  255



>gb|KJB13705.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=373

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  231  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  290

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR
Sbjct  291  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICR  349

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDR+K+VHRRCGEG+  L  A F
Sbjct  350  SVDRMKDVHRRCGEGKNALRTATF  373


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  203  ADFYVKVDDDVHVNIATLGATLARHRSKP  231



>ref|XP_004507687.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=378

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ 
Sbjct  234  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISQDLATYISTNQD  293

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRR+CCGTPPDCEWKAQAGNIC ASFDW CSGICR
Sbjct  294  VLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAGNICAASFDWKCSGICR  353

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+++VH RCGE E  LW++ F
Sbjct  354  SVERMQDVHLRCGEDENALWSSTF  377



>ref|XP_011097870.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Sesamum indicum]
Length=403

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQH
Sbjct  261  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEQGNKYFRHATGQIYAISKDLATYISINQH  320

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC 
Sbjct  321  ILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICN  379

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVHRRCGEGE  LW A F
Sbjct  380  SADRIKEVHRRCGEGEDSLWAADF  403


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  233  ADFYVKVDDDVHVNIATLGGTLARHRLKP  261



>ref|XP_002518474.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43861.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=388

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPV+++KGVRYHEPEYWKFGE GN+YFRHATGQLYAISKDLATYIS NQH
Sbjct  245  PRVYIGCMKSGPVIARKGVRYHEPEYWKFGEVGNRYFRHATGQLYAISKDLATYISVNQH  304

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWK Q GN+C ASFDW CSGIC+
Sbjct  305  VLHKYANEDVSLGSWFIGLDVDHVDDRRLCCGTPPDCEWKTQLGNVCAASFDWKCSGICK  364

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RI EVH+RCGE E  LW A F
Sbjct  365  SVERIMEVHKRCGEDENALWTATF  388


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TLA HR KP
Sbjct  217  AEFYVKVDDDVHVNLATLGMTLAGHRMKP  245



>gb|KHG03847.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=407

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYI  N
Sbjct  254  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISKDLATYIFIN  313

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q+VLHKYANEDVSLGAWFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  314  QNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWRCSGI  373

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH RCGE +  LW+A F
Sbjct  374  CRSVERIVEVHERCGEDKNALWSANF  399


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDD+HVN+ TLG  LARHRKKP
Sbjct  228  AEFYVKVDDDIHVNLATLGVALARHRKKP  256



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  249  TPRVYIGCMKSGPVLSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  308

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGL+V H+DDR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  309  HILHKYANEDVSLGSWFIGLEVEHIDDRDMCCGTPPDCEWKAQAGNLCVASFDWSCSGIC  368

Query  285  RTVDRIKEVHRRCGEGEKVLWNA  217
            ++VD+I+ VH++CGEGE  LWNA
Sbjct  369  KSVDKIQFVHQQCGEGEDALWNA  391



>ref|XP_003562342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=405

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS N+H
Sbjct  262  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEWGNKYFRHATGQLYAISKDLASYISINKH  321

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLGAWFIG+D  H+D+RRLCCGTPPDCEWK QAGN+C ASFDW+CSGIC+
Sbjct  322  VLHKYANEDVSLGAWFIGVDAEHIDERRLCCGTPPDCEWKTQAGNVCAASFDWSCSGICK  381

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVH+RCGE    +WNA F
Sbjct  382  SADRIKEVHQRCGESANAIWNATF  405


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A+YY+KVDDDVHVNI TLG  LARHR KP
Sbjct  234  ADYYVKVDDDVHVNIATLGGILARHRSKP  262



>gb|KJB13702.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=406

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  264  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICR  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDR+K+VHRRCGEG+  L  A F
Sbjct  383  SVDRMKDVHRRCGEGKNALRTATF  406


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGATLARHRSKP  264



>ref|XP_010092200.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB50426.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=407

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL++KGVRYHEPEYWKFG  GNKYFRHATGQLYA+SK+LATYIS NQH
Sbjct  264  PRVYIGCMKSGPVLARKGVRYHEPEYWKFGTAGNKYFRHATGQLYAVSKELATYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVS+G+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGN+CVASFDW CSGIC 
Sbjct  324  VLHKYANEDVSVGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNMCVASFDWRCSGICS  383

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+ EVHRRC E E  LW+ +F
Sbjct  384  SVERMAEVHRRCSEDENTLWSESF  407



>gb|KJB69212.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=346

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLY ISKDLATYI  N
Sbjct  183  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYVISKDLATYILIN  242

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  243  QDVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWKCSGI  302

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH +CGE +  LW   F
Sbjct  303  CRSVERIMEVHEQCGEDKNALWTTNF  328


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL  HRKKP
Sbjct  157  AEFYVKVDDDVHVNLATLGMTLTEHRKKP  185



>gb|KDO78242.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=359

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYA+SKDLATYIS NQ
Sbjct  215  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYALSKDLATYISINQ  274

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  275  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  334

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  335  KSVERIKEVHELCGEGEDTLWRASF  359


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVN+ TLG TLA HR KP
Sbjct  188  AEFYIKVDDDVHVNLATLGMTLAAHRTKP  216



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  252  KPRVYIGCMKSGPVLSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNQ  311

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+DDR LCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  312  PILHKYANEDVSLGAWFIGLEVEHIDDRNLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  371

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIK+VH RCGEG+  +W+  F
Sbjct  372  KSVERIKDVHARCGEGDGAIWSTPF  396


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  225  AEFYVKVDDDVHVNLGMLASTLARHRSKP  253



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  264  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHK+ANEDVSLG+WFIGLD  H+DDRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR
Sbjct  324  VLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICR  383

Query  282  TVDRIKEVHRRCGEGEK  232
            + +R+KEVHRRCGEG K
Sbjct  384  SAERMKEVHRRCGEGGK  400


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGATLARHRSKP  264



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  253  KPRVYIGCMKSGPVLSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNQ  312

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+DDR LCCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  313  PILHKYANEDVSLGAWFIGLEVEHIDDRNLCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  372

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIK+VH RCGEG+  +W+  F
Sbjct  373  KSVERIKDVHARCGEGDGAIWSTPF  397


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  226  AEFYVKVDDDVHVNLGMLASTLARHRSKP  254



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ
Sbjct  262  KPRVYIGCMKSGPVLAQKGVRYHEPEFWKFGEEGNKYFRHATGQLYAISRDLASYISINQ  321

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC
Sbjct  322  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGIC  380

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DR+K+VHRRCGEG   LW+++F
Sbjct  381  RSADRMKDVHRRCGEGHNALWSSSF  405


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLG TLA HR KP
Sbjct  235  AEFYVKVDDDVHVNIATLGATLATHRMKP  263



>gb|KDO78243.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=317

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYA+SKDLATYIS NQ
Sbjct  173  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYALSKDLATYISINQ  232

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  233  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  292

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  293  KSVERIKEVHELCGEGEDTLWRASF  317


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVN+ TLG TLA HR KP
Sbjct  146  AEFYIKVDDDVHVNLATLGMTLAAHRTKP  174



>gb|KHG30061.1| putative beta-1,3-galactosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=406

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAISKDLA+YIS NQH
Sbjct  264  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISKDLASYISINQH  323

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR
Sbjct  324  VLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICR  382

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +VDR+++VHRRCGEG+  L  A F
Sbjct  383  SVDRMRDVHRRCGEGKNALRTATF  406


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  236  ADFYVKVDDDVHVNIATLGATLARHRSKP  264



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ
Sbjct  285  KPRVYIGCMKSGPVLAQKGVRYHEPEFWKFGEEGNKYFRHATGQLYAISRDLASYISINQ  344

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            HVLHKYANEDVSLGAWFIGLDV H+DDRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC
Sbjct  345  HVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGIC  403

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DR+K+VHRRCGEG   LW+++F
Sbjct  404  RSADRMKDVHRRCGEGHNALWSSSF  428


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVNI TLG TLA HR KP
Sbjct  258  AEFYVKVDDDVHVNIATLGATLATHRMKP  286



>ref|XP_011097866.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097867.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097869.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
Length=474

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQH
Sbjct  332  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEQGNKYFRHATGQIYAISKDLATYISINQH  391

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+WFIGLDV H+DDRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC 
Sbjct  392  ILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICN  450

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            + DRIKEVHRRCGEGE  LW A F
Sbjct  451  SADRIKEVHRRCGEGEDSLWAADF  474


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  304  ADFYVKVDDDVHVNIATLGGTLARHRLKP  332



>ref|XP_006449734.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62974.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=343

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQ
Sbjct  199  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYAISNDLATYISINQ  258

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  259  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  318

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  319  KSVERIKEVHELCGEGEDTLWRASF  343



>ref|XP_006467429.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|KDO78235.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=397

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYA+SKDLATYIS NQ
Sbjct  253  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYALSKDLATYISINQ  312

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  313  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  372

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  373  KSVERIKEVHELCGEGEDTLWRASF  397


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVN+ TLG TLA HR KP
Sbjct  226  AEFYIKVDDDVHVNLATLGMTLAAHRTKP  254



>ref|NP_001183433.1| uncharacterized protein LOC100501859 [Zea mays]
 gb|ACR34699.1| unknown [Zea mays]
 gb|ACR36777.1| unknown [Zea mays]
Length=200

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS+KGVRY+EPE+WKFGE+GNKYFRHATGQLYA+SKDLATYIS N+H
Sbjct  57   PRVYIGCMKSGPVLSEKGVRYYEPEHWKFGESGNKYFRHATGQLYAVSKDLATYISINKH  116

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+C ASFDW CSGIC 
Sbjct  117  ILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCAASFDWRCSGICN  176

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  177  SEGRIWEVHNKCAEGEKALWNATF  200



>ref|XP_006467430.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO78236.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=396

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYA+SKDLATYIS NQ
Sbjct  252  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYALSKDLATYISINQ  311

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  312  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  371

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  372  KSVERIKEVHELCGEGEDTLWRASF  396


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+YIKVDDDVHVN+ TLG TLA HR KP
Sbjct  225  AEFYIKVDDDVHVNLATLGMTLAAHRTKP  253



>ref|XP_007039333.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY23834.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=402

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H
Sbjct  259  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC+
Sbjct  319  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICK  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG++ +W+ +F
Sbjct  379  SVERMEEVHQRCGEGDEAIWHTSF  402


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  231  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  259



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YA+SKDLATYIS NQH
Sbjct  253  PRVYIGCMKSGPVLSQKNVKYHEPEYWKFGEDGNKYFRHATGQIYALSKDLATYISINQH  312

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDCEWK+QAGN+C+ASFDW+CSGIC+
Sbjct  313  ILHKYANEDVSLGAWFIGLEVEHIDERNMCCGTPPDCEWKSQAGNVCIASFDWSCSGICK  372

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V+++K VH +CGEGE+ LWNA
Sbjct  373  SVEKMKFVHEQCGEGEEALWNA  394


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+GTL  TLARHR KP
Sbjct  225  ADFYVKVDDDVHVNLGTLAATLARHRPKP  253



>ref|XP_007039332.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY23833.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H
Sbjct  254  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRH  313

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC+
Sbjct  314  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICK  373

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG++ +W+ +F
Sbjct  374  SVERMEEVHQRCGEGDEAIWHTSF  397


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  226  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  254



>gb|KCW70545.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=313

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  170  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  229

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  230  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  289

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  290  SVEKIKDVHRRCGEGDAAVWDA  311


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  142  ADFYIKVDDDVHVNLGMLATTLARHRSKP  170



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ 
Sbjct  252  PRVYIGCMKSGPVLAQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQP  311

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  312  LLHKYANEDVSLGAWFIGLEVEHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  371

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+++K VH +CGEGE+ LWNA  
Sbjct  372  SVEKLKFVHEQCGEGEEALWNALL  395


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+GTL   LARHR KP
Sbjct  224  ADFYVKVDDDVHVNLGTLAANLARHRSKP  252



>gb|KJB69211.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=417

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLY ISKDLATYI  N
Sbjct  254  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYVISKDLATYILIN  313

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  314  QDVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWKCSGI  373

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH +CGE +  LW   F
Sbjct  374  CRSVERIMEVHEQCGEDKNALWTTNF  399


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL  HRKKP
Sbjct  228  AEFYVKVDDDVHVNLATLGMTLTEHRKKP  256



>gb|KJB69210.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=418

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            + PRVYIGCMKSGPVL++KGV+YHEPEYWKFGE GNKYFRHATGQLY ISKDLATYI  N
Sbjct  255  KKPRVYIGCMKSGPVLARKGVKYHEPEYWKFGEVGNKYFRHATGQLYVISKDLATYILIN  314

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGI
Sbjct  315  QDVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAGNICAASFDWKCSGI  374

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+RI EVH +CGE +  LW   F
Sbjct  375  CRSVERIMEVHEQCGEDKNALWTTNF  400


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+ TLG TL  HRKKP
Sbjct  229  AEFYVKVDDDVHVNLATLGMTLTEHRKKP  257



>ref|XP_006449733.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62973.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=407

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVY+GCMKSGPVL++KGV+Y+EPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQ
Sbjct  263  KPRVYVGCMKSGPVLARKGVKYYEPEYWKFGEIGNKYFRHATGQLYAISNDLATYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LHKYANEDVSLG+WFIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC
Sbjct  323  HLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+RIKEVH  CGEGE  LW A+F
Sbjct  383  KSVERIKEVHELCGEGEDTLWRASF  407



>ref|XP_010251481.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Nelumbo 
nucifera]
Length=402

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  259  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQLYAISKDLATYISVNRH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC+
Sbjct  319  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAGNSCGASFDWSCSGICK  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG+  +W+A F
Sbjct  379  SVERMEEVHQRCGEGDGAIWHANF  402


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN G +G TLARH+ KP
Sbjct  231  ADFYIKVDDDVHVNPGMVGSTLARHKSKP  259



>ref|XP_002518935.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43468.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=403

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISK+LATYIS N+H
Sbjct  260  PRVYIGCMKSGPVLSQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKNLATYISVNRH  319

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVS+G+WFIGLDV H+DDR LCCGTPPDCEWKAQAGN C ASFDWTCSGIC+
Sbjct  320  ILHRYANEDVSMGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAGNPCAASFDWTCSGICK  379

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG+  +W+ +F
Sbjct  380  SVERMEEVHQRCGEGDGAIWHTSF  403


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVH+N+G +G TLARHR KP
Sbjct  232  ADFYIKVDDDVHINLGMIGSTLARHRSKP  260



>ref|XP_007039335.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
 gb|EOY23836.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
Length=429

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H
Sbjct  286  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRH  345

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC+
Sbjct  346  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICK  405

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG++ +W+ +F
Sbjct  406  SVERMEEVHQRCGEGDEAIWHTSF  429


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  258  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  286



>ref|XP_009601250.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  176  KPRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  235

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC
Sbjct  236  PILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGIC  295

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+++K VH +CGEGE+ LWNA F
Sbjct  296  KSVEKLKYVHEKCGEGEEALWNALF  320


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  149  ADFYVKVDDDVHVNLGMLAATLARHRSKP  177



>ref|XP_009786663.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=320

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  176  KPRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  235

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC
Sbjct  236  PILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGIC  295

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+++K VH +CGEGE+ LWNA F
Sbjct  296  KSVEKLKYVHEKCGEGEEALWNALF  320


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  149  ADFYVKVDDDVHVNLGMLAATLARHRSKP  177



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  213  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  272

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  273  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  332

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  333  SVEKIKDVHRRCGEGDAAVWDA  354


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  185  ADFYIKVDDDVHVNLGMLATTLARHRSKP  213



>ref|NP_001149120.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
 gb|ACG34259.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=366

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS+KGVRY+EPE+WKFGE+GNKYFRHATGQLYA+SKDLATYIS N+H
Sbjct  223  PRVYIGCMKSGPVLSEKGVRYYEPEHWKFGESGNKYFRHATGQLYAVSKDLATYISINKH  282

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+C ASFDW CSGIC 
Sbjct  283  ILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCAASFDWRCSGICN  342

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  343  SEGRIWEVHNKCAEGEKALWNATF  366



>gb|KDP25226.1| hypothetical protein JCGZ_20382 [Jatropha curcas]
Length=403

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+
Sbjct  259  KPRVYIGCMKSGPVLSQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNR  318

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LH+Y+NEDVSLG+WFIGLDV H+D+R LCCGTPPDCEWKAQAGN C ASFDWTCSGIC
Sbjct  319  HILHRYSNEDVSLGSWFIGLDVEHIDERSLCCGTPPDCEWKAQAGNPCAASFDWTCSGIC  378

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+ EVH+RCGEG+  +W+ +F
Sbjct  379  KSVERMVEVHQRCGEGDGAIWHTSF  403


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  232  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  260



>ref|XP_002977391.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ21395.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GN+YFRHATGQLYAISKDLATYIS NQH
Sbjct  259  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEDGNRYFRHATGQLYAISKDLATYISINQH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLGAWFIGLDV+H+D+R  CCGTPPDCEW+A+AGN+CVASFDW CSGIC+
Sbjct  319  ILHQYANEDVSLGAWFIGLDVNHIDERSFCCGTPPDCEWQAEAGNVCVASFDWPCSGICK  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+K VH+RCGEG   +W+A F
Sbjct  379  SVERMKTVHKRCGEGNGAIWSAKF  402



>ref|XP_006364961.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010312804.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=320

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  176  KPRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  235

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC
Sbjct  236  PILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGIC  295

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+++K VH +CGEGE+ LWNA F
Sbjct  296  KSVEKLKYVHEKCGEGEEALWNALF  320


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  149  ADFYVKVDDDVHVNLGMLAATLARHRSKP  177



>gb|KHN35737.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=147

 Score =   261 bits (668),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 2/146 (1%)
 Frame = -1

Query  648  RNPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISAN  469
            R PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQLYAIS+DLA YIS N
Sbjct  4    RKPRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEVGNKYFRHATGQLYAISQDLAAYISIN  63

Query  468  QHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGI  289
            Q VLHKYANEDVSLG+WFIGLDV HVDDR++CCGTPP  EWKAQAGNICVASFDW CSGI
Sbjct  64   QDVLHKYANEDVSLGSWFIGLDVDHVDDRKMCCGTPP--EWKAQAGNICVASFDWKCSGI  121

Query  288  CRTVDRIKEVHRRCGEGEKVLWNAAF  211
            CR+V+R+KEVH+RCGE E  LW+A  
Sbjct  122  CRSVERMKEVHQRCGEDENALWSATL  147



>ref|XP_011074895.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=372

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ 
Sbjct  229  PRVYIGCMKSGPVLSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQP  288

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLG+WFIGL+V H+D+R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  289  ILHKYANEDVSLGSWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  348

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+++K VH +CGEGE+ LWNA  
Sbjct  349  SVEKMKFVHDQCGEGEEALWNALL  372


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+GTL  TLARHR KP
Sbjct  201  ADFYVKVDDDVHVNLGTLAATLARHRSKP  229



>ref|XP_001781844.1| predicted protein [Physcomitrella patens]
 gb|EDQ53299.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAIS+DLA YIS NQ 
Sbjct  227  PRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISRDLANYISVNQP  286

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHK+ANEDVSLGAW IGLDV H+DDR +CCGTPPDCEWKAQAGN+CVASFDWTCSGIC+
Sbjct  287  LLHKFANEDVSLGAWIIGLDVDHIDDRSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICK  346

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RI+EVH+RCGEG+  +W+A F
Sbjct  347  SVERIQEVHQRCGEGDGAVWSAVF  370


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G LG TLARHR KP
Sbjct  199  ADFYVKVDDDVHVNLGVLGTTLARHRSKP  227



>ref|XP_002974972.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23757.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVY+GCMKSGPVL+QKGV+YHEPEYWKFGE GN+YFRHATGQLYAISKDLATYIS NQH
Sbjct  259  PRVYVGCMKSGPVLAQKGVKYHEPEYWKFGEDGNRYFRHATGQLYAISKDLATYISINQH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLGAWFIGLDV+H+D+R  CCGTPPDCEW+A+AGN+CVASFDW CSGIC+
Sbjct  319  ILHQYANEDVSLGAWFIGLDVNHIDERSFCCGTPPDCEWQAEAGNVCVASFDWPCSGICK  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+K VH+RCGEG   +W+A F
Sbjct  379  SVERMKTVHKRCGEGNGAIWSAKF  402



>ref|XP_002451594.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
 gb|EES04570.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
Length=402

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS+KGVRY+EPE+WKFGE+GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  259  PRVYIGCMKSGPVLSEKGVRYYEPEHWKFGESGNKYFRHATGQLYAISKDLATYISINKH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGNIC ASFDW CSGIC 
Sbjct  319  ILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICAASFDWRCSGICN  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  379  SEGRIWEVHNKCAEGEKALWNATF  402



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVY+GCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ 
Sbjct  253  PRVYMGCMKSGPVLSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQP  312

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  313  ILHKYANEDVSLGAWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  372

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V++IK+VH RCGEG+  +W+A F
Sbjct  373  SVEKIKDVHERCGEGDGAVWSALF  396


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  225  AEFYVKVDDDVHVNLGMLAATLARHRSKP  253



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  252  KPRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  311

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC
Sbjct  312  PILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGIC  371

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+++K VH +CGEGE+ LWNA F
Sbjct  372  KSVEKLKYVHEKCGEGEEALWNALF  396


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  225  ADFYVKVDDDVHVNLGMLAATLARHRSKP  253



>ref|XP_001758882.1| predicted protein [Physcomitrella patens]
 gb|EDQ76388.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGV+YHEPEYWKFGE GNKYFRHATGQ+YA+SKDLA YI+ NQ 
Sbjct  254  PRVYIGCMKSGPVLNQKGVKYHEPEYWKFGEEGNKYFRHATGQIYALSKDLANYIAVNQL  313

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAW IGLDV HVDDR +CCGTPPDCEWKA AGNICVASFDWTCSGIC+
Sbjct  314  LLHKYANEDVSLGAWIIGLDVSHVDDRNMCCGTPPDCEWKALAGNICVASFDWTCSGICK  373

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+RIKEVH+RCGEG+  +W+A F
Sbjct  374  SVERIKEVHQRCGEGDDAVWSAVF  397


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G LG TLARHR KP
Sbjct  226  ADFYVKVDDDVHVNLGVLGTTLARHRSKP  254



>ref|NP_001045990.1| Os02g0164300 [Oryza sativa Japonica Group]
 dbj|BAF07904.1| Os02g0164300, partial [Oryza sativa Japonica Group]
Length=182

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL++KGVRY+EPE+WKFGE GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  39   PRVYIGCMKSGPVLTEKGVRYYEPEHWKFGEPGNKYFRHATGQLYAISKDLATYISINRH  98

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN C ASFDW CSGIC 
Sbjct  99   VLHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNTCAASFDWRCSGICN  158

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  159  SEGRIWEVHNKCAEGEKALWNATF  182



>ref|XP_006439187.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52427.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=314

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+
Sbjct  170  KPRVYIGCMKSGPVLGQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNR  229

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LH+YANEDVSLG+WFIGLDV H+DDR LCCGT PDCEWKAQAGN C ASFDW+CSG+C
Sbjct  230  HILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVC  289

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+ EVH+RCGEG++ +W+ +F
Sbjct  290  KSVERMGEVHQRCGEGDEAIWHTSF  314


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  143  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  171



>gb|KDO76779.1| hypothetical protein CISIN_1g021312mg [Citrus sinensis]
Length=314

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+
Sbjct  170  KPRVYIGCMKSGPVLGQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNR  229

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            H+LH+YANEDVSLG+WFIGLDV H+DDR LCCGT PDCEWKAQAGN C ASFDW+CSG+C
Sbjct  230  HILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVC  289

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+ EVH+RCGEG++ +W+ +F
Sbjct  290  KSVERMGEVHQRCGEGDEAIWHTSF  314


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  143  ADFYIKVDDDVHVNLGMVGSTLARHRSKP  171



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ 
Sbjct  253  PRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQP  312

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC+
Sbjct  313  ILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICK  372

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+++K VH +CGEGE+ LWNA F
Sbjct  373  SVEKLKYVHEKCGEGEEALWNALF  396


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  225  ADFYVKVDDDVHVNLGMLAATLARHRSKP  253



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PR+YIGCMKSGPVL+QK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ 
Sbjct  253  PRIYIGCMKSGPVLAQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQP  312

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+D+R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC+
Sbjct  313  ILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICK  372

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+++K VH +CGEGE+ LWNA F
Sbjct  373  SVEKLKYVHEKCGEGEEALWNALF  396


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  225  ADFYVKVDDDVHVNLGMLAATLARHRSKP  253



>emb|CAB36540.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
 emb|CAB79549.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
Length=406

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS++LA+YIS NQ
Sbjct  263  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRELASYISINQ  322

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            +VLHKY NEDVSLG+WF+GLDV HVDDRRLCCGT  DCEWKAQAGNICVASFDW+CSGIC
Sbjct  323  NVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGT-TDCEWKAQAGNICVASFDWSCSGIC  381

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DR+K+VHRRCGEGEK L  A+F
Sbjct  382  RSADRMKDVHRRCGEGEKALLAASF  406



>ref|XP_006439188.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52428.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=229

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL QKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H
Sbjct  86   PRVYIGCMKSGPVLGQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRH  145

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGT PDCEWKAQAGN C ASFDW+CSG+C+
Sbjct  146  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVCK  205

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R+ EVH+RCGEG++ +W+ +F
Sbjct  206  SVERMGEVHQRCGEGDEAIWHTSF  229


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G +G TLARHR KP
Sbjct  58   ADFYIKVDDDVHVNLGMVGSTLARHRSKP  86



>ref|XP_002867534.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43793.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS++LA+YIS NQ
Sbjct  264  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRELASYISINQ  323

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            +VLHKY NEDVSLG+WF+GLDV HVDDRRLCCGT  DCEWKAQAGNICVASFDW+CSGIC
Sbjct  324  NVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGT-TDCEWKAQAGNICVASFDWSCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DR+K+VHRRCGEGEK L  A+F
Sbjct  383  RSADRMKDVHRRCGEGEKALLAASF  407



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  246  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  305

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  306  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  365

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  366  SVEKIKDVHRRCGEGDAAVWDA  387


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  218  ADFYIKVDDDVHVNLGMLATTLARHRSKP  246



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  245  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  304

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  305  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  364

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  365  SVEKIKDVHRRCGEGDAAVWDA  386


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  217  ADFYIKVDDDVHVNLGMLATTLARHRSKP  245



>ref|NP_567762.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 sp|Q8LEJ9.1|B3GT4_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 4 [Arabidopsis 
thaliana]
 gb|AAM62612.1| Avr9 elicitor response-like protein [Arabidopsis thaliana]
 gb|AEE85272.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=407

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQLYAIS++LA+YIS NQ
Sbjct  264  KPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISRELASYISINQ  323

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
            +VLHKY NEDVSLG+WF+GLDV HVDDRRLCCGT  DCEWKAQAGNICVASFDW+CSGIC
Sbjct  324  NVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGT-TDCEWKAQAGNICVASFDWSCSGIC  382

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            R+ DR+K+VHRRCGEGEK L  A+F
Sbjct  383  RSADRMKDVHRRCGEGEKALLAASF  407



>ref|XP_011040606.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Populus 
euphratica]
Length=403

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H
Sbjct  260  PRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRH  319

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+DDR LCCGT PDCEWK QAGN C ASFDW+CSGIC+
Sbjct  320  ILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKTQAGNPCAASFDWSCSGICK  379

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG++ +W+ +F
Sbjct  380  SVERMEEVHQRCGEGDEAIWHTSF  403


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVH+N+G +G TLARHR KP
Sbjct  232  ADFYIKVDDDVHINLGMVGSTLARHRSKP  260



>gb|KDP32735.1| hypothetical protein JCGZ_12027 [Jatropha curcas]
Length=398

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  254  KPRVYIGCMKSGPVLSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  313

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLG+WFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC
Sbjct  314  PLLHKYANEDVSLGSWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGIC  373

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V++IK VH RCGEG+  +W+A F
Sbjct  374  KSVEKIKFVHERCGEGDGAVWSALF  398


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AEYY+KVDDDVHVN+G L  TLARHR KP
Sbjct  227  AEYYVKVDDDVHVNLGMLAATLARHRSKP  255



>gb|KJB62840.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=367

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQH
Sbjct  226  PRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEEGNKYFRHATGQLYAISRDLASYISINQH  285

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDR LCCGT  DCEWKAQAGN+CVASFDWTCSGIC+
Sbjct  286  VLHKYANEDVSLGSWFIGLDVDHIDDRSLCCGT-TDCEWKAQAGNVCVASFDWTCSGICK  344

Query  282  TVDRIKEVHRRCGEGEKVLWNAA  214
            +V+R+K+VHRRCGEG+  LW  A
Sbjct  345  SVERMKDVHRRCGEGKNALWTEA  367


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  198  ADFYVKVDDDVHVNIATLGATLARHRTKP  226



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  249  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  308

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  309  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  368

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  369  SVEKIKDVHRRCGEGDAAVWDA  390


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  221  ADFYIKVDDDVHVNLGMLATTLARHRSKP  249



>gb|KJB62839.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=368

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVL+QKGVRYHEPE+WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQH
Sbjct  227  PRVYIGCMKSGPVLAQKGVRYHEPEHWKFGEEGNKYFRHATGQLYAISRDLASYISINQH  286

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            VLHKYANEDVSLG+WFIGLDV H+DDR LCCGT  DCEWKAQAGN+CVASFDWTCSGIC+
Sbjct  287  VLHKYANEDVSLGSWFIGLDVDHIDDRSLCCGT-TDCEWKAQAGNVCVASFDWTCSGICK  345

Query  282  TVDRIKEVHRRCGEGEKVLWNAA  214
            +V+R+K+VHRRCGEG+  LW  A
Sbjct  346  SVERMKDVHRRCGEGKNALWTEA  368


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++Y+KVDDDVHVNI TLG TLARHR KP
Sbjct  199  ADFYVKVDDDVHVNIATLGATLARHRTKP  227



>ref|XP_010916559.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PR YIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  254  KPRTYIGCMKSGPVLSQKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQ  313

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLG+WFIGL+V H+D+R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC
Sbjct  314  PILHKYANEDVSLGSWFIGLEVEHIDERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGIC  373

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V+R+KEVH RCGEG+  +W+A F
Sbjct  374  KSVERMKEVHARCGEGDDGVWSALF  398


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TLARHR KP
Sbjct  227  AEFYVKVDDDVHVNLGMLAATLARHRSKP  255



>ref|XP_004951866.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=403

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS+KGVRY+EPE+WKFGE+GNKYFRHATGQLYAISKDLATYIS N+H
Sbjct  260  PRVYIGCMKSGPVLSEKGVRYYEPEHWKFGESGNKYFRHATGQLYAISKDLATYISINKH  319

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKY NEDVSLG+WFIGLDV H+DD+RLCCGTPPDCEWKAQAGNIC ASFDW CSGIC 
Sbjct  320  ILHKYINEDVSLGSWFIGLDVEHIDDKRLCCGTPPDCEWKAQAGNICAASFDWRCSGICN  379

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  380  SEGRIWEVHNKCAEGEKALWNATF  403



>ref|XP_008677265.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2 isoform X1 [Zea 
mays]
 gb|AFW66428.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=402

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS+KGVRY+EPE+WKFGE+GNKYFRHATGQLYA+SKDLATYIS N+H
Sbjct  259  PRVYIGCMKSGPVLSEKGVRYYEPEHWKFGESGNKYFRHATGQLYAVSKDLATYISINKH  318

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKY NEDVSLG+WFIGLDV H+DDRRLCCGTPPDCEWKAQAGN+C ASFDW CSGIC 
Sbjct  319  ILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNVCAASFDWRCSGICN  378

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +  RI EVH +C EGEK LWNA F
Sbjct  379  SEGRIWEVHNKCAEGEKALWNATF  402



>gb|KJB64380.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=322

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YAISK+LATYIS NQ 
Sbjct  179  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKELATYISINQP  238

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  239  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  298

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+++K VH+RCGEG+  +WN   
Sbjct  299  SVEKLKTVHKRCGEGDDAVWNTLL  322


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TL RHR KP
Sbjct  151  AEFYVKVDDDVHVNLGMLATTLGRHRSKP  179



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLS K V+YHEPEYWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ 
Sbjct  248  PRVYIGCMKSGPVLSSKNVKYHEPEYWKFGEEGNKYFRHATGQIYALSRDLATYISINQP  307

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC+
Sbjct  308  ILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICK  367

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK+VHRRCGEG+  +W+A
Sbjct  368  SVEKIKDVHRRCGEGDAAVWDA  389


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            A++YIKVDDDVHVN+G L  TLARHR KP
Sbjct  220  ADFYIKVDDDVHVNLGMLATTLARHRSKP  248



>ref|XP_006846610.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
 gb|ERN08285.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
Length=396

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHA+GQ+YAISKDLATYIS NQ 
Sbjct  253  PRVYIGCMKSGPVLSQKSVKYHEPEYWKFGEEGNKYFRHASGQIYAISKDLATYISINQP  312

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LHKYANEDVSLGAWFIGL+V H+DDR  CCGTPPDCEWKAQAGN+CVASFDW+CSGIC+
Sbjct  313  ILHKYANEDVSLGAWFIGLEVEHIDDRSFCCGTPPDCEWKAQAGNVCVASFDWSCSGICK  372

Query  282  TVDRIKEVHRRCGEGEKVLWNA  217
            +V++IK VH RCGEG+  +W+A
Sbjct  373  SVEKIKNVHTRCGEGDGAVWSA  394


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  727  AEYYIKVDDDVHVNIGTLGETLARHRKKP  641
            AE+Y+KVDDDVHVN+G L  TLARH+ KP
Sbjct  225  AEFYVKVDDDVHVNLGMLVATLARHQSKP  253



>ref|XP_010095510.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
 gb|EXB60484.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
Length=397

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  645  NPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQ  466
             PRVYIGCMKSGPVLSQK V+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ
Sbjct  253  KPRVYIGCMKSGPVLSQKNVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLATYISINQ  312

Query  465  HVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC  286
             +LHKYANEDVSLG+WFIGL+V H+DDR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC
Sbjct  313  PILHKYANEDVSLGSWFIGLEVEHIDDRNMCCGTPPDCEWKAQAGNVCVASFDWSCSGIC  372

Query  285  RTVDRIKEVHRRCGEGEKVLWNAAF  211
            ++V++IK VH +CGEG+  +W++ F
Sbjct  373  KSVEKIKFVHEKCGEGDGTVWSSLF  397



>ref|XP_009589155.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Nicotiana 
tomentosiformis]
Length=409

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  642  PRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQH  463
            PRVYIGCMKSGPVLSQKGV+YHEPEYWKFGE GNKYFRHATGQ+YAISKDLATY+S N H
Sbjct  266  PRVYIGCMKSGPVLSQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYVSINGH  325

Query  462  VLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR  283
            +LH+YANEDVSLG+WFIGLDV H+D+R LCCGTPPDCEWKAQAGN C ASFDW+CSGIC+
Sbjct  326  ILHRYANEDVSLGSWFIGLDVEHIDERSLCCGTPPDCEWKAQAGNTCAASFDWSCSGICK  385

Query  282  TVDRIKEVHRRCGEGEKVLWNAAF  211
            +V+R++EVH+RCGEG   +W+ +F
Sbjct  386  SVERMEEVHQRCGEGNGAIWHTSF  409



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470