BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040H20

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    405   1e-137   Elaeis guineensis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    405   2e-137   Oryza brachyantha
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     404   3e-137   Sesamum indicum [beniseed]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                402   7e-137   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     402   2e-136   Solanum lycopersicum
gb|KJB83533.1|  hypothetical protein B456_013G252200                    400   2e-136   Gossypium raimondii
gb|AAL47679.1|  aminotransferase 1                                      401   4e-136   Cucumis melo [Oriental melon]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    401   4e-136   
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             401   5e-136   Prunus persica
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    401   5e-136   Cucumis sativus [cucumbers]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    397   6e-136   Gossypium raimondii
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     401   6e-136   Prunus mume [ume]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     400   1e-135   Pyrus x bretschneideri [bai li]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   1e-135   Solanum tuberosum [potatoes]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     400   1e-135   Fragaria vesca subsp. vesca
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     400   2e-135   Nicotiana tomentosiformis
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     400   2e-135   Gossypium hirsutum [American cotton]
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     400   2e-135   Nicotiana sylvestris
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       399   3e-135   Gossypium arboreum [tree cotton]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     399   5e-135   Malus domestica [apple tree]
gb|AAQ56192.1|  aminotransferase 1                                      398   6e-135   Cucumis melo [Oriental melon]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    398   6e-135   Gossypium raimondii
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     398   8e-135   
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                398   9e-135   Cucumis melo [Oriental melon]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         398   9e-135   Ricinus communis
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             392   1e-134   
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      397   2e-134   
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             393   3e-134   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     396   4e-134   Tarenaya hassleriana [spider flower]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     396   4e-134   Elaeis guineensis
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          396   4e-134   Amborella trichopoda
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     396   5e-134   Nelumbo nucifera [Indian lotus]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     396   5e-134   Eucalyptus grandis [rose gum]
ref|NP_001062170.1|  Os08g0502700                                       396   6e-134   
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    396   6e-134   Sesamum indicum [beniseed]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             395   7e-134   Fritillaria agrestis
gb|KJB54391.1|  hypothetical protein B456_009G074800                    389   7e-134   Gossypium raimondii
dbj|BAJ90006.1|  predicted protein                                      395   8e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     395   9e-134   Phoenix dactylifera
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         395   1e-133   Jatropha curcas
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    395   2e-133   Citrus sinensis [apfelsine]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  395   2e-133   Citrus sinensis [apfelsine]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     394   2e-133   Triticum urartu
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     393   2e-133   Peperomia schizandra
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   2e-133   Cucumis melo [Oriental melon]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       394   2e-133   Gossypium arboreum [tree cotton]
gb|ABQ81924.1|  aminotransferase 2                                      394   3e-133   Cucumis sativus [cucumbers]
gb|AFK37194.1|  unknown                                                 388   3e-133   Medicago truncatula
gb|ABQ81922.1|  aminotransferase 2                                      394   3e-133   Cucumis sativus [cucumbers]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            394   3e-133   Cucumis melo [Oriental melon]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    389   3e-133   
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           394   3e-133   Cucumis melo [Oriental melon]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     392   5e-133   Peperomia bracteata
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     392   6e-133   Peperomia cerrateae
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     392   7e-133   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     391   8e-133   Peperomia cerrateae
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             393   9e-133   Citrus clementina [clementine]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     393   9e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             392   1e-132   Populus trichocarpa [western balsam poplar]
gb|ACN39798.1|  unknown                                                 392   1e-132   Picea sitchensis
gb|ABK24112.1|  unknown                                                 392   1e-132   Picea sitchensis
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     391   2e-132   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     390   2e-132   Peperomia cavispicata
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     390   2e-132   Peperomia bracteata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     390   2e-132   Peperomia bracteata
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     390   3e-132   Peperomia radiatinervosa
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     390   3e-132   Peperomia bracteata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     391   3e-132   Populus euphratica
gb|ABQ81925.1|  aminotransferase 2                                      391   3e-132   Cucumis melo [Oriental melon]
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     389   3e-132   Peperomia radiatinervosa
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     389   3e-132   Peperomia ayacuchoana
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     390   4e-132   Peperomia parvisagittata
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     389   5e-132   Peperomia radiatinervosa
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    391   5e-132   Cucumis sativus [cucumbers]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    390   6e-132   Glycine max [soybeans]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      390   7e-132   Genlisea aurea
gb|AAQ56193.1|  aminotransferase 2                                      390   7e-132   Cucumis melo [Oriental melon]
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     389   8e-132   Peperomia bracteata
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     389   8e-132   Peperomia parvisagittata
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     389   1e-131   Peperomia andina
emb|CBI24214.3|  unnamed protein product                                389   1e-131   Vitis vinifera
emb|CDP08481.1|  unnamed protein product                                390   1e-131   Coffea canephora [robusta coffee]
ref|NP_001237048.1|  enzymatic resistance protein                       390   1e-131   
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     389   2e-131   Beta vulgaris subsp. vulgaris [field beet]
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     388   2e-131   Peperomia pseudoverruculosa
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    389   2e-131   Glycine max [soybeans]
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     387   3e-131   Peperomia questionis
gb|ACN36238.1|  unknown                                                 386   3e-131   Zea mays [maize]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                389   3e-131   Medicago truncatula
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     389   3e-131   Vitis vinifera
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    389   4e-131   
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     387   4e-131   Peperomia verruculosa
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    388   5e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     387   5e-131   Peperomia verruculosa
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     390   6e-131   Brachypodium distachyon [annual false brome]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    388   6e-131   Setaria italica
emb|CAN84001.1|  hypothetical protein VITISV_007680                     388   8e-131   Vitis vinifera
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     386   8e-131   Peperomia bracteata
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     388   9e-131   Glycine soja [wild soybean]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           388   9e-131   Glycine max [soybeans]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      387   1e-130   Spirodela polyrhiza
gb|AFK40703.1|  unknown                                                 387   1e-130   Medicago truncatula
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    387   1e-130   Glycine max [soybeans]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    388   2e-130   
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     385   2e-130   Peperomia parvifolia
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     385   2e-130   Peperomia peruviana
ref|NP_001148339.1|  LOC100281949                                       387   2e-130   Zea mays [maize]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             387   2e-130   Phaseolus vulgaris [French bean]
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     385   3e-130   Peperomia rupiseda
ref|XP_002313371.1|  aminotransferase 2 family protein                  386   3e-130   
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    386   5e-130   Phaseolus vulgaris [French bean]
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          386   5e-130   Sorghum bicolor [broomcorn]
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    385   7e-130   Populus euphratica
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     384   7e-130   Peperomia chutanka
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     384   8e-130   Peperomia sp. JN-2011
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             385   1e-129   
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     384   2e-129   Brassica rapa
emb|CDX81443.1|  BnaC09g08540D                                          384   2e-129   
emb|CDY37208.1|  BnaA09g08290D                                          384   2e-129   Brassica napus [oilseed rape]
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     383   2e-129   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     382   2e-129   Peperomia aff. gracillima JN-2011
dbj|BAJ33858.1|  unnamed protein product                                385   2e-129   Eutrema halophilum
gb|ABK96624.1|  unknown                                                 384   4e-129   Populus trichocarpa x Populus deltoides
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     382   6e-129   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    382   1e-128   Brassica rapa
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     380   3e-128   Peperomia pugnicaudex
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     379   4e-128   Peperomia peruviana
emb|CDX89604.1|  BnaC03g45180D                                          380   5e-128   
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    379   1e-127   Camelina sativa [gold-of-pleasure]
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     377   2e-127   Peperomia polycephala
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    379   2e-127   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     377   2e-127   Peperomia peruviana
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  378   6e-127   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      376   2e-126   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             376   3e-126   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             373   5e-125   Capsella rubella
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     366   6e-123   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     365   1e-122   Peperomia putlaensis
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     363   3e-122   Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    368   4e-122   Camelina sativa [gold-of-pleasure]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     363   5e-122   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     363   6e-122   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     362   9e-122   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     362   1e-121   Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia peruviana
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia cyclaminoides
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     360   4e-121   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     361   6e-121   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     359   2e-120   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     358   5e-120   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     356   4e-119   Peperomia sp. JN-2011
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     355   1e-118   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     355   1e-118   Peperomia exclamationis
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    353   4e-117   Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                349   1e-115   Medicago truncatula
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     343   1e-114   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     343   4e-114   Peperomia aff. pinoi JN-2011
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             343   2e-113   Selaginella moellendorffii
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     340   5e-113   Peperomia jalcaensis
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     340   6e-113   Peperomia elatior
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     340   6e-113   Peperomia parvisagittata
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             342   1e-112   
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     338   3e-112   Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     337   1e-111   Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     336   2e-111   Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     335   4e-111   Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     334   4e-111   Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     334   1e-110   Peperomia cerrateae
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     333   4e-110   Peperomia wernerrauhii
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     332   4e-110   Peperomia klopfensteinii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             325   5e-106   Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  323   1e-105   
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             323   1e-105   Selaginella moellendorffii
ref|XP_001783551.1|  predicted protein                                  322   8e-105   
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     318   1e-104   Peperomia sp. JN-2011
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                318   7e-104   Morus notabilis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     315   2e-103   Peperomia aff. ovatopeltata JN-2011
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             312   1e-101   
gb|ABR16109.1|  unknown                                                 311   2e-101   Picea sitchensis
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              306   3e-101   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                312   6e-101   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  310   1e-100   Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              304   1e-98    
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                302   5e-98    
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     297   1e-96    
gb|AEA48973.1|  glyoxylate aminotransferase                             289   2e-95    Rosa roxburghii [chestnut rose]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                288   2e-92    
ref|XP_001763095.1|  predicted protein                                  288   1e-91    
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   6e-88    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   3e-83    Oryza sativa Indica Group [Indian rice]
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     256   1e-82    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     253   1e-81    Phaseolus vulgaris [French bean]
gb|AGN53916.1|  glyoxylate aminotransferase                             244   6e-78    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             243   2e-77    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             242   2e-77    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             241   5e-77    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             241   8e-77    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             240   1e-76    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             240   1e-76    Silene vulgaris [maiden's-tears]
gb|AGN53897.1|  glyoxylate aminotransferase                             240   2e-76    Silene latifolia
gb|AGN53921.1|  glyoxylate aminotransferase                             239   3e-76    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             239   4e-76    Silene vulgaris [maiden's-tears]
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     243   2e-74    Methyloceanibacter caenitepidi
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                243   2e-74    
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    241   2e-73    Methylobacterium aquaticum
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                240   5e-73    Methylocapsa aurea
gb|AEW08188.1|  hypothetical protein 2_2585_01                          229   2e-72    Pinus lambertiana
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    237   6e-72    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                236   1e-71    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                236   2e-71    Methylosinus
gb|AFG57258.1|  hypothetical protein 2_2585_01                          226   2e-71    Pinus taeda
gb|AEW08187.1|  hypothetical protein 2_2585_01                          226   4e-71    Pinus radiata
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                234   9e-71    Methylocaldum szegediense
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                234   1e-70    Methylocella silvestris
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 233   1e-70    Auxenochlorella protothecoides
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                234   2e-70    Methylocapsa acidiphila
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                233   3e-70    Methylosinus
ref|XP_005709273.1|  serine--glyoxylate transaminase                    233   3e-70    Galdieria sulphuraria
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                232   6e-70    Hyphomicrobium nitrativorans
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      232   6e-70    Hyphomicrobium nitrativorans NL23
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                232   9e-70    Paraburkholderia sacchari
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              230   1e-68    Volvox carteri f. nagariensis
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                229   1e-68    Methylobacterium nodulans
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                229   2e-68    Paraburkholderia phymatum
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     226   4e-68    Methylorubrum extorquens DM4
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                227   6e-68    Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                227   6e-68    Methylorubrum extorquens
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                227   8e-68    Methylobacterium sp. 4-46
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                227   9e-68    Methylobacterium sp. WSM2598
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                227   9e-68    Caballeronia glathei
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                227   9e-68    Paraburkholderia terrae
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                226   9e-68    Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylorubrum populi
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylobacteriaceae
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                226   1e-67    Burkholderia sp. UYPR1.413
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                226   1e-67    Methyloversatilis universalis
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                225   2e-67    Methylocystis parvus
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                226   2e-67    Paraburkholderia hospita
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    216   2e-67    Prunus avium [gean]
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                226   2e-67    Paraburkholderia caribensis
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                225   3e-67    Burkholderiaceae
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                225   3e-67    Paraburkholderia mimosarum
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                224   5e-67    Ferrovum
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                223   1e-66    Methylocystis sp. ATCC 49242
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    223   1e-66    Methylibium
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                223   1e-66    Dongia sp. URHE0060
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    223   2e-66    Methylobacterium
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      223   2e-66    Methylibium petroleiphilum PM1
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    214   2e-66    Hedera helix [English ivy]
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                221   4e-66    Methyloversatilis universalis
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                222   5e-66    Hyphomicrobium zavarzinii
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                221   5e-66    Granulibacter bethesdensis
gb|KIZ03753.1|  serine--glyoxylate transaminase                         222   6e-66    Monoraphidium neglectum
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                221   6e-66    Granulibacter bethesdensis
ref|WP_010687105.1|  Aminotransferase class V                           221   6e-66    Methylobacterium mesophilicum
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                221   7e-66    Methylobacterium
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    212   8e-66    Dactylis glomerata [cocksfoot]
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                221   1e-65    Paraburkholderia oxyphila
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     221   1e-65    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        221   1e-65    Granulibacter bethesdensis CGDNIH4
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    211   1e-65    Betula pendula [white birch]
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                220   2e-65    Methyloversatilis discipulorum
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                220   2e-65    Granulibacter bethesdensis
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                219   2e-65    Methylohalobius crimeensis
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                220   2e-65    Methylobacterium sp. 88A
gb|AID30749.1|  serine--glyoxylate aminotransferase                     215   3e-65    Mesorhizobium huakuii 7653R
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                219   3e-65    Methyloversatilis discipulorum
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    219   4e-65    Hyphomicrobium methylovorum
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    210   4e-65    Crocus vernus
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                219   4e-65    Ensifer sojae
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        220   6e-65    Granulibacter bethesdensis
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                219   6e-65    Rhizobium leucaenae
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    209   7e-65    Lonicera caprifolium
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                214   7e-65    
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                219   8e-65    Hyphomicrobium denitrificans
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                214   8e-65    
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                214   8e-65    
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                214   9e-65    
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                214   1e-64    
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                218   2e-64    
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                218   2e-64    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    208   2e-64    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                217   3e-64    
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                217   3e-64    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    208   3e-64    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                217   4e-64    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_020188076.1|  hypothetical protein                               216   5e-64    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                216   6e-64    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                216   6e-64    
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    216   8e-64    
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                216   8e-64    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                216   9e-64    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                216   9e-64    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                216   1e-63    
emb|CAM59868.2|  alanine:glyoxylate aminotransferase                    206   1e-63    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 216   2e-63    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                215   2e-63    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                214   2e-63    
gb|AIQ91949.1|  Aminotransferase class V                                216   3e-63    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    214   3e-63    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    214   4e-63    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                214   5e-63    
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                214   5e-63    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                213   7e-63    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   8e-63    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                213   9e-63    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                213   9e-63    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                213   1e-62    
emb|CAM59871.2|  alanine:glyoxylate aminotransferase                    204   1e-62    
emb|CAM59869.2|  alanine:glyoxylate aminotransferase                    204   1e-62    
ref|WP_020592928.1|  hypothetical protein                               212   2e-62    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                212   3e-62    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                211   3e-62    
emb|CAM59870.2|  alanine:glyoxylate aminotransferase                    202   3e-62    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                211   8e-62    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                210   2e-61    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                210   2e-61    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                210   2e-61    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                210   2e-61    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                209   4e-61    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                208   4e-61    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                209   4e-61    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    208   6e-61    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                208   7e-61    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                208   7e-61    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                208   8e-61    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                208   9e-61    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                207   1e-60    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            207   1e-60    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 208   1e-60    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 208   2e-60    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                206   2e-60    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   2e-60    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                206   5e-60    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                206   5e-60    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                206   5e-60    
ref|WP_020058450.1|  hypothetical protein                               206   5e-60    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                206   7e-60    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                205   8e-60    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    205   1e-59    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 205   1e-59    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                204   2e-59    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         204   2e-59    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                204   2e-59    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    205   3e-59    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                204   3e-59    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                204   3e-59    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                204   4e-59    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                203   4e-59    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    203   7e-59    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                203   7e-59    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                203   7e-59    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                202   8e-59    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                202   9e-59    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                202   9e-59    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      202   1e-58    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   1e-58    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   1e-58    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              203   2e-58    
gb|EEE42985.1|  aminotransferase, class V superfamily                   201   3e-58    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                201   3e-58    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             203   4e-58    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                201   4e-58    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     197   6e-58    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                201   6e-58    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     197   6e-58    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                201   6e-58    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                200   7e-58    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                200   8e-58    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                200   9e-58    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                199   2e-57    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                199   2e-57    
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     196   2e-57    
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     195   2e-57    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                199   2e-57    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     199   3e-57    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                199   3e-57    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                199   3e-57    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                199   3e-57    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                199   3e-57    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    198   5e-57    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                198   6e-57    
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     195   6e-57    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   7e-57    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                197   8e-57    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                197   8e-57    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                197   9e-57    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   1e-56    
emb|CAM84337.1|  alanine:glyoxylate aminotransferase                    188   1e-56    
ref|WP_023263325.1|  serine--glyoxylate aminotransferase                197   1e-56    
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     197   2e-56    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                196   3e-56    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                196   4e-56    
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     192   5e-56    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                195   6e-56    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                195   6e-56    
ref|WP_020950386.1|  serine-glyoxylate transaminase                     195   7e-56    
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                195   8e-56    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   405 bits (1042),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  363  LSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   405 bits (1040),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  184  VDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWADYLKFYK  243

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKNCTQKEE
Sbjct  244  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNCTQKEE  303

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  304  WFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  363

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  364  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   404 bits (1038),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 216/219 (99%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   402 bits (1032),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA SVRVFFDW DYLKFYK
Sbjct  141  LDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTATSVRVFFDWNDYLKFYK  200

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL  ATRLAV AWGLKNCTQKEE
Sbjct  201  LGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKNCTQKEE  260

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  261  WFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  320

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  321  LAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  363  LAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  124  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYK  183

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  184  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEE  243

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  244  WFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  303

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  304  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   401 bits (1031),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   401 bits (1031),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  363  LAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   401 bits (1031),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  363  LAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   401 bits (1030),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   397 bits (1021),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  88   LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  147

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEE
Sbjct  148  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEE  207

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  208  WYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  267

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  268  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   401 bits (1030),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  363  LAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  363  LAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  363  LAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   399 bits (1024),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   398 bits (1022),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 201/219 (92%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  363  LAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   398 bits (1022),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   398 bits (1022),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL NCTQKEE
Sbjct  243  MGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   392 bits (1007),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK
Sbjct  26   LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYK  85

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  86   LGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  145

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  146  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  205

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  206  LAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   393 bits (1010),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK
Sbjct  93   LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYK  152

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  153  LGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  212

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  213  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  272

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  273  LAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   396 bits (1018),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  363  LAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   396 bits (1018),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW DYLKFYK
Sbjct  184  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWNDYLKFYK  243

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK+E
Sbjct  244  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKDE  303

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  304  WFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  363

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  364  LSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   396 bits (1018),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYL+FYK
Sbjct  183  LDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLRFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  363  LSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   396 bits (1017),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   396 bits (1017),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  363  LAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   396 bits (1017),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKFYK
Sbjct  184  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  243

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEE
Sbjct  244  MGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEE  303

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G 
Sbjct  304  WFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGA  363

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  364  LSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   396 bits (1017),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   395 bits (1016),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  IGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  363  LSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   389 bits (998),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTF  60

Query  564  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  385
            WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SD
Sbjct  61   WPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSD  120

Query  384  TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  205
            TVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV
Sbjct  121  TVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180

Query  204  EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            EM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  181  EMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   395 bits (1016),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT+KEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  NFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  LGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   395 bits (1015),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  363  LSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  363  LAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   395 bits (1014),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY 
Sbjct  183  IDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   395 bits (1014),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY 
Sbjct  183  IDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT KEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  NFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  LGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   393 bits (1009),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 210/215 (98%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGXDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   394 bits (1013),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   388 bits (997),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYK
Sbjct  20   LDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYK  79

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EE
Sbjct  80   MGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEE  139

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG 
Sbjct  140  WFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGA  199

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  200  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   389 bits (998),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY 
Sbjct  44   LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYD  103

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  104  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  163

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  164  WFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  223

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  224  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   392 bits (1007),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   392 bits (1006),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   392 bits (1006),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   391 bits (1005),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   393 bits (1009),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY 
Sbjct  183  IDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   393 bits (1009),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  363  LSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  363  LSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  363  LSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   391 bits (1004),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  128  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  187

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  188  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  247

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  248  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  307

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  308  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   390 bits (1003),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   390 bits (1003),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   390 bits (1001),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  139  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  198

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  199  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  258

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  259  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  318

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  319  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   390 bits (1002),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   391 bits (1005),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   391 bits (1005),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   389 bits (1000),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  136  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  195

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  196  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  255

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  256  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  315

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  316  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   389 bits (1000),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  137  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  196

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  197  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  256

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  257  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  316

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  317  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   390 bits (1001),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   389 bits (1000),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   391 bits (1004),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   390 bits (1003),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   390 bits (1003),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  363  LAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   390 bits (1003),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKDYLKFY 
Sbjct  183  LDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   389 bits (999),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   389 bits (999),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQEEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   389 bits (998),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 209/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   389 bits (999),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYLKFYK
Sbjct  156  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYLKFYK  215

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  216  LGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREE  275

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGC
Sbjct  276  WFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGC  335

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  336  LAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   390 bits (1001),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK YK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   390 bits (1001),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   389 bits (1000),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NELQLLG 
Sbjct  303  WFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINELQLLGA  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   388 bits (996),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 207/215 (96%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   386 bits (992),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY 
Sbjct  110  LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYD  169

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  170  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  229

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  230  WFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  289

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  290  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   389 bits (999),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG 
Sbjct  303  WFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGA  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   389 bits (998),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   389 bits (998),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   387 bits (994),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   388 bits (997),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+LQLLGC
Sbjct  303  WFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDLQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  363  LSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   387 bits (993),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  137  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  196

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  197  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  256

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  257  CFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  316

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  317  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   390 bits (1003),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKDYLKFYK
Sbjct  243  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKDYLKFYK  302

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKNCTQKEE
Sbjct  303  MGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKNCTQKEE  362

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  363  NFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  422

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  423  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   388 bits (997),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK YK
Sbjct  184  LDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSYK  243

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKEE
Sbjct  244  IGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKEE  303

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  304  WFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  363

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  364  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   388 bits (996),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   386 bits (991),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  137  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  196

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+A GLKNCTQKEE
Sbjct  197  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKNCTQKEE  256

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  257  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  316

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  317  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   388 bits (996),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD+LKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDHLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   388 bits (996),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  363  LTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKNCTQKEE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  WFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  363  LSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNELQLLG 
Sbjct  303  WFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGA  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK YK
Sbjct  219  LDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSYK  278

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKEE
Sbjct  279  IGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKEE  338

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  339  WFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  398

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  399  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D LKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDNLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 0/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY 
Sbjct  185  LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYD  244

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  245  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  304

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  305  WFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  364

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  365  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLGC
Sbjct  303  WHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  363  LAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY+
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQ  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEE
Sbjct  243  LGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLGC
Sbjct  303  WHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  363  LAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKDYL+FY+
Sbjct  184  LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKDYLRFYE  243

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKNC QKEE
Sbjct  244  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNCCQKEE  303

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  304  CFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  363

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  364  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   385 bits (990),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   384 bits (985),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   384 bits (985),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   385 bits (989),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   382 bits (982),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  220  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  279

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  280  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  339

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  340  WISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  399

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  400  LAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   384 bits (985),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY 
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   382 bits (980),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   380 bits (975),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQ  130
            L+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   379 bits (974),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  121
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   380 bits (977),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   379 bits (974),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQ  130
            L+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            L+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   378 bits (970),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY 
Sbjct  176  LDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYN  235

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNCTQKEE
Sbjct  236  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNCTQKEE  295

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  296  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  355

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQN  127
            LAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  356  LAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   376 bits (966),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   373 bits (958),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  363  LAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   366 bits (939),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAAA  145
            L+GVEMVLKD+GYPVK GSGVAAA
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVA  151
            L+GVEMVLKD+GYPVK GSGVA
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  136  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  195

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  196  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  255

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  256  CFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  315

Query  216  LAGVEMVLKDIGYPVKLGSGVAA  148
            L+GVEMVLKD+GYPVK GSGVAA
Sbjct  316  LSGVEMVLKDVGYPVKFGSGVAA  338



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGC
Sbjct  303  WISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
            LAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  363  LAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  127  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  186

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  187  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKEE  246

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NELQLLGC
Sbjct  247  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNELQLLGC  306

Query  216  LAGVEMVLKDIGYPVKLGSGVAAA  145
            L+GVEMVLKD+GYPVK GSGVAAA
Sbjct  307  LSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   363 bits (933),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVAA  148
            L+GVEMVLKD+GYPVK GSGVAA
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   362 bits (930),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  136  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  195

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  196  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  255

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  256  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  315

Query  216  LAGVEMVLKDIGYPVKLGSGVAA  148
            L+GVEMVLKD+GYPVK GSGVAA
Sbjct  316  LSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  128  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  187

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  188  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  247

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  248  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  307

Query  216  LAGVEMVLKDIGYPVKLGSG  157
            L+GVEMVLKD+GYPVK GSG
Sbjct  308  LSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  127  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  186

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  187  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKEE  246

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  247  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  306

Query  216  LAGVEMVLKDIGYPVKLGSGVA  151
            L+GVEMVLKD+GYPVK GSGVA
Sbjct  307  LSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  128  LDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  187

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  188  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  247

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  248  CFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  307

Query  216  LAGVEMVLKDIGYPVKLGSGVAA  148
            L+GVEMVLKD+GYPVK GSGVAA
Sbjct  308  LSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  131  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  190

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  191  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  250

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  251  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  310

Query  216  LAGVEMVLKDIGYPVKLGSGVA  151
            L+GVEMVLKD+GYPVK GSGVA
Sbjct  311  LSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLGSGVA  151
            L+GVEMVLKD+GYPVK GSGVA
Sbjct  328  LSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVKLG  163
            L+GVEMVLKD+GYPVK G
Sbjct  328  LSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   358 bits (919),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  137  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  196

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  197  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  256

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  257  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  316

Query  216  LAGVEMVLKDIGYPVKLG  163
            L+GVEMVLKD+GYPVK G
Sbjct  317  LSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   356 bits (913),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPVK  169
            L+GVEMVLKD+GYPVK
Sbjct  328  LSGVEMVLKDVGYPVK  343



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPV  172
            L+GVEMVLKD+GYPV
Sbjct  328  LSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVLKDIGYPV  172
            L+GVEMVLKD+GYPV
Sbjct  328  LSGVEMVLKDVGYPV  342



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  YLK Y 
Sbjct  183  LDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNGYLKCYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKNC Q +E
Sbjct  243  LGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNCCQNKE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  SYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  363  LAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  YLK Y 
Sbjct  183  LDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNGYLKCYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC QKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNCCQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNELQLLGC
Sbjct  303  WYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGC  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  363  LAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  124  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  183

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  184  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  243

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  244  WFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  303

Query  216  LAGVEMVLK  190
            L+GVEMVLK
Sbjct  304  LSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   343 bits (880),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVL  193
            L+GVEMVL
Sbjct  328  LSGVEMVL  335



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            I+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKFYK
Sbjct  183  IEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ E
Sbjct  243  LGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRPE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG 
Sbjct  303  WNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLGA  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  363  LSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   340 bits (871),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  136  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  195

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  196  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  255

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  256  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  315

Query  216  LAGVEMVL  193
            L+GVEMVL
Sbjct  316  LSGVEMVL  323



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   340 bits (872),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVL  193
            L+GVEMVL
Sbjct  328  LSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   340 bits (872),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVL  193
            L+GVEMVL
Sbjct  328  LSGVEMVL  335



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            I+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKFYK
Sbjct  183  IEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ E
Sbjct  243  VGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRPE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG 
Sbjct  303  WNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLGA  362

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  363  LSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVEMVL  193
            L+GVEMVL
Sbjct  328  LSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGV  205
            L+GV
Sbjct  328  LSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVE  202
            L+GVE
Sbjct  328  LSGVE  332



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGVE  202
            L+GVE
Sbjct  328  LSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   334 bits (857),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  127  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  186

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  187  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  246

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  247  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  306

Query  216  LAGVE  202
            L+GVE
Sbjct  307  LSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGV  205
            L+GV
Sbjct  328  LSGV  331



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   333 bits (853),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAGV  205
            L+GV
Sbjct  328  LSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  268  WFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGC  327

Query  216  LAG  208
            L+G
Sbjct  328  LSG  330



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  750  FRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMG  571
            FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK Y++G
Sbjct  185  FRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKSYELG  244

Query  570  TYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  391
            +YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  E +
Sbjct  245  SYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCVKDPELY  304

Query  390  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  211
            SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+  LA
Sbjct  305  SDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALA  364

Query  210  GVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            GVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  365  GVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW DYLKFY+
Sbjct  183  IDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDYLKFYE  242

Query  576  MGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  400
             GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL  CTQ  
Sbjct  243  AGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTLCTQDP  302

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQ+LG
Sbjct  303  KWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNELQMLG  362

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
             LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  363  ALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  750  FRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMG  571
            FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK Y++G
Sbjct  185  FRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKSYELG  244

Query  570  TYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  391
            +YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  E +
Sbjct  245  SYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCIKDPELY  304

Query  390  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  211
            SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+  LA
Sbjct  305  SDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALA  364

Query  210  GVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            GVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  365  GVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   322 bits (824),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW DYLKFY+
Sbjct  183  IDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDYLKFYE  242

Query  576  MGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  400
             GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL  CT+  
Sbjct  243  AGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTLCTKDP  302

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  303  KWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNELQLLG  362

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
             LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  363  ALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  125  LDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYK  184

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  185  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEE  244

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  226
             FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQL
Sbjct  245  CFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQL  301



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
            W+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  303  WYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK
Sbjct  148  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYK  207

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL V+AWGLKNCT KEE
Sbjct  208  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKNCTPKEE  267

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
             FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  268  CFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK
Sbjct  183  LDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  223
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+  +
Sbjct  303  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTFI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK
Sbjct  183  IDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EE
Sbjct  243  LGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  235
            W+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  303  WYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY 
Sbjct  44   LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYD  103

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  104  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  163

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
            WFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  164  WFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  218



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYK
Sbjct  183  LDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYK  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EE
Sbjct  243  MGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  223
            WFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ L+
Sbjct  303  WFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTLI  360



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY 
Sbjct  183  IDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYN  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  226
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+  
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEVMF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY 
Sbjct  185  LDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYD  244

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  245  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  304

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
            WFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  305  WFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 180/220 (82%), Gaps = 15/220 (7%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E                YLK Y 
Sbjct  145  LDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE--------------NGYLKCYN  190

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC Q+EE
Sbjct  191  LGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCCQQEE  250

Query  396  -WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
             W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNELQLLG
Sbjct  251  EWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNELQLLG  310

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            CLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  311  CLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  648  LEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARH  469
              A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RH
Sbjct  108  FSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRH  167

Query  468  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  289
            TRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGL
Sbjct  168  TRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGL  227

Query  288  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIP  109
            NKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IP
Sbjct  228  NKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIP  287

Query  108  SRI  100
            SRI
Sbjct  288  SRI  290



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   289 bits (740),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  600  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  421
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  420  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  241
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  240  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 174/219 (79%), Gaps = 19/219 (9%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  YLK Y 
Sbjct  144  LDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNGYLKCYN  203

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       +L V            E
Sbjct  204  LGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV------------E  244

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNELQLLGC
Sbjct  245  WYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGC  304

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  305  LAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +YLK YK
Sbjct  183  MDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYK  242

Query  576  MGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  400
             GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL  C +K 
Sbjct  243  AGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKP  302

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NELQLLG
Sbjct  303  QWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLG  362

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
             LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  363  ALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (689),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  555  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  376
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  375  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  196
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  195  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  564  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  385
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSD  120

Query  384  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  298
            TVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  564  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  385
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSD  120

Query  384  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  298
            TVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDS+EIVKRAWKRYN
Sbjct  121  VVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDS+EIVK+AWKRYN
Sbjct  121  VVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDSS+IVK+AWKRYN
Sbjct  121  VVIPPYIDSSDIVKKAWKRYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YI+SSEIVK AWKRYN
Sbjct  121  VVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (610),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  732  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  553
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  552  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  373
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  372  VVVPSYIDSSEIVKRAWKRYN  310
            VV+P YI+S+EIVK AWKRYN
Sbjct  121  VVIPPYINSAEIVKMAWKRYN  141



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 161/219 (74%), Gaps = 1/219 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFR DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA   R +F+  D+ K   
Sbjct  152  IDFRFDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLADHFK-AN  210

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  C ++ +
Sbjct  211  AGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLCAKEPK  270

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL LLG 
Sbjct  271  WQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNELMLLGA  330

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  100
            ++G EM ++D+G  V+ GSGVAAA  Y +N       R+
Sbjct  331  ISGAEMSMRDVGIQVEPGSGVAAAQEYFRNAHGAADQRL  369



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D +K   
Sbjct  186  IDFRMDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFEDMIKSNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R AV AWGLKNC  + +
Sbjct  246  TG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNCATEPK  304

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            WFSDTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL +LG 
Sbjct  305  WFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNELMVLGA  364

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  365  LAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFR +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D  K   
Sbjct  183  IDFRAEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGDQAKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  C ++E+
Sbjct  243  TG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLCAKEEK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL LLG 
Sbjct  302  WYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  362  LAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 158/209 (76%), Gaps = 1/209 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFR DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D +K   
Sbjct  178  LDFRTDEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFNDMIKANA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ +LYGLR  L +LFEE L++V  RH  L    R AV+AWGLK C  + +
Sbjct  238  TG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPCATEPK  296

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG 
Sbjct  297  WYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGA  356

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQ  130
            + G EM + D+G  VKLGSGV AA A+ +
Sbjct  357  IGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL+FYKMGTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLRFYKMGTY  60

Query  564  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  388
            WPYTPSIQLLYGLRA LDL+  EEGLDNVIARH RLGTATRLAV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWYS  120

Query  387  DTVTAVVVPSYIDSS  343
            DTVTAV+VP YIDS+
Sbjct  121  DTVTAVIVPPYIDSA  135



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DF+ DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D++K   
Sbjct  183  LDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDHVKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASA  139
            +AG EM + D+G PV  GSGVAAA A
Sbjct  362  IAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K   
Sbjct  183  LDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASA  139
            +AG EM + D+G PV  GSGVAAA A
Sbjct  362  IAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K   
Sbjct  183  LDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASA  139
            +AG EM + D+G PV  GSGVAAA A
Sbjct  362  IAGAEMAMLDVGIPVTAGSGVAAAQA  387



>gb|AFG57258.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57259.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57260.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57261.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57262.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57263.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57264.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57265.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57266.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57267.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57268.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57269.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57270.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57271.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57272.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57273.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57274.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57275.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
Length=135

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  564  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  388
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVITRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  387  DTVTAVVVPSYIDSS  343
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>gb|AEW08187.1| hypothetical protein 2_2585_01, partial [Pinus radiata]
Length=135

 Score =   226 bits (576),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -3

Query  744  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  565
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  564  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  388
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIIRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  387  DTVTAVVVPSYIDSS  343
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 155/218 (71%), Gaps = 1/218 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAKS R F D +D++    
Sbjct  178  IDFRMDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQDHITNNA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R AV+AWGL+ C +  +
Sbjct  238  SG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELCARDPK  296

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL L   
Sbjct  297  WYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNELMLCSA  356

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  103
            +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  357  IAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFR DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S R +FD+ D +K   
Sbjct  178  LDFRQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDMIKANA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  C ++ +
Sbjct  238  TG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCAKEPK  296

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL +LG 
Sbjct  297  WYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELMVLGA  356

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  115
            LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  357  LAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            + F+ D+W VDVA+TGSQKALSLPTG+GIV AS KAL+A  +AK  RV+F + D LK  K
Sbjct  156  LPFKFDDWRVDVAVTGSQKALSLPTGLGIVAASDKALDARSSAKLKRVYFSFDDMLKTNK  215

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G   PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR AV AWGLK   ++  
Sbjct  216  NGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKLLCREPR  274

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++EL L G 
Sbjct  275  WQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDELMLAGA  334

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  103
            L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  335  LGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DFR DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D +K   
Sbjct  178  LDFRADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFADMIKANA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  L    R AV+AWGL  C ++ +
Sbjct  238  TG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPCAKEAK  296

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG 
Sbjct  297  WDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGA  356

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  357  IAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            +DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K   
Sbjct  183  LDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKESK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASA  139
            +AG EM + D+G PV  GSGVAAA A
Sbjct  362  IAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            I F+MDEW VD+A+TGSQK L LP G+G+VCAS KALE SK     RVFF ++D +    
Sbjct  180  IPFKMDEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFEDMIVNND  239

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
            +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL    R AV+AWGLK C +  +
Sbjct  240  VG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTCCKNPK  298

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
             +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL +L  
Sbjct  299  EYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNELMVLAT  358

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  359  LAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKF  583
            +D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K 
Sbjct  177  LDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKT  236

Query  582  YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  403
               G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++
Sbjct  237  NDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKE  295

Query  402  EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  223
             +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + 
Sbjct  296  PKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIG  355

Query  222  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  106
            G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  356  GVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 157/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKF  583
            +D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K 
Sbjct  180  LDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKT  239

Query  582  YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  403
               G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++
Sbjct  240  NDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKE  298

Query  402  EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  223
             +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + 
Sbjct  299  PKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIG  358

Query  222  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  106
            G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  359  GVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D +K   
Sbjct  186  IDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGDMIKANA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLELCAKGP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L  
Sbjct  305  KWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  115
             +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  365  AIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  471  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  292
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  291  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  112
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  111  PSRI  100
            PSRI
Sbjct  121  PSRI  124



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            ++FRMD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D L+   
Sbjct  228  LEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRTNP  287

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G   PYTPS+ +LYG+R  + +L EEG++NV ARH RLG   R AV+ WGLK   +   
Sbjct  288  SGNV-PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKLLCKNPR  346

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SD++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NEL L+  
Sbjct  347  WRSDSLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNELMLVSA  406

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  103
            LAG EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  407  LAGAEMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K   
Sbjct  183  IDFRASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG 
Sbjct  302  WYSDTVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            LAG EM + D G  ++ GSGVAAA  + + T
Sbjct  362  LAGAEMSMLDAGIKIEPGSGVAAAQQHFRET  392



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLELCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
             W SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  RWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D 
Sbjct  160  LPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQ  219

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  220  KKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  278

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  279  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  338

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  339  SLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D 
Sbjct  183  LPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQ  242

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  243  KKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  301

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  302  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  361

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  362  SLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D 
Sbjct  183  LPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQ  242

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  243  KKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  301

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  302  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  361

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  362  SLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K   
Sbjct  183  IDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG 
Sbjct  302  WYSDTVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            LAG EM + D G  ++ GSGV AA  + + T
Sbjct  362  LAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K   
Sbjct  183  IDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +
Sbjct  243  TG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG 
Sbjct  302  WYSDTVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
            LAG EM + D G  ++ GSGV AA  + + T
Sbjct  362  LAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 154/208 (74%), Gaps = 2/208 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D +K   
Sbjct  186  IDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLADMIKANA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH  L    R A+ + W L  C +  
Sbjct  246  TG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLGVCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+G
Sbjct  305  KWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMG  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAY  136
             +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  365  AIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R A+ + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  KWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D+
Sbjct  183  LPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDH  242

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  243  KKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  301

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  302  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  361

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  362  SLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D+
Sbjct  183  LPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDH  242

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  243  KKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  301

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  302  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  361

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  362  SLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 154/216 (71%), Gaps = 6/216 (3%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDY  592
            + F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     +  +  RV+FDW+D 
Sbjct  183  LPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVYFDWEDQ  242

Query  591  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  412
             K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C
Sbjct  243  KKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTC  301

Query  411  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  232
             +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL
Sbjct  302  AKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNEL  361

Query  231  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  124
             LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  362  SLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L +  R AV + WGL  C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVRAAVTEGWGLSLCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
             W SDTV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  RWHSDTVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V  GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 152/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA S R +FD  D LK   
Sbjct  181  IDFRMDEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETATSRRCYFDLGDMLKNNA  240

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLKNCTQKE  400
             G Y+PYTPSI +LYG+R  L+ +FEEGL+N+ ARH  L +  R AVQ  W L  C +  
Sbjct  241  TG-YFPYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVRAAVQEGWKLNLCAKAP  299

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            EW+SDTV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN L L+ 
Sbjct  300  EWYSDTVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLNALSLMS  359

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V  GSGVAAAS Y +   P
Sbjct  360  AIAGAEMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 154/209 (74%), Gaps = 1/209 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            ++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D +    
Sbjct  183  LEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQDMIAQNA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR AV AWGLK C ++ +
Sbjct  243  NG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTCAKEPK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQ  130
            +AG EM + D G  ++ GSGVAAA A  +
Sbjct  362  IAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  KWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>emb|CAM59875.2| alanine:glyoxylate aminotransferase [Prunus avium]
Length=120

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  753  DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKM  574
            DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK+
Sbjct  1    DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKL  60

Query  573  GTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEW  394
            GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC QKEEW
Sbjct  61   GTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCXQKEEW  120



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  KWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++   
Sbjct  186  IDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+ 
Sbjct  305  KWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  118
             +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  365  AIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D +K   
Sbjct  186  IDFRMDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGDMIKANA  245

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L    R AV + WGL+ C +  
Sbjct  246  TG-YFPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLELCAKAP  304

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W SDTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L  
Sbjct  305  KWHSDTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTS  364

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAY  136
             ++G EM + D+G  V+ GSG  AA+ Y
Sbjct  365  AISGAEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_031597721.1| serine--glyoxylate aminotransferase [Ferrovum myxofaciens]
Length=398

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 154/208 (74%), Gaps = 2/208 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEW VD+ + GSQK L LP G+GI C S KAL+A++ ++  R +FD+ D +K   
Sbjct  178  IDFRMDEWKVDICVAGSQKGLMLPAGMGITCVSQKALQAAQNSRHPRCYFDYLDMVKSNG  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTPSI +LYGLR  L +L EEGL+NV ARH  L    R AV Q W L  C +  
Sbjct  238  TG-YFPYTPSIPMLYGLREALVMLEEEGLENVFARHHYLAEGVRAAVTQGWKLSLCAKAP  296

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W+SD+V+A+VVP+  +++E+++RA++RYNL+LG GL+KVAGKVFRIGHLG+LNE+ L+G
Sbjct  297  QWYSDSVSAIVVPAGFNAAEVIERAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEVMLMG  356

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAY  136
             +AG EM + D G PV  GSGVAAA+ +
Sbjct  357  AIAGAEMAMLDCGIPVTPGSGVAAATQF  384



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 153/209 (73%), Gaps = 1/209 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            ++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA+E  KT K  R +F+++D +    
Sbjct  183  LEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIEKGKTNKGRRAYFEFQDMIAQNA  242

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +
Sbjct  243  NG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKTCAKEPK  301

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG 
Sbjct  302  WNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGA  361

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQ  130
            +AG EM + D G  ++ GSGVAAA A  +
Sbjct  362  IAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D +K   
Sbjct  178  IDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDMIKANA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  C +  
Sbjct  238  TG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGLCAKDP  296

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL +LG
Sbjct  297  KWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNELMVLG  356

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  103
             LAG EM + D+G  ++ GSGVAAA  Y + T   +P +
Sbjct  357  ALAGAEMSMLDVGIKIEPGSGVAAAQKYFR-THDNVPKK  394



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 150/210 (71%), Gaps = 1/210 (0%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+A+ GSQK   LP G+ I+C SPKAL+ +K +K  R +FD+ D +K  K
Sbjct  178  IDFRMDEWGVDIAVCGSQKGFMLPGGLAILCVSPKALDTAKNSKLHRCYFDFADMIKTNK  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  397
             G ++PYTP +QL+ GLR  +D+L  EGL+NV ARH RLG   R AV AW +K   +++ 
Sbjct  238  DG-FFPYTPPMQLIRGLRTSVDMLLSEGLENVFARHHRLGEGVRRAVAAWNMKLVAKEKR  296

Query  396  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  217
            W SDTV+A+ +    DS+ +V+ A++RY LSLG+GL ++ GKVFRIGHLG+LNEL +L  
Sbjct  297  WQSDTVSAIQITDGFDSNSLVRHAYRRYGLSLGVGLARLNGKVFRIGHLGDLNELMVLSA  356

Query  216  LAGVEMVLKDIGYPVKLGSGVAAASAYLQN  127
            L GVE+ ++D+G P+K GSGV AA  Y   
Sbjct  357  LGGVELAMRDVGVPIKAGSGVGAAVDYFHQ  386



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 155/211 (73%), Gaps = 2/211 (1%)
 Frame = -3

Query  756  IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  577
            IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D +K   
Sbjct  178  IDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDMIKANA  237

Query  576  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKE  400
             G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  C +  
Sbjct  238  TG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGLCAKDP  296

Query  399  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  220
            +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL +LG
Sbjct  297  KWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNELMVLG  356

Query  219  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  127
             LAG EM + D+G  ++ GSGVAAA  Y + 
Sbjct  357  ALAGAEMSMLDVGIRIEPGSGVAAAQKYFRT  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260