BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040G12

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    281   5e-91   Nicotiana tomentosiformis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               280   1e-90   Nicotiana sylvestris
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               275   1e-88   Solanum lycopersicum
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    273   5e-88   Solanum tuberosum [potatoes]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    272   2e-85   
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                264   3e-84   Erythranthe guttata [common monkey flower]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               261   4e-83   Nicotiana sylvestris
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               259   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          259   2e-82   Solanum tuberosum [potatoes]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               258   8e-82   Sesamum indicum [beniseed]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             253   3e-80   Phaseolus vulgaris [French bean]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               254   4e-80   Nicotiana sylvestris
gb|ACU23452.1|  unknown                                                 252   8e-80   Glycine max [soybeans]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    252   9e-80   Glycine max [soybeans]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               251   2e-79   Solanum lycopersicum
gb|AFK41983.1|  unknown                                                 249   8e-79   Medicago truncatula
ref|XP_002509881.1|  conserved hypothetical protein                     250   9e-79   Ricinus communis
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               250   9e-79   Nicotiana tomentosiformis
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               250   9e-79   Vitis vinifera
emb|CDP05124.1|  unnamed protein product                                249   1e-78   Coffea canephora [robusta coffee]
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               249   1e-78   Phoenix dactylifera
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               249   1e-78   Nelumbo nucifera [Indian lotus]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               249   1e-78   Glycine max [soybeans]
gb|KHG24129.1|  Reticulon-like protein B3                               249   2e-78   Gossypium arboreum [tree cotton]
gb|ACJ84486.1|  unknown                                                 249   2e-78   Medicago truncatula
ref|XP_007038874.1|  VIRB2-interacting protein 2                        248   3e-78   Theobroma cacao [chocolate]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          248   4e-78   Cicer arietinum [garbanzo]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               248   4e-78   
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               248   7e-78   Elaeis guineensis
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               247   1e-77   Phoenix dactylifera
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                247   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               247   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          246   3e-77   Solanum tuberosum [potatoes]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               245   6e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001149653.1|  LOC100283279                                       245   8e-77   Zea mays [maize]
gb|EAY75742.1|  hypothetical protein OsI_03655                          244   1e-76   Oryza sativa Indica Group [Indian rice]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          244   1e-76   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044177.1|  Os01g0736900                                       244   2e-76   
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               244   2e-76   Pyrus x bretschneideri [bai li]
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               244   2e-76   Vitis vinifera
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               244   3e-76   Nicotiana tomentosiformis
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             243   3e-76   Citrus clementina [clementine]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 243   4e-76   Elaeis guineensis
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               244   6e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          243   7e-76   Citrus sinensis [apfelsine]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               243   7e-76   Malus domestica [apple tree]
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         243   7e-76   Jatropha curcas
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               242   8e-76   Phoenix dactylifera
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          242   1e-75   Oryza brachyantha
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               242   1e-75   Eucalyptus grandis [rose gum]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             241   2e-75   Citrus clementina [clementine]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   241   2e-75   Citrus sinensis [apfelsine]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               241   2e-75   Elaeis guineensis
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               241   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               241   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          241   3e-75   Setaria italica
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               241   4e-75   Elaeis guineensis
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               240   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               240   8e-75   Cucumis melo [Oriental melon]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    239   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               239   1e-74   Sesamum indicum [beniseed]
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    239   1e-74   Nicotiana sylvestris
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               239   2e-74   
ref|NP_001042463.1|  Os01g0226300                                       236   2e-74   
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               239   2e-74   Solanum lycopersicum
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               238   3e-74   Populus euphratica
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          238   3e-74   Cucumis sativus [cucumbers]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               238   3e-74   Malus domestica [apple tree]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          238   3e-74   Solanum tuberosum [potatoes]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             238   5e-74   Prunus persica
emb|CDP12094.1|  unnamed protein product                                238   6e-74   Coffea canephora [robusta coffee]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         237   6e-74   Jatropha curcas
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             238   6e-74   Capsella rubella
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               239   7e-74   Elaeis guineensis
ref|NP_192861.1|  reticulon-like protein B2                             238   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056102.1|  Os05g0526400                                       236   1e-73   
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          237   1e-73   Solanum tuberosum [potatoes]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    236   1e-73   
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             237   2e-73   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             236   2e-73   
emb|CDY57657.1|  BnaC01g15350D                                          237   2e-73   Brassica napus [oilseed rape]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               236   2e-73   Prunus mume [ume]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               236   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               236   5e-73   Brassica rapa
emb|CDY44123.1|  BnaA01g13310D                                          236   5e-73   Brassica napus [oilseed rape]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               235   5e-73   Eucalyptus grandis [rose gum]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     236   6e-73   Eucalyptus grandis [rose gum]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     235   6e-73   Eucalyptus grandis [rose gum]
dbj|BAJ33905.1|  unnamed protein product                                236   6e-73   Eutrema halophilum
dbj|BAB32723.1|  unknown protein                                        236   6e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             236   6e-73   Eutrema salsugineum [saltwater cress]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               235   7e-73   Solanum lycopersicum
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             234   9e-73   Prunus persica
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               232   1e-72   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         234   1e-72   Jatropha curcas
ref|XP_010092876.1|  Reticulon-like protein                             234   2e-72   Morus notabilis
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    234   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               234   2e-72   Populus euphratica
gb|EAY98759.1|  hypothetical protein OsI_20691                          234   2e-72   Oryza sativa Indica Group [Indian rice]
gb|EAY73097.1|  hypothetical protein OsI_00974                          234   2e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    234   2e-72   Nicotiana sylvestris
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               233   2e-72   Eucalyptus grandis [rose gum]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               234   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    233   2e-72   Sesamum indicum [beniseed]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             234   3e-72   
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     229   3e-72   Eucalyptus grandis [rose gum]
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               232   4e-72   Brachypodium distachyon [annual false brome]
emb|CDY10954.1|  BnaA03g46130D                                          233   4e-72   Brassica napus [oilseed rape]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        233   5e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010112604.1|  Reticulon-like protein                             232   6e-72   Morus notabilis
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               233   7e-72   Fragaria vesca subsp. vesca
ref|NP_194094.1|  VIRB2-interacting protein 1                           233   8e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08746.1|  unnamed protein product                                232   8e-72   Coffea canephora [robusta coffee]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               232   1e-71   Brassica rapa
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               232   1e-71   Nicotiana sylvestris
gb|KJB52210.1|  hypothetical protein B456_008G250900                    231   1e-71   Gossypium raimondii
emb|CDY24806.1|  BnaA08g15040D                                          232   1e-71   Brassica napus [oilseed rape]
ref|NP_001150474.1|  seed maturation protein                            233   1e-71   
ref|XP_002299504.1|  reticulon family protein                           231   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               232   1e-71   Brassica rapa
gb|ACF87936.1|  unknown                                                 229   2e-71   Zea mays [maize]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          231   2e-71   Oryza brachyantha
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               231   2e-71   Brassica rapa
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                231   2e-71   Erythranthe guttata [common monkey flower]
emb|CDY41666.1|  BnaC03g62180D                                          231   3e-71   Brassica napus [oilseed rape]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          231   3e-71   Setaria italica
ref|NP_001130478.1|  Seed maturation protein                            230   3e-71   Zea mays [maize]
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               230   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        230   5e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               230   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               231   7e-71   Brachypodium distachyon [annual false brome]
tpg|DAA52789.1|  TPA: seed maturation protein                           231   7e-71   
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               230   8e-71   Camelina sativa [gold-of-pleasure]
dbj|BAJ89699.1|  predicted protein                                      229   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               229   1e-70   Populus euphratica
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          228   1e-70   Oryza brachyantha
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    229   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               229   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               229   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002511930.1|  conserved hypothetical protein                     228   2e-70   Ricinus communis
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               228   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               228   3e-70   Brachypodium distachyon [annual false brome]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               229   3e-70   
gb|EMT18983.1|  Reticulon-like protein B1                               226   4e-70   
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               228   5e-70   Malus domestica [apple tree]
gb|EMS62606.1|  Reticulon-like protein B1                               227   5e-70   Triticum urartu
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               227   7e-70   Camelina sativa [gold-of-pleasure]
gb|KHG04885.1|  Reticulon-like protein B5                               227   7e-70   Gossypium arboreum [tree cotton]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               227   1e-69   Nelumbo nucifera [Indian lotus]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    226   2e-69   Gossypium raimondii
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          226   2e-69   Cucumis sativus [cucumbers]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        226   3e-69   
emb|CDJ26559.1|  unnamed protein product                                226   3e-69   Triticum aestivum [Canadian hard winter wheat]
gb|EMT19773.1|  Reticulon-like protein B1                               226   4e-69   
gb|KHG20258.1|  Reticulon-like protein B3                               224   7e-69   Gossypium arboreum [tree cotton]
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          226   7e-69   Glycine max [soybeans]
gb|ABK94480.1|  unknown                                                 224   7e-69   Populus trichocarpa [western balsam poplar]
ref|XP_002320163.1|  reticulon family protein                           224   8e-69   Populus trichocarpa [western balsam poplar]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   225   9e-69   Citrus sinensis [apfelsine]
gb|KHG29253.1|  Reticulon-like protein B5                               224   9e-69   Gossypium arboreum [tree cotton]
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             225   9e-69   
gb|KJB06451.1|  hypothetical protein B456_001G157900                    224   1e-68   Gossypium raimondii
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               224   1e-68   Populus euphratica
ref|XP_002303615.1|  reticulon family protein                           223   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               224   2e-68   Camelina sativa [gold-of-pleasure]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                223   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               223   3e-68   Sesamum indicum [beniseed]
ref|NP_198975.1|  reticulon-like protein B4                             223   4e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KJB24288.1|  hypothetical protein B456_004G137000                    222   5e-68   Gossypium raimondii
gb|KHN15986.1|  Reticulon-like protein B5                               222   5e-68   Glycine soja [wild soybean]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    222   7e-68   Gossypium raimondii
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               223   8e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG15548.1|  Reticulon-like protein B3                               221   8e-68   Gossypium arboreum [tree cotton]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               222   9e-68   Glycine max [soybeans]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    221   1e-67   Arabis alpina [alpine rockcress]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               221   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    222   2e-67   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          221   3e-67   
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               220   4e-67   Malus domestica [apple tree]
ref|XP_007051689.1|  Reticulon family protein                           219   5e-67   
gb|KJB19087.1|  hypothetical protein B456_003G084400                    219   6e-67   Gossypium raimondii
gb|KHG09260.1|  Reticulon-like protein B3                               218   1e-66   Gossypium arboreum [tree cotton]
gb|KHN29299.1|  Reticulon-like protein B5                               218   2e-66   Glycine soja [wild soybean]
gb|EPS73616.1|  hypothetical protein M569_01145                         218   4e-66   Genlisea aurea
dbj|BAJ98297.1|  predicted protein                                      217   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH20346.1|  AT4G11220                                              214   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40449.1|  Reticulon-like protein B5                               216   2e-65   Glycine soja [wild soybean]
ref|XP_003592173.1|  Reticulon family protein                           216   2e-65   Medicago truncatula
ref|NP_001239653.1|  uncharacterized protein LOC100793862               216   2e-65   Glycine max [soybeans]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               216   2e-65   Pyrus x bretschneideri [bai li]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               216   2e-65   Glycine max [soybeans]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             215   3e-65   Phaseolus vulgaris [French bean]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               215   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               215   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               215   4e-65   Prunus mume [ume]
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          215   4e-65   Cicer arietinum [garbanzo]
gb|AFK34557.1|  unknown                                                 215   6e-65   Medicago truncatula
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               214   9e-65   Elaeis guineensis
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               214   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               214   1e-64   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               213   1e-64   Phoenix dactylifera
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    213   1e-64   Arabis alpina [alpine rockcress]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               214   1e-64   Prunus mume [ume]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             214   1e-64   Eutrema salsugineum [saltwater cress]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             213   1e-64   Eutrema salsugineum [saltwater cress]
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             213   2e-64   
emb|CDM81762.1|  unnamed protein product                                213   2e-64   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               213   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               213   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    213   2e-64   Elaeis guineensis
emb|CDY08353.1|  BnaC09g12430D                                          213   2e-64   Brassica napus [oilseed rape]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               213   2e-64   Camelina sativa [gold-of-pleasure]
gb|ABK23818.1|  unknown                                                 209   2e-64   Picea sitchensis
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               213   3e-64   Tarenaya hassleriana [spider flower]
emb|CDY05135.1|  BnaC03g29330D                                          214   3e-64   
gb|EMS50148.1|  Reticulon-like protein B2                               211   6e-64   Triticum urartu
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               211   6e-64   Fragaria vesca subsp. vesca
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               212   7e-64   Pyrus x bretschneideri [bai li]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    211   7e-64   Arabis alpina [alpine rockcress]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               211   7e-64   Malus domestica [apple tree]
emb|CDY25557.1|  BnaC09g11820D                                          211   8e-64   Brassica napus [oilseed rape]
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             211   9e-64   Populus trichocarpa [western balsam poplar]
emb|CDY34396.1|  BnaA09g11380D                                          211   9e-64   Brassica napus [oilseed rape]
gb|EMS62854.1|  Reticulon-like protein B1                               211   1e-63   Triticum urartu
ref|XP_002887921.1|  reticulon family protein                           211   1e-63   Arabidopsis lyrata subsp. lyrata
gb|EMT25698.1|  Reticulon-like protein B2                               211   1e-63   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             214   1e-63   
gb|ABB51093.1|  reticulon                                               209   2e-63   Hordeum vulgare [barley]
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               210   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               210   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               210   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             210   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    210   4e-63   Camelina sativa [gold-of-pleasure]
emb|CDY38194.1|  BnaA09g11950D                                          209   4e-63   Brassica napus [oilseed rape]
gb|ABR17571.1|  unknown                                                 210   4e-63   Picea sitchensis
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          209   4e-63   Sorghum bicolor [broomcorn]
gb|ABK22748.1|  unknown                                                 209   4e-63   Picea sitchensis
emb|CDX90792.1|  BnaA03g24720D                                          210   5e-63   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          209   6e-63   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             209   6e-63   Phaseolus vulgaris [French bean]
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               209   6e-63   Phoenix dactylifera
gb|KHN12926.1|  Reticulon-like protein B1                               209   6e-63   Glycine soja [wild soybean]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             209   9e-63   Capsella rubella
gb|ACN40158.1|  unknown                                                 209   1e-62   Picea sitchensis
dbj|BAJ94514.1|  predicted protein                                      209   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_566065.1|  reticulon-like protein B5                             209   1e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57206.1|  AT1G64090                                              207   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               208   2e-62   Zea mays [maize]
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               207   2e-62   Nelumbo nucifera [Indian lotus]
ref|NP_176592.1|  reticulon-like protein B3                             208   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057713.1|  Os06g0503400                                       208   2e-62   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          207   3e-62   Oryza brachyantha
ref|NP_001185307.1|  reticulon-like protein B3                          208   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          207   3e-62   Sorghum bicolor [broomcorn]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             207   3e-62   Capsella rubella
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               207   3e-62   Brassica rapa
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               207   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    208   5e-62   Gossypium raimondii
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    206   5e-62   
gb|ACG32549.1|  seed maturation protein                                 207   6e-62   Zea mays [maize]
ref|XP_010105716.1|  Reticulon-like protein                             207   7e-62   
gb|KJB52679.1|  hypothetical protein B456_008G272900                    206   7e-62   Gossypium raimondii
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               206   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          206   8e-62   Setaria italica
gb|ACG36034.1|  reticulon                                               206   8e-62   Zea mays [maize]
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          206   9e-62   Oryza brachyantha
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               206   1e-61   Cucumis melo [Oriental melon]
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               206   1e-61   Camelina sativa [gold-of-pleasure]
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    206   1e-61   Arabis alpina [alpine rockcress]
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          206   1e-61   
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               206   1e-61   Brassica rapa
gb|KHN21799.1|  Reticulon-like protein B1                               205   2e-61   Glycine soja [wild soybean]
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               204   2e-61   Elaeis guineensis
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               205   2e-61   Brassica rapa
gb|AFK42059.1|  unknown                                                 205   3e-61   Lotus japonicus
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             204   4e-61   Capsella rubella
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          204   4e-61   Glycine max [soybeans]
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               204   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_002880222.1|  reticulon family protein                           204   5e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             204   6e-61   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               203   6e-61   
emb|CDY42012.1|  BnaC04g00900D                                          204   7e-61   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               204   8e-61   
ref|NP_001046501.1|  Os02g0265900                                       203   9e-61   
emb|CDY52012.1|  BnaC06g42920D                                          203   1e-60   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               203   1e-60   
gb|EAY85291.1|  hypothetical protein OsI_06662                          201   4e-60   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          202   4e-60   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          202   4e-60   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               202   4e-60   
gb|EMT06999.1|  Reticulon-like protein B1                               201   7e-60   
gb|EPS71452.1|  hypothetical protein M569_03311                         201   8e-60   
gb|EPS64109.1|  hypothetical protein M569_10676                         201   8e-60   
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               201   1e-59   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               200   1e-59   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      200   4e-59   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             199   4e-59   
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               199   5e-59   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      200   6e-59   
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   198   8e-59   
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             198   9e-59   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               197   2e-58   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               197   2e-58   
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             197   3e-58   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               197   4e-58   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          207   7e-58   
ref|NP_191715.2|  reticulon-like protein B6                             196   7e-58   
ref|XP_002876621.1|  reticulon family protein                           196   9e-58   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          195   1e-57   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               195   2e-57   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          195   3e-57   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               194   4e-57   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          194   4e-57   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               193   1e-56   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     192   1e-56   
gb|ABK26525.1|  unknown                                                 192   3e-56   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               189   3e-55   
gb|EMS49910.1|  Reticulon-like protein B3                               191   8e-55   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               187   3e-54   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          185   1e-53   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              186   2e-53   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      185   3e-53   
dbj|BAK06264.1|  predicted protein                                      184   4e-53   
gb|EPS69502.1|  hypothetical protein M569_05265                         183   4e-53   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         181   8e-53   
ref|XP_010921233.1|  PREDICTED: reticulon-like protein B1 isoform X2    181   3e-52   
gb|ABK94711.1|  unknown                                                 177   4e-52   
gb|EAY97489.1|  hypothetical protein OsI_19418                          181   4e-52   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               181   5e-52   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                180   5e-52   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    181   7e-52   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               180   9e-52   
ref|NP_001055164.1|  Os05g0312500                                       180   1e-51   
gb|EEC80692.1|  hypothetical protein OsI_23118                          191   1e-51   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               179   2e-51   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               178   7e-51   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               177   1e-50   
ref|NP_001149072.1|  LOC100282693                                       177   1e-50   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          177   1e-50   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 177   2e-50   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               177   2e-50   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               175   5e-50   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             176   5e-50   
gb|EMS52545.1|  Reticulon-like protein B1                               176   6e-50   
gb|EPS67049.1|  hypothetical protein M569_07727                         174   7e-50   
ref|NP_001150935.1|  seed maturation protein                            174   2e-49   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     173   2e-49   
gb|ABK26009.1|  unknown                                                 172   6e-49   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               171   1e-48   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               172   1e-48   
gb|ACJ84844.1|  unknown                                                 169   1e-48   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    171   3e-48   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    171   3e-48   
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             165   2e-46   
ref|XP_002521590.1|  conserved hypothetical protein                     166   4e-46   
gb|EMT10142.1|  Reticulon-like protein B1                               166   6e-46   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         165   8e-46   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               164   2e-45   
gb|ABC69764.1|  unknown                                                 162   2e-45   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    163   4e-45   
gb|KJB41425.1|  hypothetical protein B456_007G104000                    159   5e-45   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          163   8e-45   
ref|XP_002302126.2|  reticulon family protein                           161   2e-44   
dbj|BAH20230.1|  AT4G23630                                              156   3e-44   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               160   4e-44   
ref|XP_002306759.1|  reticulon family protein                           160   4e-44   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    160   4e-44   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          160   7e-44   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               159   2e-43   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    159   2e-43   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          157   4e-43   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               157   5e-43   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    157   5e-43   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               157   7e-43   
gb|KJB41424.1|  hypothetical protein B456_007G104000                    153   1e-42   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               157   1e-42   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               156   1e-42   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    157   1e-42   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    156   1e-42   
ref|XP_007048924.1|  Reticulon family protein                           156   1e-42   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    156   2e-42   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    156   2e-42   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               155   2e-42   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               155   3e-42   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               155   3e-42   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          155   3e-42   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             155   5e-42   
emb|CDP04019.1|  unnamed protein product                                154   8e-42   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               154   9e-42   
gb|KJB41426.1|  hypothetical protein B456_007G104000                    152   1e-41   
gb|KHN11998.1|  Reticulon-like protein B8                               154   1e-41   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          154   1e-41   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               154   1e-41   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    154   1e-41   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    154   1e-41   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             154   1e-41   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    154   2e-41   
tpg|DAA61174.1|  TPA: hypothetical protein ZEAMMB73_087528              150   2e-41   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    153   2e-41   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    152   3e-41   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             153   3e-41   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               152   4e-41   
ref|NP_566371.1|  reticulon-like protein B8                             152   5e-41   
ref|NP_850552.1|  reticulon-like protein B8                             152   6e-41   
ref|XP_006442586.1|  hypothetical protein CICLE_v10022074mg             151   6e-41   
ref|XP_006477776.1|  PREDICTED: reticulon-like protein B9-like          151   6e-41   
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             150   7e-41   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     151   7e-41   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             152   7e-41   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          154   7e-41   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               152   8e-41   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    151   1e-40   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               151   1e-40   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             151   2e-40   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               150   2e-40   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   151   2e-40   
gb|KHG28741.1|  Reticulon-like protein B8                               150   2e-40   
ref|XP_010093192.1|  Reticulon-like protein                             150   3e-40   
gb|KDO41234.1|  hypothetical protein CISIN_1g0293962mg                  149   3e-40   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    150   3e-40   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             151   3e-40   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    151   3e-40   
dbj|BAK05980.1|  predicted protein                                      149   3e-40   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    150   3e-40   
ref|XP_004971481.1|  PREDICTED: reticulon-like protein B1-like          146   5e-40   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               149   5e-40   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     150   7e-40   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               149   7e-40   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    151   9e-40   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    151   1e-39   
ref|XP_006491908.1|  PREDICTED: reticulon-like protein B5-like is...    151   1e-39   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               148   1e-39   
emb|CDY00916.1|  BnaC05g42840D                                          148   1e-39   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               149   1e-39   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               148   1e-39   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    148   1e-39   
ref|NP_001051461.1|  Os03g0781700                                       148   2e-39   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    149   2e-39   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    149   2e-39   
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          147   2e-39   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    148   2e-39   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               148   2e-39   
emb|CDP18758.1|  unnamed protein product                                148   2e-39   
gb|KHN28537.1|  Reticulon-like protein B8                               147   3e-39   
gb|ACG31942.1|  seed maturation protein                                 148   3e-39   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          147   4e-39   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          147   5e-39   
gb|AFA36590.1|  putative 24 kDa seed maturation protein                 143   5e-39   
gb|EAY92056.1|  hypothetical protein OsI_13754                          147   6e-39   
ref|XP_001783075.1|  predicted protein                                  146   6e-39   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                146   6e-39   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    146   7e-39   
ref|XP_001759351.1|  predicted protein                                  146   7e-39   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    147   8e-39   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               145   9e-39   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    146   9e-39   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    146   1e-38   
emb|CDY07184.1|  BnaCnng01990D                                          146   1e-38   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               145   1e-38   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               145   1e-38   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    145   2e-38   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               145   2e-38   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    145   2e-38   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    145   2e-38   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    145   2e-38   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    145   2e-38   
ref|NP_001150885.1|  seed maturation protein                            144   2e-38   
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             145   2e-38   
gb|ACG26944.1|  seed maturation protein                                 145   3e-38   
ref|NP_001137021.1|  seed maturation protein isoform 1                  145   3e-38   
tpg|DAA51729.1|  TPA: seed maturation protein                           145   3e-38   
gb|EAY98925.1|  hypothetical protein OsI_20880                          144   3e-38   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               144   4e-38   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     144   4e-38   
ref|XP_008218214.1|  PREDICTED: reticulon-like protein B2               144   4e-38   
ref|XP_007207847.1|  hypothetical protein PRUPE_ppa022956mg             144   6e-38   
ref|XP_010926506.1|  PREDICTED: reticulon-like protein B2               143   9e-38   
ref|NP_001058867.1|  Os07g0142000                                       144   9e-38   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          143   1e-37   
ref|XP_004969613.1|  PREDICTED: reticulon-like protein B9-like is...    142   1e-37   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               142   1e-37   
emb|CDY41331.1|  BnaA01g31880D                                          143   1e-37   
ref|XP_008374784.1|  PREDICTED: reticulon-like protein B9               142   1e-37   
emb|CDY56712.1|  BnaC01g38700D                                          145   1e-37   
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             142   2e-37   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1               141   2e-37   
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               142   3e-37   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          142   3e-37   
gb|KEH33648.1|  reticulon-like protein B2                               141   3e-37   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                142   3e-37   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               141   3e-37   
ref|XP_004969612.1|  PREDICTED: reticulon-like protein B9-like is...    142   4e-37   
ref|XP_011071252.1|  PREDICTED: reticulon-like protein B9               141   4e-37   
ref|XP_001778850.1|  predicted protein                                  141   5e-37   
gb|KEH33647.1|  reticulon-like protein B2                               142   5e-37   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    142   5e-37   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    142   6e-37   
ref|NP_192032.1|  reticulon-like protein B7                             141   6e-37   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    141   6e-37   
gb|AFK34561.1|  unknown                                                 141   7e-37   



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILILALA+ FLWSNASTFINKSPPQIP VILP+D VL VASAL
Sbjct  91   WVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LR+IASGK++KKFLAVIAGLWVLS++GN +NFLTLFY+  VLLHTVP+LY
Sbjct  151  RIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAFAEKAEAEI KQYAV N K LSKIP+GPLKDKKL
Sbjct  211  EKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKL  253



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILILALA+ FLWSNASTFINKSPPQIP VILP+D VL VASAL
Sbjct  91   WVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LR+IASGK++KKFLAVIAGLWVLS++GN +NFLTLFY+  VLLHTVP+LY
Sbjct  151  RIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAFAEKAEAEI KQYAV N K LSKIP+GPLKDKK 
Sbjct  211  EKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKF  253



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLVCHILILALA+ FLWSNASTFINKSPPQIP VILP+D VL VA+AL
Sbjct  92   WVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L V R+IASGK++KKFL VIAGLWVLS++GN +NFLTLFY+  VLLHTVP+LY
Sbjct  152  RIEINRALEVFRDIASGKELKKFLGVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EK+EDQVDAFAEKAEAEI KQYAV N K LSKIP+GPLKDKKL
Sbjct  212  EKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKL  254



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLVCHILILALA+ FLWSNASTFINKSPPQIP VILP+D VL VA+AL
Sbjct  92   WVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+ L + R+IASGK++KKFLAVIAGLWVLS++GN +NFLTLFY+  VLLHTVP+LY
Sbjct  152  RIEINKALEIFRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EK+EDQVDAFAEKAEAEI KQYAV N K LSKIP+GPLKDKK 
Sbjct  212  EKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKF  254



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLVCHILILALA+ FLWSNASTFINKSPPQIP VILP+D VL VA+AL
Sbjct  240  WVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAAL  299

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+ L + R+IASGK++KKFLAVIAGLWVLS++GN +NFLTLFY+  VLLHTVP+LY
Sbjct  300  RIEINKALEIFRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY  359

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EK+EDQVDAFAE AEAEI KQYAV N K LSKIP+GPLKDKK 
Sbjct  360  EKFEDQVDAFAENAEAEIKKQYAVFNVKVLSKIPRGPLKDKKF  402



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+LVCHILIL LAI FLWSNAS+FINKSPP+IP V++ +D V+ VA+AL
Sbjct  96   WVLFELIEYHLLSLVCHILILGLAIIFLWSNASSFINKSPPKIPEVVVREDIVIGVANAL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE NR  A+LR+I SGKD+KKFLAVIAGLWVLS++G+ FNFLTLFY+  VLLHTVP+LY
Sbjct  156  RIEFNRAFAILRDIVSGKDLKKFLAVIAGLWVLSMLGSCFNFLTLFYICFVLLHTVPLLY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKY+DQ+DAFAEKAEAE+ KQYAV + K LSKIPKGPLKDKK 
Sbjct  216  EKYDDQIDAFAEKAEAELKKQYAVFDAKVLSKIPKGPLKDKKF  258



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFEL++YHLLTLVCHILI+A+ + FLWSNAS FIN +PPQIP V+LP+D VL VASAL
Sbjct  97   WALFELLQYHLLTLVCHILIVAITVLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR L +LR+IASGKD+KKFL VI GLWV+S++GN +NFLTLFY++ VLLHTVP+LY
Sbjct  157  RIEMNRILEILRDIASGKDLKKFLVVILGLWVVSILGNCWNFLTLFYIVFVLLHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            +KYED+VDAFAEKAEAEI K YAV N++ LSKIP+GPL+DK+LA
Sbjct  217  DKYEDKVDAFAEKAEAEIKKHYAVFNDQVLSKIPRGPLRDKRLA  260



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTLVCH LIL+LAI FLWSNA+TFINKSPP IP VI+P+D  +N+A +L
Sbjct  88   WVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKSPPHIPEVIIPEDLSVNIALSL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIA+G+DVKKFLAVI GLWVLSV+GN  NFLTLFY+  V LHTVP LY
Sbjct  148  RYEINRGFAVLREIAAGRDVKKFLAVIVGLWVLSVIGNCCNFLTLFYIAFVTLHTVPFLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            +KYEDQVD+FAEKA  E  K YAV++ KYLSKIP+GPLKDKK+
Sbjct  208  DKYEDQVDSFAEKATVEFKKHYAVIHAKYLSKIPRGPLKDKKV  250



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFEL+EYHLLTLVCHILI+A+A+ FLWSNAS FIN +PPQIP V+LP+D VL VASAL
Sbjct  91   WALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LR+IASGKD+KKFL VI GLWV+SV+GN +NFLTLFY++ VLLHTVP+LY
Sbjct  151  RIEINRALEILRDIASGKDLKKFLVVIVGLWVVSVLGNIWNFLTLFYIVFVLLHTVPLLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAFAEKAEAEI K YAV +   LSKIP+GPLK KK
Sbjct  211  EKYEDKVDAFAEKAEAEIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   258 bits (658),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILILALA+ FLWSNASTFINKSPP+IP +I+P+D VL +A+A 
Sbjct  95   WVLFELLEYHLLTLVCHILILALALIFLWSNASTFINKSPPKIPEIIVPEDIVLGIAAAF  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE NR LA+LR+IASG+++KKFLAVIAGLWVLS++GN FNFLTLFY   VLLHTVP+LY
Sbjct  155  RIEFNRALAILRDIASGRELKKFLAVIAGLWVLSILGNYFNFLTLFYTCFVLLHTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAFAEKAEAE+ KQYAV N K LSKIP+GPLKDKKL
Sbjct  215  EKYEDQVDAFAEKAEAELKKQYAVFNTKVLSKIPRGPLKDKKL  257



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH +ILALA  FLWSNASTFINK PP+IP V +P+D +L  ASAL
Sbjct  91   WILFELLEYHLLTLVCHFVILALAGLFLWSNASTFINKRPPKIPQVHIPEDPILQFASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  +VLR+IASG+D+KKFL+VIAGLWV S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  151  RIEINRAFSVLRDIASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD+F EKA AEI KQYAV + K LSKIPKGPLKDKK
Sbjct  211  EKYEDQVDSFGEKAIAEIKKQYAVFDAKVLSKIPKGPLKDKK  252



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHILI++LA+ FLWSNA+TFINK PP IP + LPQD  L VASAL
Sbjct  103  WVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASAL  162

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR LA+LREIASG+++KKFL V+AGLW+LS++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  163  RIEINRALALLREIASGRELKKFLGVVAGLWILSIVGSWCNFLTLFYILFVLLHTVPVLY  222

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD  AEKA  EI KQYAV +EK LSKIP+GPLKDKK
Sbjct  223  EKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPLKDKK  264



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LILALA  FLWSNASTFINKSPP+IP V +P++ VL  ASAL
Sbjct  90   WVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASAL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVLR+IASG+D+KKFL+VIAGLWV S++G   NFLTLFY+  VLLHTVP+LY
Sbjct  150  RIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED VD+F EKA AEI KQYAV + K LSKIP+GPLKDKK
Sbjct  210  EKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  251



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LILALA  FLWSNASTFINKSPP+IP V +P++ VL  ASAL
Sbjct  91   WVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVLR+IASG+D+KKFL+VIAGLWV S++G   NFLTLFY+  VLLHTVP+LY
Sbjct  151  RIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED VD+F EKA AEI KQYAV + K LSKIP+GPLKDKK
Sbjct  211  EKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFEL+EYHLLTLVCHILI+A+A+ FLWSNAS FIN +PP IP V+LP+D VL+VASAL
Sbjct  91   WALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFINTAPPHIPEVVLPKDIVLSVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LR+IASGKD+KKFL VI GLW++S++GN +NFLTLFY++ VLLHTVP+LY
Sbjct  151  RIEINRALEILRDIASGKDLKKFLVVIVGLWIVSILGNIWNFLTLFYIVFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+ED+VDA AEKAEAEI K YAV +   LSKIP+GPLK KK
Sbjct  211  EKHEDKVDAVAEKAEAEIKKHYAVFDANVLSKIPRGPLKGKK  252



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+ H+ ILALA+ FLWSNASTFINKSPP+IP V +P++ VL +ASA+
Sbjct  74   WVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAI  133

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  A+LR+IASG+D+K+FL+VIAGLWVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  134  RIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLY  193

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+F EKA  E  KQYAV +EK LSKIPKGPLKDKK
Sbjct  194  EKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPLKDKK  235



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CH  ILALAI FLWSNASTFINKSPP IP V +P++ VL VA+AL
Sbjct  97   WVLFELIEYHLLTLICHGFILALAILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EIN   A+LR+IASG+D+KKFL+VIAGLWVLS++G+  NFLTLFY+  VLLHTVP+ Y
Sbjct  157  RMEINYAFAILRDIASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VDAFAEKA  EI KQYAV + K LSKIP+GPLKDKK A
Sbjct  217  EKYEDKVDAFAEKAAIEIKKQYAVFDAKVLSKIPRGPLKDKKKA  260



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHILI++LA+ FLWSNA+TFINK PP IP + LPQD  L VASAL
Sbjct  105  WVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASAL  164

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR LA+LREIASG+++KKFL V+AGLW++S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  165  RIEINRALALLREIASGRELKKFLGVVAGLWIISIVGSWCNFLTLFYISFVLLHTVPVLY  224

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD  AEKA  EI KQYAV ++K LSKIP+GPLKDKK
Sbjct  225  EKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSKIPRGPLKDKK  266



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH  ILALAI FLWSNA+TFINK+PP IP V +P+D VL  ASAL
Sbjct  89   WILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKAPPHIPEVHIPEDPVLQFASAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   +LR +ASGKD+KKFL+VIAGLWV+S++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  149  RIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED VD+FAEKA  EI +QYAV + K LS+IP+GPLKDKK+A
Sbjct  209  EKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSRIPRGPLKDKKIA  252



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+LLTLVCHILILALA+ FLWSNASTFINKSPPQ P VILP+D VL VASAL
Sbjct  93   WVLFELLEYYLLTLVCHILILALAVLFLWSNASTFINKSPPQFPEVILPEDIVLGVASAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR LA LREIASG+D+KKFLAVIAGLWV S++G+  NFLTLFY+  +LLHTVP+LY
Sbjct  153  RIEVNRALAALREIASGRDLKKFLAVIAGLWVFSILGSCCNFLTLFYISFILLHTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVD+FAEKAEAEI KQYAV N K LSKIP+GPLKDKK 
Sbjct  213  EKYEDQVDSFAEKAEAEIKKQYAVFNAKVLSKIPRGPLKDKKF  255



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+LVCH LIL+LAI FLWSNASTFINK+PP+IP   +P+D  +NVA +L
Sbjct  91   WVLFELLEYHLLSLVCHCLILSLAILFLWSNASTFINKAPPRIPEASIPEDLAVNVALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIASG+D+KKFL VIAGLWVLS++G+  NFLTLFY ++V LHTVP+LY
Sbjct  151  RYEINRAFAVLREIASGRDLKKFLVVIAGLWVLSILGSCCNFLTLFYTMLVTLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+FAEKA AEI KQY V + K LSKIP+ PLKDKK
Sbjct  211  EKYEDKVDSFAEKAMAEIKKQYGVFDAKVLSKIPRSPLKDKK  252



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LI++LA+ FL+SNA  F++K+PP+IP V +P+D VL  ASAL
Sbjct  91   WVLFELLEYHLLTLVCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVLR+IASG+D+KKFLAVIAGLWVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  151  RIEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYEDQVD+FAEKA AEI KQY + + K LSKIPKGPLKDKK A
Sbjct  211  EKYEDQVDSFAEKAMAEIKKQYVIFDAKVLSKIPKGPLKDKKHA  254



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LIL LA+ FLWSNASTFINKSPP+IP V +P+  VL  ASAL
Sbjct  91   WVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTFINKSPPKIPQVHIPEKPVLEFASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EINR  A+LR+IASG+D+KKFL+VIAGLWV S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  151  RVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED VD+F  KA AEI KQYAV + K LSKIP+GPLKDKK
Sbjct  211  EKYEDHVDSFGGKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TFINKSPP+IP V +P+D V+  A AL
Sbjct  87   WILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINKSPPRIPEVQIPKDPVMEFAQAL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+++KKFL+VIAGLWVLS++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  147  RFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV + K LSKIP+GPLK+KK
Sbjct  207  EKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPLKEKK  248



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+ H+ ILALA+ FLWSNASTFINKSPP+IP V +P++ VL +ASA+
Sbjct  97   WVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAI  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  A+LR+IASG+D+K+FL+VIAGLWVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  157  RIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+F EKA  E  KQYAV +EK LSKIPKGPLKDKK
Sbjct  217  EKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPLKDKK  258



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHL+TL+CH LIL+LAI FLWSNASTFINKSPP IP V+LP+  VL VASAL
Sbjct  84   WILFEMLEYHLITLLCHTLILSLAILFLWSNASTFINKSPPNIPEVVLPEKCVLEVASAL  143

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR L V+R+IASG D+KKFL VI GLW LS++GN  NFLTLFY++ VLLHTVP+ Y
Sbjct  144  RIEVNRALDVVRDIASGNDLKKFLGVIVGLWALSLVGNCCNFLTLFYIVFVLLHTVPVFY  203

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            E YEDQVD+F+EKA  EI KQYA  +EK LSKIPKGPLK+KK
Sbjct  204  EIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSKIPKGPLKEKK  245



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH+ ILALA+ FLWSNASTFINK+PP+IP V +P++ VL +A+AL
Sbjct  92   WILFELLEYHLLTLVCHLAILALAVLFLWSNASTFINKAPPKIPQVHIPEEPVLQIAAAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVLR+IASGKD+KKFL+VIAGLWVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  152  RIEINRVFAVLRDIASGKDLKKFLSVIAGLWVLSIVGSWANFLTLFYIAFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+F EKA AE  KQYAV + K LSKIPKG LK+KK
Sbjct  212  EKYEDRVDSFGEKALAEFKKQYAVFDAKVLSKIPKGALKNKK  253



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHILI+ LA+ FLWSNA+TFINK PP IP V LP+  +L VASAL
Sbjct  100  WVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASAL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LREIASG+++KKFLAVIAGLW+LS++G+  NFLTLFY+  VLLHTVP++Y
Sbjct  160  RIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTVPVIY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD  AEKA  EI KQYAV +EK LSKIP+GPLKDKK
Sbjct  220  EKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPLKDKK  261



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   248 bits (632),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLV H L+L+LAI FLWSNASTFINK PP IP V +P+D  +NVA +L
Sbjct  92   WVLFELLDYHLLTLVGHCLVLSLAILFLWSNASTFINKIPPHIPEVSIPEDVAINVALSL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFLAVIAGLWVLS++G+  NFLTLFY++ V LHTVP+LY
Sbjct  152  RYEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYILFVTLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+FAEKA AEI KQY V + K LSKIP+GPLKDKK
Sbjct  212  EKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLV H LIL+LAI FLWSNASTFI+K+PP IP V +P+D  +NVA +L
Sbjct  92   WVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTPPHIPEVSIPEDLAVNVALSL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A+LR+IASG+D+KKFLAVIAGLWVLS++G+  NFLTLFY++ V LHTVP+LY
Sbjct  152  RYEINRAFAILRDIASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYIVFVTLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA AEI KQY V + K LSKIP+GPLKDKK
Sbjct  212  EKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+LVCH LIL LAI FLWSNASTFI+KS P+ P VI+ ++ V++VASAL
Sbjct  93   WVLFELLEYHLLSLVCHFLILGLAILFLWSNASTFISKSRPKFPEVIISENVVVSVASAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IE NR  A+LRE+ASGKD+KKFLAVIAGLWVLSV+G+ FNFLTLFY   VLLHTVP+LY
Sbjct  153  TIEFNRAFAILREVASGKDLKKFLAVIAGLWVLSVLGSCFNFLTLFYTCFVLLHTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAFAEKAE EI KQYAV + K LSK+PK  LK KK 
Sbjct  213  EKYEDQVDAFAEKAEHEIKKQYAVFDVKVLSKLPKAILKYKKF  255



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLT VCH LIL+LAI FLWSNASTFINKSPP+IP V +P+D  +N+A +L
Sbjct  95   WVLFELMEYHLLTFVCHSLILSLAIMFLWSNASTFINKSPPRIPEVSIPEDMAVNIALSL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EIN   A LR+IA G+D+KKFL+VIAGLWV S++GN  NFLTLFY+  V LHTVP LY
Sbjct  155  RYEINWAFAALRDIALGRDLKKFLSVIAGLWVFSIIGNFCNFLTLFYIAFVTLHTVPPLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VDAFAEKA+ E  K Y+V++ KYLSKIPKGPLKDKK 
Sbjct  215  EKYEDKVDAFAEKAQTEFKKHYSVIHAKYLSKIPKGPLKDKKF  257



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHILI+ LA+ FLWSNA+TFINK PP IP V LP+  +L VASAL
Sbjct  102  WVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASAL  161

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LREIASG+++KKFLAVIAGLW+LS++G+  NFLTLFY+  VLLHT+P+LY
Sbjct  162  RIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTIPVLY  221

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD  AEKA  EI KQYAV + K LSKIP+GPLKDKK
Sbjct  222  EKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSKIPRGPLKDKK  263



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFE+ EYHLL+L+CH+L+L + + FLWSNASTFINK+PP+IP V +P+  VL +ASAL
Sbjct  85   WALFEIFEYHLLSLICHLLMLTITVLFLWSNASTFINKAPPKIPDVRIPEGPVLEIASAL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            + EINR LA LREIASGKD+KKFLAVIAGLW+ S++G+  NFLTLFY+  V+LHT+P+LY
Sbjct  145  KYEINRGLASLREIASGKDLKKFLAVIAGLWIFSILGSCCNFLTLFYICFVMLHTLPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYEDQVDAFAEKA  EI KQY V + K LSKIP+GPLKDKK A
Sbjct  205  EKYEDQVDAFAEKAMIEIKKQYIVFDAKVLSKIPRGPLKDKKAA  248



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LAI FLWSNASTFINKSPP IP V +P+D  +NVA +L
Sbjct  95   WLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFINKSPPNIPEVKIPEDVAVNVALSL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+D+KKFL VIAGLW+LSV+G+  NFLTLFY++ V L+TVP+LY
Sbjct  155  RYEINRGFATLREIGHGRDLKKFLIVIAGLWLLSVLGSCCNFLTLFYIVFVALYTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  E+ K YA+ +EK LSKIPKGPLKDKK
Sbjct  215  EKYEDKVDAFGEKAMTELKKYYAIFDEKCLSKIPKGPLKDKK  256



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LA+ FLWSNASTFI+KSPP IP V +P+D  +N+A +L
Sbjct  91   WLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+D+KKFL VIAGLW+LSV+G+S NFLTLFY++ V L+TVP+LY
Sbjct  151  RYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++DAF EKAE E+ K YA+  EK LSKIPKGPLKDKK
Sbjct  211  EKYEDKIDAFGEKAEIELKKYYALFEEKCLSKIPKGPLKDKK  252



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LA+ FLWSNASTFI+KSPP IP V +P+D  +N+A +L
Sbjct  91   WLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+D+KKFL VIAGLW+LSV+G+S NFLTLFY++ V L+TVP+LY
Sbjct  151  RYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKAE E  K YA+  EK LSKIPKGPLKDKK
Sbjct  211  EKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPLKDKK  252



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LA+ FLWSNASTFI+KSPP IP V +P+D  +N+A +L
Sbjct  91   WLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+D+KKFL VIAGLW+LSV+G+S NFLTLFY++ V L+TVP+LY
Sbjct  151  RYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKAE E  K YA+  EK LSKIPKGPLKDKK
Sbjct  211  EKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPLKDKK  252



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ FLWS ASTFINKSPPQIP V +P+ TVL +ASAL
Sbjct  87   WVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASAL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+   VLR+IASG+D+K FL VIA LW+LSV+G  FNFLTLFY+I VLLHT+P++Y
Sbjct  147  RIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQ+DAF EKA  EI KQYAV + K LSKIPKGP+K+KK
Sbjct  207  EKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  248



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL+LAI FLWSNA+TFINKSPP+IP V +P+D  L   +AL
Sbjct  92   WVLFELLEYHLLTLVCHILILSLAILFLWSNATTFINKSPPRIPEVHIPEDPFLQAVNAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN   AVLR+IASG+D+KKFL +IAGLWVLS++G+  NFLTLFY+  VLLHTVP++Y
Sbjct  152  RIEINCGFAVLRDIASGRDLKKFLIIIAGLWVLSILGSCCNFLTLFYITFVLLHTVPVIY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED++D FAEKA  EI KQYAV + K LSKIPK PLK KK+A
Sbjct  212  EKYEDRIDPFAEKATIEIKKQYAVFDAKVLSKIPKVPLKYKKMA  255



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL LVCH+LI  LAI FLWSNA+TFINK  P IP V LP++ +L +ASAL
Sbjct  100  WVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEVHLPEEPILEIASAL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN TL VLREIASG+D+ KFL+VIAGLWVLSV+GN  NFLTLFY+  VLLHTVP+LY
Sbjct  160  RIEINYTLRVLREIASGRDLTKFLSVIAGLWVLSVLGNCCNFLTLFYISFVLLHTVPVLY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD   EKA  EI KQYAV + K LSKIPKGPL+DKK A
Sbjct  220  EKYEDKVDPLVEKAVKEIKKQYAVFDAKVLSKIPKGPLRDKKKA  263



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LI+ALA+ FLWSNASTFINKSPP+IP V +P++ VL +ASAL
Sbjct  94   WVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   +LREIASG+D+KKFL+VIAGLWV+S++G+  NFLTLFY++ VLLHTVP++Y
Sbjct  154  RFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD+F+EKA AEI KQYAV + K LSKIP+  LKDKK A
Sbjct  214  EKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLL+LVCH LIL+LAI FLWSNA+TFINKSPP IP V +P+D  ++VA +L
Sbjct  90   WVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R +INR  AVLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY++ V LHTVP+LY
Sbjct  150  RYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+F EKA AEI K YA ++ K LSKIPKG LK+KK
Sbjct  210  EKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPKGALKEKK  251



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   244 bits (622),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTL+CH LI +LA+ FLW+NASTFINKSPP IP VILP+  +L   + L
Sbjct  122  WILFELLEYHLLTLICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGL  181

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+NR LA+L +IA GKD+KKFLAVIAGLW+LS++G S  F+TLFY+  VLLHT+P+LY
Sbjct  182  RHELNRGLAMLHDIAMGKDLKKFLAVIAGLWILSIVGKSCGFITLFYINFVLLHTIPILY  241

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAFAEKA AE  K Y V+NEKY+SKIP+GPLK+KK
Sbjct  242  EKYEDKVDAFAEKAMAEAKKHYGVINEKYISKIPRGPLKNKK  283



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLF+L+EYHLLTLVCH LI+ALA+ FLWSNASTFINKSPP+IP V +P++ VL +ASAL
Sbjct  94   WVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   +LREIASG+D+KKFL+VIAGLWV+S++G+  NFLTLFY++ VLLHTVP++Y
Sbjct  154  RFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD+F+EKA AEI KQYAV + K LSKIP+  LKDKK A
Sbjct  214  EKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ FLWS ASTFINKSPPQIP V +P+ TVL +ASAL
Sbjct  98   WVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASAL  157

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+   VLR+IASG+D+K FL VIA LW+LSV+G  FNFLTLFY+I VLLHT+P++Y
Sbjct  158  RIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIY  217

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQ+DAF EKA  EI KQYAV + K LSKIP+GP+K+KK
Sbjct  218  EKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPRGPVKEKK  259



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CH LIL+LA+ FLWSNASTFINKSPP+IP V +P++ VL VA AL
Sbjct  94   WVLFELIEYHLLTLICHGLILSLAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQVADAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EIN   AVLR+IASG+D+KKFL+VIAGLWVLS++G+  NFLTLFY++ VLL+TVP+ Y
Sbjct  154  RSEINWGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGSWVNFLTLFYIVFVLLYTVPVFY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+ AEKA  E+ KQYAVL+ K LSKIP+GPLKDKK
Sbjct  214  EKYEDKVDSLAEKALIELKKQYAVLDAKVLSKIPRGPLKDKK  255



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTLVCH LIL+LAI FLWSNASTFINKS P IP V +P+D  ++VA +L
Sbjct  90   WVLFELMEYHLLTLVCHCLILSLAILFLWSNASTFINKSSPHIPEVSIPEDVAVDVALSL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+++KKFL VIAGLWVLS++G   NFLTLFY++ V LHTVP+LY
Sbjct  150  RYEINRGFAVLRDIASGRELKKFLMVIAGLWVLSIIGTCCNFLTLFYIVFVTLHTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEK  AEI K YA  + K LSKIP+GPLK+KK
Sbjct  210  EKYEDKVDPFAEKVMAEIKKHYATFHAKCLSKIPRGPLKEKK  251



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LA+ FLWSNASTFINKSPP IP V +P+D  +N+A +L
Sbjct  91   WLLFEVMEYHLLTLVCHCLILSLAVLFLWSNASTFINKSPPNIPEVKIPEDLTVNIALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+++KKFL VIAGLW+LSV+G+S NFLTLFY++ V L+TVP+LY
Sbjct  151  RYEINRGFATLREIGHGRELKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDA  EKAE E+ K YA+  EK LSKIPKGPLKDKK
Sbjct  211  EKYEDKVDALGEKAEIELKKYYALFEEKCLSKIPKGPLKDKK  252



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFELMEYHL+TLVCHILI  LAI FLW++AST I KSPP IP V LP+  VL VAS L
Sbjct  92   WILFELMEYHLITLVCHILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E NR LA+LREIASG+++KKFLA IAGLWVLS++G+ FN +TLFY+  VLLHTVP+ Y
Sbjct  152  RFEANRGLALLREIASGRELKKFLAFIAGLWVLSMVGSWFNSVTLFYITFVLLHTVPVFY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD FAEKA  EI KQ+AV NEK LSK+P+GPLKDKK
Sbjct  212  EKYEDQVDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPLKDKK  253



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHL+TLVCHI IL+LA+ FLWSNASTFINKSPP+IP V LP+  VL  ASAL
Sbjct  90   WVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASAL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR LAVLREIASG+D+KKFL VIAGLW+LS++GN  NF+TLFY++ VLLHTVP++Y
Sbjct  150  RYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDK  280
            EKYED++D+F EKA  EI KQYAV +E    K LS+IPKG LK K
Sbjct  210  EKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHL+TLVCHI IL+LA+ FLWSNASTFINKSPP+IP V LP+  VL  ASAL
Sbjct  90   WVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASAL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR LAVLREIASG+D+KKFL VIAGLW+LS++GN  NF+TLFY++ VLLHTVP++Y
Sbjct  150  RYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDK  280
            EKYED++D+F EKA  EI KQYAV +E    K LS+IPKG LK K
Sbjct  210  EKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LIL+LAI FLWSNAS FINK+PP+I  V +P+D  +NVA +L
Sbjct  91   WVLFELLEYHLLTLVCHCLILSLAILFLWSNASIFINKAPPRILEVSIPKDLAVNVALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR +AVLREI SG+D+KKFLAVIAGLWVL V+G+  NF+TLFY++VV LHTVP+LY
Sbjct  151  RYEINRAIAVLREITSGQDLKKFLAVIAGLWVLLVLGSCCNFMTLFYIMVVTLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD+FAEKA  EI KQY V + K LSKIP+ PLKDKK
Sbjct  211  EKYEDKVDSFAEKAMTEIKKQYKVFDAKVLSKIPREPLKDKK  252



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV+FEL+ YHLLT VCH LIL+L I FLWS A TFINKSPP+IP V +P+D  + VA  L
Sbjct  90   WVMFELVGYHLLTFVCHGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+NR LAVLRE+A G+DVKKFL VIAGLW+LS++G+S NFLTL Y++ V LHTVP+LY
Sbjct  150  RYEMNRALAVLREVALGRDVKKFLTVIAGLWLLSMVGSSVNFLTLVYILFVTLHTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDA AEKA AEI KQYAVL++K LSKIP+GPLKDKK
Sbjct  210  EKYEDKVDAAAEKAMAEIKKQYAVLDDKVLSKIPRGPLKDKK  251



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELM+YHLLTL CHILI+ LA+ FLWSNAS FINKSPP+IP V +P++ +L +AS L
Sbjct  104  WVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFINKSPPKIPEVHIPEEHILQLASGL  163

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LR+IASG+D+KKFL+ IAGLWVLSV+G+  NFLTL Y+ +V+L TVP++Y
Sbjct  164  RIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSVIGSWCNFLTLSYIAMVMLFTVPVMY  223

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  EI KQYAVL+EK  SKIP+GPLKDKK
Sbjct  224  EKYEDKVDAFGEKAMVEIKKQYAVLDEKVFSKIPRGPLKDKK  265



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LIL+LAI FLWSNASTFINKSPP IP V + +D  +NVA +L
Sbjct  95   WLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFINKSPPNIPEVKISEDVAVNVALSL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G+D+KKFL VIAG W+LSV+G+  NFLTLFY++ V+L+TVP+LY
Sbjct  155  RYEINRGFATLREIGHGRDLKKFLIVIAGFWLLSVLGSCCNFLTLFYIVFVVLYTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  E+ K YA+ +EK LSKIPKGPLKDKK
Sbjct  215  EKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKGPLKDKK  256



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLL LVCH LIL+LAI FLWSNASTFI+KSPP+IP V +P+D  +NVA +L
Sbjct  89   WVLFELMEYHLLALVCHCLILSLAILFLWSNASTFIHKSPPRIPEVSIPEDVAVNVALSL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   VLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY+  V LHTVP+LY
Sbjct  149  RYEINRGFTVLRDIASGRDLKKFLVVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEK   E+ K YA  + K LSKIP+GPLK+KK
Sbjct  209  EKYEDKVDPFAEKVMTEVKKHYATFHAKCLSKIPRGPLKEKK  250



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFELMEYHLLTLVCH LIL+LAI FLWSNA+T INKSPP IP V +P+D  +N++ +L
Sbjct  88   WILFELMEYHLLTLVCHCLILSLAILFLWSNATTLINKSPPHIPVVSIPEDLAVNISRSL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EINR  +VLREIA+G+++KKFLAVIAGLW+LS++G+  NFLTLFY+  V LHTVP LY
Sbjct  148  TYEINRGFSVLREIATGRELKKFLAVIAGLWILSIIGSCCNFLTLFYIAFVTLHTVPFLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            +KYED+VD FAEKA  E  K YAV + K LSKIP+GPLKDKK 
Sbjct  208  DKYEDRVDTFAEKATVEFKKHYAVFHAKCLSKIPRGPLKDKKF  250



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYH LTL+CHI + ALA+ FLWSNAS FINKS P IP V +P+D V+ +ASAL
Sbjct  94   WILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEDPVIEIASAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EINR +AVLR+IASG+D+K FL  IAGLWVLS++G+ FNFLTL Y+ V++L TVP+ Y
Sbjct  154  RVEINRAIAVLRDIASGRDLKSFLYAIAGLWVLSILGSWFNFLTLLYIGVIVLFTVPVFY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKY+D+VDAFAEKA AEI KQY V + K LSKIP+GPLKDKK+A
Sbjct  214  EKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FELMEYHLLTL CH LIL+LAI FLWSNA+  INKSPP IP V +P++ V+++A +L
Sbjct  89   WIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLINKSPPHIPVVSIPENLVVDIALSL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIA+G+D+KKFL VIAGLWVLS +G   NFLTLFY++ V LHT+P LY
Sbjct  149  RYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            +KYED+VDAFAEKA  E  K YAV   KYLSKIP+GPLKDKK 
Sbjct  209  DKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGPLKDKKF  251



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+ ILAL++ FLWSNA+TFINK PP IP V LP+D  L VAS L
Sbjct  95   WVLFELLEYHLLTLVCHVSILALSLLFLWSNATTFINKRPPHIPEVRLPEDPFLEVASVL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIASG+D+KKFL V+ GLW LS++G+  NFLTLFY++ +LLHTVP+LY
Sbjct  155  RTEINRGFAVLREIASGRDLKKFLMVVVGLWALSIVGSFCNFLTLFYIVFILLHTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+D++DAFAEKA  +I KQYAV + K LSKIP+GPL  K+
Sbjct  215  EKYDDKIDAFAEKAMIQIKKQYAVFDAKVLSKIPRGPLGKKR  256



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL LVCH+LI  LAI FLWSNA+TFINK  P IP   L ++ +L +ASAL
Sbjct  100  WVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASAL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN  L VLREIASG+D+KKFLAVIAGLWVLS++GN  NFLTLFY+  VLLHTVP+LY
Sbjct  160  RIEINHILHVLREIASGRDLKKFLAVIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD  AEKA  EI KQYAV + + LSKIPKGPLKDKK A
Sbjct  220  EKYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIPKGPLKDKKKA  263



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASAL
Sbjct  88   WVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+N+   VLR+IASG+D+K FL VIA LW+LSV+G  FNFLTLFY+I VLLHT+P++Y
Sbjct  148  RIELNKGFYVLRBIASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQ+DAF EKA  EI KQYAV + K LSKIPKGP+K+KK
Sbjct  208  EKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|NP_001042463.1| Os01g0226300 [Oryza sativa Japonica Group]
 dbj|BAF04377.1| Os01g0226300, partial [Oryza sativa Japonica Group]
Length=178

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  16   WILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  75

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  76   RYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY  135

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAVL+ K LSK+P+GPLKDKK
Sbjct  136  EKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  177



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE++EYHLLTL+CH L++ALA  FLWSNASTFI+KS P IP V +P+  VL  ASAL
Sbjct  107  WVLFEVVEYHLLTLLCHGLMIALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASAL  166

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR LAVLREIASG+D+K FL VI GLW+ S++G   +FLTLFY+IVV+LHTVP+LY
Sbjct  167  RNEINRALAVLREIASGRDLKMFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLY  226

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  E+ KQYAVL+ K LSKIP+GPLKDKK
Sbjct  227  EKYEDQVDAFAEKALHELKKQYAVLDAKVLSKIPRGPLKDKK  268



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH LILALA+ FLWSNASTFINKSPP+IP V +P++ VL +A+AL
Sbjct  91   WVLFELLEYHLLTLVCHCLILALALLFLWSNASTFINKSPPRIPEVHIPEEPVLQIAAAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+  AVLR+IASG+D+KKFL VIAGLWVLS++G+  NF+TLFY+  VLLHTVP+ Y
Sbjct  151  RIEINQGFAVLRDIASGRDLKKFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  EI KQYAV + K LSKIP+GPLKDKK
Sbjct  211  EKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYH LTL+CHI + ALA+ FLWSNAS FINKS P IP V +P+  V+ +ASAL
Sbjct  94   WILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEGPVVEIASAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EINR +AVLREIASG+D+K FL  IAGLWVLS++G+ FNFLTL Y+ V++L TVP+ Y
Sbjct  154  RVEINRAIAVLREIASGRDLKSFLYAIAGLWVLSIVGSWFNFLTLLYIGVIVLFTVPLFY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKY+D+VDAFAEKA AEI KQY V + K LSKIP+GPLKDKK+A
Sbjct  214  EKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASAL
Sbjct  88   WVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+N+   VLR IASG+D+K FL VIA LW+LSV+G  FNFLTLFY+I VLLHT+P++Y
Sbjct  148  RIELNKGFYVLRNIASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQ+DAF EKA  EI KQYAV + K LSKIPKGP+K+KK
Sbjct  208  EKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY L+ LVCH+LI  LA+ FLWSNA+TFINK  P IP V LP++ +L +ASAL
Sbjct  92   WVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR L++LREIA+GKD+KKFLAV+AGLW+LSV+GN  NFLTLFY++ VLLHTVP+LY
Sbjct  152  SIEINRALSMLREIATGKDLKKFLAVVAGLWILSVVGNCCNFLTLFYILFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD  AEKA  EI KQYAV + + LSKIP GPLKDKK A
Sbjct  212  EKYEDKVDPLAEKAMQEIKKQYAVFDARVLSKIPIGPLKDKKNA  255



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ FLWSNASTFINKSPPQIP V L + TVL++ASAL
Sbjct  102  WVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASAL  161

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR   +LR+IASG+D+K FL VIA LW+LSV+G  FNFLTLFY+  VLLHT+P++Y
Sbjct  162  RIELNRAFHILRDIASGRDLKTFLGVIAILWILSVVGKWFNFLTLFYITFVLLHTLPVIY  221

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+ Q+DAF+EKA  E  KQYAV + K LSKIPKGPLK+KK
Sbjct  222  EKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPLKEKK  263



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE++EYHLLTLVCH LI+ LA+ FLWSNASTFINKSPP+IP V +P+  VL  AS  
Sbjct  89   WVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTFINKSPPRIPEVSVPEKPVLQFASDA  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+ IN+T A+LR++ASG+++KKFL+VIAGLW+ S++G+  +FLTL Y+  VLLHTVP++Y
Sbjct  149  RVAINQTFALLRDVASGRNLKKFLSVIAGLWIFSILGSCCDFLTLLYISAVLLHTVPVIY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYEDQVD+FAEKA AE+ KQYAV ++K LSKIP+GPLKDKK
Sbjct  209  DKYEDQVDSFAEKALAELKKQYAVFDKKVLSKIPRGPLKDKK  250



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHL+TLVCHI IL LAI FLWSNASTF+NKSPP+IP ++LP+  VL +ASAL
Sbjct  85   WVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKSPPEIPQIVLPEKYVLEIASAL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR LAVL +IA+G+DVK FL VIA LWVLS++G+ FNFLTL Y++ VLLHTVP+ Y
Sbjct  145  RIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSIIGSWFNFLTLLYIVFVLLHTVPLAY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D  AEKA  EI KQY V +EK LSKIP G LK+ K
Sbjct  205  EKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSKIPVGLLKELK  246



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS L
Sbjct  108  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGL  167

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL+ IAGLWVLS++G   +FLTL Y+ +VLL TVP+LY
Sbjct  168  RIEINRGFSSLREIASGRDLKKFLSAIAGLWVLSILGGCCSFLTLSYIALVLLFTVPLLY  227

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+ KQYAVL+ K LSKIP+GPLKDKK
Sbjct  228  DKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPLKDKK  269



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 144/179 (80%), Gaps = 6/179 (3%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLL+LVCH LIL+LAI FLWSNA+TFINKSPP IP V +P+D  ++VA +L
Sbjct  90   WVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R +INR  AVLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY++ V LHTVP+LY
Sbjct  150  RYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA**ERWCFTLKFLSRC  226
            EKYED+VD+F EKA AEI K YA ++ K LSKIPKG LK +      R+C   +F++ C
Sbjct  210  EKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPKGALKRRSSC---RFC---QFVASC  262



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS L
Sbjct  108  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGL  167

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR ++ LREIASG+D+KKFL+ IAGLWVLS++G  ++FLTL Y+ +VLL TVP+ Y
Sbjct  168  RIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFY  227

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+ KQYAVL+ K  SKIP+GPLKDKK
Sbjct  228  DKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPRGPLKDKK  269



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+M+YHLLTL+CH +IL LA+ FLWSNASTFINKSPP IP V +P+D  +NVA +L
Sbjct  89   WLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL V+ GLWVLSV+G+  NFLTLFY++ ++L+TVP+LY
Sbjct  149  RFEINRGFATLREIGQGHDLKKFLIVVVGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+DAF EKA  E+ K YA+ +EK LSKIPKGPLK+KK
Sbjct  209  EKYEDQIDAFGEKAMIELKKYYAIFDEKCLSKIPKGPLKNKK  250



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE++EYHLLTL+CH L++ALA  FLWSNASTFI+KS P IP V +P+  VL  ASAL
Sbjct  107  WVLFEVVEYHLLTLLCHGLMVALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLAFASAL  166

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR LAVLREIASG+D+K FL VI GLW+ S++G   +FLTLFY+IVV+LHTVP+LY
Sbjct  167  RNEINRALAVLREIASGRDLKTFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLY  226

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  E+ KQYAV + K LSKIP+GPLKDKK
Sbjct  227  EKYEDQVDAFAEKALHELKKQYAVFDAKVLSKIPRGPLKDKK  268



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLF+LMEYHLL LVCH LIL+LAI FLWSNA+TFINKSPP+IP V +P+D  ++ A +L
Sbjct  89   WVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY+  V LHT+P+LY
Sbjct  149  RYEINRGFAVLRDIASGRDLKKFLMVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED+VD+FAEKA  ++ K YA  N K LSKIP+GPLK K
Sbjct  209  EKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  249



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+ I +LA+ FLWSNAS F+NKSPP+IP V+LP+  V  VAS L
Sbjct  100  WVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVL +IASG+D+KKFLAVIAGL VLS++G+  NFLTL Y+  VLLHTVP+LY
Sbjct  160  RIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD  +EKA  +I KQYAVL+EKY+SKIP+GP K+KK
Sbjct  220  EKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPFKEKK  261



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+ I +LA+ FLWSNAS F+NKSPP+IP V+LP+  V  VAS L
Sbjct  91   WVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVL +IASG+D+KKFLAVIAGL VLS++G+  NFLTL Y+  VLLHTVP+LY
Sbjct  151  RIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD  +EKA  +I KQYAVL+EKY+SKIP+GP K+KK
Sbjct  211  EKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPFKEKK  252



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  112  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L+ LREIASG+D+KKFL  I GLWVLS+MG  FNFLTL Y+ +VLL TVP++Y
Sbjct  172  RIEINRGLSSLREIASGRDLKKFLCAIVGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  232  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  273



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LIL+LA+ FLWSNASTFINKSPPQIP V L + TVL++ASAL
Sbjct  96   WVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASAL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR   +LR+IASG+D+K FL VIA LW++S++G  FNFLTLFY+  VLLHT+P++Y
Sbjct  156  RIELNRAFHILRDIASGRDLKMFLGVIAVLWIVSLVGKWFNFLTLFYITFVLLHTLPVIY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+ Q+DAF+EKA  E  KQYAV + K LSKIPKGPLK+KK
Sbjct  216  EKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPLKEKK  257



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL EYHLLTL+CH+LI  +A+ FLWSNAS FI+KSPP+IP V +P++ +L +AS L
Sbjct  104  WVLFELAEYHLLTLLCHVLIAVIAVLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGL  163

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LR+IASG+D+KKFL+ IAGLWVLS++G   NFLTL Y+ +V+L T+P+LY
Sbjct  164  RIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSILGGCCNFLTLSYIAMVMLFTIPVLY  223

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDA+ EKA  EI KQYAVL+EK LSKIP+GPLK KK
Sbjct  224  EKYEDKVDAYGEKAMVEIKKQYAVLDEKVLSKIPRGPLKGKK  265



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  113  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L+ LREIASG+D+KKFL  I GLWVLS+MG  FNFLTL Y+ +VLL TVP++Y
Sbjct  173  RIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVY  232

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  233  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  113  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L+ LREIASG+D+KKFL  I GLWVLS+MG  FNFLTL Y+ +VLL TVP++Y
Sbjct  173  RIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVY  232

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  233  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH+LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L
Sbjct  99   WILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EIN+ +A LREIASG+D+KKFL V+A  WV S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  159  SSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV +EK LSKIP+GPLKDKK
Sbjct  219  EKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH+LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L
Sbjct  99   WILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EIN+ +A LREIASG+D+KKFL V+A  WV S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  159  SSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV +EK LSKIP+GPLKDKK
Sbjct  219  EKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH+LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L
Sbjct  99   WILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EIN+ +A LREIASG+D+KKFL V+A  WV S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  159  SSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV +EK LSKIP+GPLKDKK
Sbjct  219  EKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  112  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL+ +AGLWVLSV+G  FNFLTL Y+ +VLL TVP++Y
Sbjct  172  RIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  232  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  117  WILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  176

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  177  RYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY  236

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAVL+ K LSK+P+GPLKDKK
Sbjct  237  EKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  278



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  112  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL+ +AGLWVLSV+G  FNFLTL Y+ +VLL TVP++Y
Sbjct  172  RIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  232  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY L+ LVCH+LI  LA+ FLWSNA+TFINK  P IP V LP++ +L +ASAL
Sbjct  100  WVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASAL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR L++LREIA+GKD KKFLAV+ GLW+LSV+GN  NFLTLFY++ VLLHTVP+LY
Sbjct  160  SIEINRALSMLREIATGKDPKKFLAVVTGLWILSVVGNCCNFLTLFYILFVLLHTVPVLY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD  AEKA  EI KQYA+ + K LSKIP GPLKDKK A
Sbjct  220  EKYEDKVDPLAEKAVQEIKKQYAIFDAKVLSKIPIGPLKDKKNA  263



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+ YHLLTL+ H LIL LA+ FLWSNASTFINKSPP+IP V +P+  VL +ASA+
Sbjct  95   WVFFELLGYHLLTLMAHCLILVLAMLFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAI  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR   +LREIASGKD+K+FL+VIAGLWVLS++G  +NFLTL Y++VVLL T+P+ Y
Sbjct  155  TIEINRAFVILREIASGKDLKQFLSVIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQVDAFAEKA  EI KQYAV + K LSK+PKG +KDKK
Sbjct  215  EKYDDQVDAFAEKAMIEIKKQYAVFDAKVLSKVPKGQMKDKK  256



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE++EYH LTL+CH LI+ALA  FLWSNAS FI+KS P IP V +P+  VL  A+ L
Sbjct  34   WVLFEVVEYHFLTLLCHCLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGL  93

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIA+G+D+K FL VI GLW+LSV+G+  +FL+LFY+IVV+LHTVP+LY
Sbjct  94   RNEINRAFAVLREIAAGRDLKMFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLY  153

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYEDQ+D+FAEKA  E+ KQYAV + K LSKIP+GPL+DKK A
Sbjct  154  EKYEDQIDSFAEKAFHELKKQYAVFDAKVLSKIPRGPLRDKKKA  197



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL CHILIL+LA+ FLWSNA TFINK+PP+IP + LP++  L VASAL
Sbjct  92   WVLFELIEYHLLTLACHILILSLAVLFLWSNAHTFINKTPPRIPQIHLPEEPFLLVASAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EINR LAVLR+IASGKD+KKFL VIA LWV+S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  152  TLEINRGLAVLRDIASGKDLKKFLIVIAALWVVSIVGSWCNFLTLFYISFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  EI KQYAV + K LSKIP G LK K++
Sbjct  212  EKYEDKVDPFAEKATIEIKKQYAVFDAKVLSKIPVGALKAKRV  254



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHLLTLVC+ LI++LAI FLWSNA TFI+KSPP+IP V +P+D  L V SAL
Sbjct  92   WVFFELLEYHLLTLVCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEIN+  A LR IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY+ VVLLHTVP+LY
Sbjct  152  TIEINQGFAALRSIASGRDLKKFLIVIAGLWVLSIVGSWANFLTLFYISVVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED++D  AEKA  E+ KQY V +EK LSKIPKGPLK KK A
Sbjct  212  EKYEDKIDPLAEKALIELKKQYTVFDEKVLSKIPKGPLKGKKRA  255



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFIN-KSPPQIPSVILPQDTVLNVASA  586
            W+ FELMEYHLLTL CH LIL+LAI FLWSNA+  IN +SPP IP V +P++ V+++A +
Sbjct  89   WIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLINNRSPPHIPVVSIPENLVVDIALS  148

Query  585  LRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPML  406
            LR EINR  AVLREIA+G+D+KKFL VIAGLWVLS +G   NFLTLFY++ V LHT+P L
Sbjct  149  LRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFL  208

Query  405  YEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            Y+KYED+VDAFAEKA  E  K YAV   KYLSKIP+GPLKDKK 
Sbjct  209  YDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGPLKDKKF  252



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVC++ I +LA+ FLWSNAS F+NKSPP+IP V+LP+  V  VAS L
Sbjct  91   WVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKCVREVASGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR +AVL +IASG+D+KKFLAVIAGL VLS++G+  NFLTL Y+  VLLHTVP+LY
Sbjct  151  RIEINRGVAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD  +EK+  +I KQYA+L+EKYLSKIP+GP K+KK
Sbjct  211  EKYEDQVDGCSEKSWIQIKKQYALLDEKYLSKIPRGPFKEKK  252



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+M+YHLLTL+CH +IL LA+ FLWSNASTFINKSPP IP V +P+D  +NVA ++
Sbjct  89   WLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSV  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL V+AGLWVLSV+G+  NFLTLFY++ ++L+TVP+LY
Sbjct  149  RFEINRGFATLREIGLGHDLKKFLIVVAGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+DAF EKA  E+ K YA+ +EK LSKIPKGP K+KK
Sbjct  209  EKYEDQIDAFGEKAVIELKKYYAIFDEKCLSKIPKGPSKNKK  250



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  117  WILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  176

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  177  RYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY  236

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAV + K LSK+P+GPLKDKK
Sbjct  237  EKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPLKDKK  278



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL LVCH+LI  LAI FLWSNA+TFINK  P IP   L ++ +L +ASAL
Sbjct  100  WVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASAL  159

Query  582  RIEINRTLAVLREIASGKDVKKFLA----VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTV  415
            RIEIN  L VLREIASG+D+KKFLA    VIAGLWVLS++GN  NFLTLFY+  VLLHTV
Sbjct  160  RIEINHILHVLREIASGRDLKKFLAVNCSVIAGLWVLSMLGNCCNFLTLFYISFVLLHTV  219

Query  414  PMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            P+LYEKYED+VD  AEKA  EI KQYAV + + LSKIPKGPLKDKK A
Sbjct  220  PVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIPKGPLKDKKKA  267



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFEL EYHLLTL  H LIL LA+ FLWSNA  FI+KSPP+IP V +P++ VL  ASAL
Sbjct  92   WALFELAEYHLLTLAAHCLILTLAVLFLWSNAHAFIHKSPPRIPEVSIPEEPVLQFASAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EIN+  AVLR+IASGKD+KKFL VIAGLW+LS+ GN  NFLTLFY++ VLLHTVP+LY
Sbjct  152  RLEINQAFAVLRDIASGKDLKKFLLVIAGLWLLSIAGNWCNFLTLFYIVFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EK+ED++D FAE+A  E+ KQYAV + K LSKIP GPLKDKK A
Sbjct  212  EKFEDKIDPFAERAMGELKKQYAVFDAKVLSKIPLGPLKDKKKA  255



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH+LI  LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASAL
Sbjct  101  WVFFELLEYHLITLVCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASAL  160

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+N+   VLR+IASG+D+K FL V+A LW+LSV+G  FNFLTLFY++ VLLHT+P++Y
Sbjct  161  RIELNKGFYVLRDIASGRDLKAFLGVVAVLWILSVVGKWFNFLTLFYILFVLLHTLPVIY  220

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQ+DAF EKA  EI KQYAV + K LSKIPKGP+K+KK
Sbjct  221  EKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  262



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLF+++EYHLLTLVCH LI+ LA+ FLWS+  TFINKSPP+IP V +P++  L  ASAL
Sbjct  85   WVLFDVLEYHLLTLVCHGLIVGLALLFLWSSIMTFINKSPPRIPEVSIPEEPALKFASAL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EIN   AVLR+IASG+D+KKFL+V+AGLW+LSV+G   +FLTL Y I VLL TVP+ Y
Sbjct  145  RVEINHGFAVLRDIASGRDLKKFLSVVAGLWILSVVGGCCDFLTLLYTITVLLFTVPLFY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD+FAEKA AE+ KQY V + + LSKIP+GPLKDKK
Sbjct  205  EKYEDQVDSFAEKAMAEVKKQYVVFDARVLSKIPRGPLKDKK  246



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  111  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  170

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL  IAGLWVLS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  171  RIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAY  230

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  231  DKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  272



>gb|KCW46475.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=158

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -1

Query  744  MEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINR  565
            MEYHL+TLVCHILI  LAI FLW++AST I KSPP IP V LP+  VL VAS LR E NR
Sbjct  1    MEYHLITLVCHILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANR  60

Query  564  TLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQ  385
             LA+LREIASG+++KKFLA IAGLWVLS++G+ FN +TLFY+  VLLHTVP+ YEKYEDQ
Sbjct  61   GLALLREIASGRELKKFLAFIAGLWVLSMVGSWFNSVTLFYITFVLLHTVPVFYEKYEDQ  120

Query  384  VDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            VD FAEKA  EI KQ+AV NEK LSK+P+GPLKDKK
Sbjct  121  VDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPLKDKK  156



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTL+CH  IL L I FLWSNAS FINKSPP IP V +P+D  +NVA +L
Sbjct  82   WLLFEVMEYHLLTLLCHCFILTLGILFLWSNASAFINKSPPNIPEVRIPEDLAVNVARSL  141

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+I  G+D+KKFL VIAGLW LS +G+S NFLTLFY++ ++L+TVP+LY
Sbjct  142  RYEINRGFASLRDIGQGRDLKKFLIVIAGLWTLSALGSSCNFLTLFYIVFMVLYTVPVLY  201

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++DA+ EKA  E+ K YA+ +EK LSKIPKGP KDKK
Sbjct  202  EKYEDKIDAYGEKAMIELKKYYAIFDEKCLSKIPKGPSKDKK  243



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  107  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  166

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EINR  + LREIASG+D+KKFL  IAGLWV+S++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  167  RVEINRGFSSLREIASGRDLKKFLTAIAGLWVMSILGGWFNFLTLAYIALVLLFTVPLAY  226

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  227  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  268



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV+FELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  109  WVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  168

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL  IAGLWVLS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  169  RIEINRGFSTLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAY  228

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  229  DKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  270



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCH+LILALA+ FLWSNASTFINKSPP++P V +P+D VL VA+AL
Sbjct  94   WILFELVEYHLLTLVCHLLILALALLFLWSNASTFINKSPPRLPDVYIPEDPVLQVAAAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR LA+LREIASG+D+KKFL+VIAGLWVLSV GN FNFLTLFY   VLL TVP++Y
Sbjct  154  RIEINRGLAILREIASGRDLKKFLSVIAGLWVLSVAGNLFNFLTLFYTAFVLLFTVPVIY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK  286
            EKYED+VD FAEKA  EI KQY V + K LSK+P+GPLK
Sbjct  214  EKYEDKVDPFAEKAIIEIKKQYKVFDAKVLSKLPRGPLK  252



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FE +EYHL+TL CHI+IL LA+ FLWSN S+FINK+PP+IP V +P+  VL++ASAL
Sbjct  112  WIFFECLEYHLITLFCHIMILFLAVFFLWSNGSSFINKAPPEIPKVQIPEKCVLDIASAL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+N+   VLREIASG+D+K FL VIA LW++SV+G  F+FLTLFYL  VLLH+ P++Y
Sbjct  172  RIELNKGFHVLREIASGRDLKTFLGVIAVLWIVSVIGKCFSFLTLFYLTFVLLHSAPLIY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+EDQ+DA AEKA  E  KQYAV NEK LSKIPKGP+K+KK
Sbjct  232  EKHEDQIDAVAEKAWIEFKKQYAVFNEKVLSKIPKGPVKEKK  273



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV+FELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  112  WVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKFL  IAGLWVLS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  172  RIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  232  DKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKK  273



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILILALAI FLWSNA+TFINKSPP+IP V L ++  L VA+A+
Sbjct  100  WVLFELLEYHLLTLVCHILILALAILFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAV  159

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR LAVLREIASG+D+KKFLAV++GLW  S++G+  NFLTLFY+  VLLHT+P+LY
Sbjct  160  RFEINRALAVLREIASGRDLKKFLAVVSGLWFFSILGSYCNFLTLFYITFVLLHTLPVLY  219

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED+VD+FAEKA  EI K+YAV +EK LSKIP+GP KDKK A
Sbjct  220  EKYEDKVDSFAEKAMIEIRKKYAVFDEKVLSKIPRGPSKDKKRA  263



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  105  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  164

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+EINR  + LREIASG+D+KKFLA IAGLW +S++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  165  RVEINRGFSSLREIASGRDLKKFLAAIAGLWFVSILGGWFNFLTLAYIALVLLFTVPLAY  224

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  225  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  266



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE++EYH LTL+CH LI+ALA  FLWSNAS FI+KS P IP V +P+  VL  A+ L
Sbjct  105  WVLFEVVEYHFLTLLCHGLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGL  164

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLREIA+G+D+K FL VI GLW+LSV+G+  +FL+LFY+IVV+LHTVP+LY
Sbjct  165  RNEINRAFAVLREIAAGRDLKTFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLY  224

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYEDQ+D+FAEKA  E+ KQYAV + K LSKIP+GPL+DKK A
Sbjct  225  EKYEDQIDSFAEKALHELKKQYAVFDAKVLSKIPRGPLRDKKKA  268



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TF+NKSPP+IP V +P+D V+  A AL
Sbjct  87   WILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSPPRIPEVQIPKDPVMEFAQAL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFL+VIAGLW+LS++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  147  RFEINRAFAVLRDIASGRDLKKFLSVIAGLWILSIVGSWCNFLTLFYIVFVLLHTVPVLY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV + K L KIP+GPLK+KK
Sbjct  207  EKYEDKVDPFAEKAMHEIKKQYAVFDAKVLRKIPRGPLKEKK  248



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FI+KSPP+IP V +P++ VL +AS L
Sbjct  111  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGL  170

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LREIASG+D+KKF++ IAGLWVLS++G  FNFLTL Y+ +VLL TVP++Y
Sbjct  171  RIEINRGFYSLREIASGRDLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVY  230

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  231  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  272



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI AL + FLWSNAS+FI+K+PP+IP VI+P+D V+N+A + 
Sbjct  121  WILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALST  180

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAG W+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  181  RYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLY  240

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK  AEI KQYAV +EK LSK+P+GP KDKK
Sbjct  241  EKYEDQIDSYGEKGWAEIKKQYAVFDEKVLSKVPRGPAKDKK  282



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+L+TLVCH LILALA+ FLWSNASTFINKSPP+IP V +P++ VL  A+AL
Sbjct  91   WVLFELLEYNLVTLVCHCLILALALLFLWSNASTFINKSPPRIPEVCIPEEPVLQTAAAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+  +VLR+IASG+D+K FL VIAGLWVLS++G+  NF+TLFY+  VLLHTVP+ Y
Sbjct  151  RIEINQGFSVLRDIASGRDLKNFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  EI KQYAV + K LSKIP+GPLKDKK
Sbjct  211  EKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_009109295.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=269

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FI+KSPP+IP V +P++ VL +AS L
Sbjct  106  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGL  165

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LREIASG+D+KKF++ +AGLWVLS++G  FNFLTL Y+ +VLL TVP++Y
Sbjct  166  RIEINRGFHSLREIASGRDLKKFISAVAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVY  225

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  226  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  267



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LI++LAI FLWSNAS+FINKSPP IP V +P+D  +NVA  L
Sbjct  47   WLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTL  106

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL VIAGLW+ SV+G+  NFLTLFY++ V L+T+P+LY
Sbjct  107  RYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLY  166

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  E+ K YA+ +EK LSKIPKG LKDKK
Sbjct  167  EKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-LKDKK  207



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI +L + FLWSNAS+FINKS P+IP V++P+D V+N+A + 
Sbjct  87   WILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSSPRIPEVVIPEDLVVNIALST  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  147  RYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLLYIVFVVLHTVPILY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAV + K LSK+P+GPLKDKK
Sbjct  207  EKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPLKDKK  248



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P+D +L +AS L
Sbjct  104  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGL  163

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ + GLW+LS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  164  RIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVY  223

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+ KQYAVL+ K LSKIP+GPLKDKK
Sbjct  224  DKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPLKDKK  265



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLF+L+EYHLL LVCH LIL L   FL+SNASTFI KSPP+IP V +P++ VLN ASAL
Sbjct  91   WVLFDLLEYHLLALVCHGLILGLVGLFLYSNASTFIKKSPPKIPVVSIPEEPVLNFASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RI IN   A LR+IASGKD+KKFL+VIAGLWVLS  G+  +FLTL Y I VLL TVP++Y
Sbjct  151  RIGINEGFATLRDIASGKDLKKFLSVIAGLWVLSFFGSCCDFLTLLYSITVLLFTVPLVY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYEDQVD FAEKA  EI KQYAV N K LSKIP+GPLK+KK
Sbjct  211  DKYEDQVDCFAEKAMVEIKKQYAVFNTKVLSKIPRGPLKEKK  252



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSN + FI+KSPP+IP V +P++ VL +AS L
Sbjct  113  WVLFELMEYHLLTLLCHVMIVVLAVLFLWSNVTRFIHKSPPKIPQVHIPEEPVLQLASGL  172

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+D+KKF++ IAGLWVLS++G  FNFLTL Y+ +VLL TVP++Y
Sbjct  173  RIEINRGFSSLREIASGRDLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVY  232

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  EI KQYAVL+EK LSKIP GPLK+KK
Sbjct  233  DKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE + YHLLT VCH LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  116  WILFECLGYHLLTFVCHGLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  175

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR    LR+IA G+D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  176  RYEINRAFVNLRQIALGRDIKKFLMVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPVLY  235

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAV +EK LSK+P+GP KDKK
Sbjct  236  EKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  277



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLVCH LI++LAI FLWSNAS+FINKSPP IP V +P+D  +NVA  L
Sbjct  92   WLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL VIAGLW+ SV+G+  NFLTLFY++ V L+T+P+LY
Sbjct  152  RYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  E+ K YA+ +EK LSKIPKG LKDKK
Sbjct  212  EKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-LKDKK  252



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+LVCH  ILALA+ FLWSNASTFI+K+PP+IP V +P++ VL +AS L
Sbjct  93   WVLFELLEYHLLSLVCHSSILALAVLFLWSNASTFIHKTPPRIPEVHIPEEHVLQLASGL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IASG+D+KKFL VIAGLWVLS++G+  NF+TLFY+  VLL T+P+LY
Sbjct  153  RTEINRGFAALRDIASGRDLKKFLMVIAGLWVLSILGSCCNFVTLFYIATVLLFTIPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYED+VDAF EKA  EI KQY VL+EK L    SKIP+G L  KK
Sbjct  213  EKYEDKVDAFGEKAMKEIKKQYEVLDEKVLSKIMSKIPRGALSKKK  258



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L + S L
Sbjct  108  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLVSGL  167

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN   + LREIASG+D+KKFL+ IAGLWVLS++G   +FLTL Y+ +VLL TVP+ Y
Sbjct  168  RIEINCGFSSLREIASGRDLKKFLSAIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLFY  227

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VDA+ EKA AE+ KQYAV + K LSKIP+GPLKDKK
Sbjct  228  DKYEDKVDAYGEKAMAELKKQYAVFDAKVLSKIPRGPLKDKK  269



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH  I ALA+ FLWSNASTFI+K+PP+IP V +P++ V+ +AS L
Sbjct  93   WVLFELLEYHLLTLVCHSSIFALAVLFLWSNASTFIHKTPPRIPHVHIPEEPVIQLASGL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+NR    LR+IASG+D+KKFL VI+GLWVLS++G+  NF+TLFY+  VLL TVP+LY
Sbjct  153  RFEVNRGFTALRDIASGRDLKKFLVVISGLWVLSILGSCCNFVTLFYIATVLLFTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYEDQVDAF EKA  EI KQYAVL+EK L    SKIP+G L  KK
Sbjct  213  EKYEDQVDAFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGALTKKK  258



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLL  +CH LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+NVA + 
Sbjct  124  WILFELLGYHLLAFLCHGLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNVALST  183

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREIA G+D+KKFL VIAGLW+LS++G+  NFLTL Y++ V+LHTVP+LY
Sbjct  184  RHEINRAFANLREIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLVYIVFVVLHTVPVLY  243

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   E+ KQY+V + K LSK+P+GPLKDKK
Sbjct  244  EKYEDQIDSYGEKGWVEVKKQYSVFDAKVLSKVPRGPLKDKK  285



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI AL + FLWSNAS+FI+K+PP+IP VI+P+D V+N+A + 
Sbjct  121  WILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALST  180

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAG W+LSV+G+  NFLTL Y++ V+LHTVP+LY
Sbjct  181  RYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLY  240

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D++ EK   EI KQYAV +EK LSK+P+GP KDKK
Sbjct  241  EKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  282



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  113  WVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+++KKFL  I GLW+LS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  173  RIEINRGFSTLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAY  232

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  233  DKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHLLTL+CH  IL L I FLWSNAS F+NK PP IP V +P+D  +NVA +L
Sbjct  94   WLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR I  G+D+KKFL V+AGLW+LS +G+S NFLTLFY++ ++L+TVP+LY
Sbjct  154  RYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSALGSSCNFLTLFYIVFMVLYTVPVLY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++DAF EKA  E+ K YA+ +EK LSKIPKGP KDKK
Sbjct  214  EKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  255



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+ YHL+TLVC++ I  LA+ FLWSN S F+NK PP+IP V+LP+  V  VASAL
Sbjct  88   WVLFELLGYHLITLVCYLSIFFLAVLFLWSNTSDFLNKPPPKIPEVVLPEQCVREVASAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVL +IASG+D+KK LAVIAGLWVLS++G+  N LTL Y+  VLLHTVP+LY
Sbjct  148  RIEINRGFAVLHDIASGRDLKKVLAVIAGLWVLSLIGSCINILTLLYISFVLLHTVPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDA++EK   EI KQYAV +EKYLSKIPKG LK +K
Sbjct  208  EKYEDQVDAYSEKTWIEIKKQYAVFDEKYLSKIPKGALKGEK  249



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+M+YHLLTL+CH +IL LAI FLWSNASTFINKSPP IP V +P+D  +NVA +L
Sbjct  85   WLLFEVMDYHLLTLLCHCVILTLAILFLWSNASTFINKSPPNIPEVRIPEDLAVNVARSL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL V+AGLW+LSV+G+  NFLTLFY++ + L+TVP+LY
Sbjct  145  RFEINRGFATLREIGQGHDLKKFLIVVAGLWILSVLGSCCNFLTLFYIVFMALYTVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+D++DAF EKA  E+ K  A+ +EK L+KIPKGP K+KK
Sbjct  205  EKYDDKIDAFGEKAMIELKKYCAIFDEKCLAKIPKGPSKNKK  246



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS L
Sbjct  113  WVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+++KKFL  I GLW+LS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  173  RIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAY  232

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  233  DKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL EYHLLTLV H+LIL +A  FLWSNASTFINKSPP IP V +P+  VL +AS +
Sbjct  96   WVFFELFEYHLLTLVSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASVI  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EINR   +LREIASGKD+K+FL+VIAGLWV+S++G  +NFLTL Y++VVLL T+P+ Y
Sbjct  156  TMEINRAFVILREIASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIVVVLLFTLPVFY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKY+DQVDA AEKA  EI KQYAV + K +SKIP+G LKDKK 
Sbjct  216  EKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP + +P++ +L +AS L
Sbjct  112  WVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGL  171

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LREIASG+++KKFL  I GLW+LS++G  FNFLTL Y+ +VLL TVP+ Y
Sbjct  172  RIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAY  231

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD   EKA  E+ KQYAVL+EK LSKIP GPLK+KK
Sbjct  232  DKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  273



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLVCHI IL LAI FLWSNA TFINK+PP+IP V +P++ VL VASAL
Sbjct  91   WILFELIEYHLLTLVCHISILTLAILFLWSNAHTFINKTPPRIPQVHIPEEPVLQVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EIN   AVLR IASGKD+KKFL VIA  W LS++G   NFLTLFY+  VLLHTVP+LY
Sbjct  151  TMEINHGFAVLRSIASGKDLKKFLVVIAAFWALSIVGCWCNFLTLFYITFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  EI KQYA+ + K LSKIP G LK K++
Sbjct  211  EKYEDKVDPFAEKAMIEIKKQYAMFDAKVLSKIPVGALKAKRV  253



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP + +P+D +L +AS L
Sbjct  105  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEIHIPEDPLLQLASGL  164

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ I GLWVLS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  165  RIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIY  224

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED++D + EKA AE+ KQYAV + K LSKIP+GPLK+KK
Sbjct  225  DKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  266



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLL LVCH LIL+LA  FLWSNA TFINKSPP IP V +P+D  +N+A +L
Sbjct  95   WLLFEVMEYHLLNLVCHCLILSLATLFLWSNACTFINKSPPNIPEVKIPEDLTVNIALSL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  + LR+I  G+D+KKFL VIA LWVLSV+GN  NFLTL Y++ V+L+TVP+LY
Sbjct  155  RYEINRGFSTLRDIGHGRDLKKFLIVIASLWVLSVLGNCCNFLTLSYIVFVVLYTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  E+ K YA+  EK LSKIPKG LK+KK
Sbjct  215  EKYEDKVDAFGEKAMIELKKYYAIFEEKCLSKIPKGHLKNKK  256



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLLT VCH LI +L + FLWSNAS+FI+KSPP+IP V++P+D V+N+A + 
Sbjct  117  WILFELLGYHLLTFVCHGLIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVST  176

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR IA G+D+KKFL VIAGLW+LSV+G+  N LTL Y++ V+LHTVP+LY
Sbjct  177  RYEINRAFANLRRIALGRDIKKFLMVIAGLWLLSVLGSCCNLLTLVYIVFVVLHTVPVLY  236

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D + EK   EI KQYAV +EK LSK+P+GP KDKK
Sbjct  237  EKYEDQIDTYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  278



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHLLTL+CH  IL L I FLWSNAS F+NK PP IP V +P+D  +NVA +L
Sbjct  62   WLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSL  121

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR I  G+D+KKFL V+AGLW+LS +G+  NFLTLFY++ ++L+TVP+LY
Sbjct  122  RYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLY  181

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++DAF EKA  E+ K YA+ +EK LSKIPKGP KDKK
Sbjct  182  EKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  223



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL EYHLLTLV H+LIL +A  FLWSNASTFINKSPP IP V +P+  VL +AS +
Sbjct  96   WVFFELFEYHLLTLVSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKLVLQIASVI  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EINR   +LREIASGKD+K+FL+VIAGLWV+S++G  +NFLTL Y+ VVLL T+P+ Y
Sbjct  156  TLEINRAFVILREIASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIAVVLLFTLPVFY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKY+DQVDA AEKA  EI KQYAV + K +SKIP+G LKDKK 
Sbjct  216  EKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE++EYHLLTL+CH  IL L I FLWSNAS F+NK PP IP V +P+D  +NVA +L
Sbjct  85   WLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR I  G+D+KKFL V+AGLW+LS +G+  NFLTLFY++ ++L+TVP+LY
Sbjct  145  RYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++DAF EKA  E+ K YA+ +EK LSKIPKGP KDKK
Sbjct  205  EKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  246



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS L
Sbjct  102  WVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGL  161

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ I GLWVLS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  162  RIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIY  221

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED++D + EKA AE+ KQYAV + K LSKIP+GPLK+KK
Sbjct  222  DKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  263



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHI IL LA+ FLWSNA TFI+KSPP+IP + LP++  L VASAL
Sbjct  93   WVLFELIEYHLLTLICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IE+N+ L +LR+IASG+++K+FL VIA  WVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  153  AIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  E+ KQYAV + K LSKIP GPLK KK+
Sbjct  213  EKYEDKVDPFAEKAAIEVKKQYAVFDAKVLSKIPMGPLKAKKV  255



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS--PPQIPSVILPQDTVLNVAS  589
            WVLFEL+EYH LTLVCH LIL+L++ FLWSNA+TFINKS  PP+IP V +P+D VL  AS
Sbjct  90   WVLFELLEYHFLTLVCHCLILSLSLLFLWSNATTFINKSQSPPRIPEVYIPEDPVLQFAS  149

Query  588  ALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPM  409
            ALRIEIN   +VLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY++ VLLHTVP+
Sbjct  150  ALRIEINSGFSVLRDIASGRDLKKFLVVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPV  209

Query  408  LYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
             YEKYED+VD+FAEKA AEI KQY V + K LSKIP+GPLKDKK A
Sbjct  210  FYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKRA  255



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL L+CHI IL LA+ FLWSNA TFI+KSPP+IP + LP++  L VASAL
Sbjct  93   WVLFELIEYHLLALICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IE+N+ L +LR+IASG+++K+FL VIA  WVLS++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  153  AIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  EI KQYAV + K LSKIP GPLK KK+
Sbjct  213  EKYEDKVDPFAEKAAIEIKKQYAVFDAKVLSKIPMGPLKAKKV  255



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY L+TLVCHILI+ LAI FLWS A+TFINK+PPQIP V LP+D +L V ++L
Sbjct  87   WILFELLEYQLITLVCHILIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR ++ LR++ASG+D++KFL+   GLW+LS+ G+  NFLTL Y+  +LLHTVP+LY
Sbjct  147  RIEINRIISTLRDVASGRDLRKFLSAFLGLWILSIAGSWCNFLTLLYMCFILLHTVPVLY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD FAEKA  E+ KQYA  + K LSKIP GPL++KK
Sbjct  207  EKYEDQVDPFAEKALIELKKQYAEFDAKVLSKIPLGPLQEKK  248



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL EYHLL  +CH  I ALA  FLWSNA TFI+K+ P IP V +P+D VL + S L
Sbjct  91   WVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKASPHIPEVNIPEDPVLQLVSGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L VLR IASGKDVKKF+ VIAGLWVLS++G+ +NFLTLFY+  VLL T+P+LY
Sbjct  151  RIEINRGLTVLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYIATVLLFTIPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  EI KQYAVL+E    K LSKIP+G L  KK
Sbjct  211  EKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLL  + H LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  128  WILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  187

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LS++G+  NFLTLFY++ V+LHTVP++Y
Sbjct  188  RHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIY  247

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D + EK   E+ KQYAV + K LSK+P+GPLKDKK
Sbjct  248  EKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  289



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLL  + H LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  124  WILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPKIPEVIIPEDLVVNIALST  183

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LR+IA G+D+KKFL VIAGLW+LS++G+  NFLTLFY++ V+LHTVP++Y
Sbjct  184  RHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIY  243

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ+D + EK   E+ KQYAV + K LSK+P+GPLKDKK
Sbjct  244  EKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  285



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LILALA+ FLWSNA+TFI+KSPP+IP V +P+D VL  A AL
Sbjct  88   WVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFL+VI GLWV S++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  148  RFEINRGFAVLRDIASGRDLKKFLSVIVGLWVSSIVGSWCNFLTLFYIVFVLLHTVPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD  AEKA  EI KQYAV + K LSKIPK PLK+KK
Sbjct  208  EKYEDKVDPLAEKAWHEIKKQYAVFDAKVLSKIPKRPLKEKK  249



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FEL+EYHLLTLVCHI IL LA+ FLWSNA TFI+K+PP+IP V +P++ +L  ASAL
Sbjct  151  WIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKAPPRIPVVHIPEEPILQFASAL  210

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR  A LR I SG+D+K FL VI G W++S++G+  NFLTLFY+  VLLHTVP+LY
Sbjct  211  TIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISIVGSWCNFLTLFYIAFVLLHTVPVLY  270

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            +KYED++D  AEKA  E  KQYAV +EK LSKIPKGPLK+KKLA
Sbjct  271  DKYEDKIDPLAEKALVEFKKQYAVFDEKVLSKIPKGPLKEKKLA  314



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   224 bits (571),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+LLTLVCHILIL+LA+SFLWSNA +FINKSPP+IP V LP++ VL VASAL
Sbjct  89   WVLFELVEYNLLTLVCHILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EIN    VLR IA+GKD+KKFL VIAGLWV+S++G+  +FLTLFY+  VLLHTVP+LY
Sbjct  149  CVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EK+ED++D  AEKA  EI +QYAV + K LSKIP   LK KK+
Sbjct  209  EKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAALKAKKV  251



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+LLTLVCHILIL+LA+SFLWSNA +FINKSPP+IP V LP++ VL VASAL
Sbjct  89   WVLFELVEYNLLTLVCHILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EIN    VLR IA+GKD+KKFL VIAGLWV+S++G+  +FLTLFY+  VLLHTVP+LY
Sbjct  149  CVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EK+ED++D  AEKA  EI +QYAV + K LSKIP   LK KK+
Sbjct  209  EKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAALKAKKV  251



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 139/197 (71%), Gaps = 36/197 (18%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHL+TLVCHI IL+LA+ FLWSNASTFINKSPP+IP V LP+  VL  ASAL
Sbjct  90   WVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASAL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYL------------  439
            R EINR LAVLREIASG+D+KKFL VIAGLW+LS++GN  NF+TLFY+            
Sbjct  150  RYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYF  209

Query  438  --------------------IVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNE-  322
                                + VLLHTVP++YEKYED++D+F EKA  EI KQYAV +E 
Sbjct  210  LKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEK  269

Query  321  ---KYLSKIPKGPLKDK  280
               K LS+IPKG LK K
Sbjct  270  VLKKVLSRIPKGALKKK  286



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHI IL LA+ FLWSN  TFI+K+PP+IP V LP++  L +ASAL
Sbjct  89   WVLFELIEYHLLTLLCHISILCLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IE+N+ L +LR+IASG+++KKFL V+A  WVLSV+G+  NFLTLFY   VLLHTVP+LY
Sbjct  149  TIELNQALKLLRDIASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  EI KQYAV + K L KIP GPLK KK+
Sbjct  209  EKYEDKVDPFAEKAVIEIKKQYAVFDAKVLGKIPTGPLKTKKV  251



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 139/197 (71%), Gaps = 36/197 (18%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHL+TLVCHI IL+LA+ FLWSNASTFINKSPP+IP V LP+  VL  ASAL
Sbjct  90   WVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASAL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYL------------  439
            R EINR LAVLREIASG+D+KKFL VIAGLW+LS++GN  NF+TLFY+            
Sbjct  150  RYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYF  209

Query  438  --------------------IVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNE-  322
                                + VLLHTVP++YEKYED++D+F EKA  EI KQYAV +E 
Sbjct  210  LKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEK  269

Query  321  ---KYLSKIPKGPLKDK  280
               K LS+IPKG LK K
Sbjct  270  VLKKVLSRIPKGALKKK  286



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CHI IL+LA+ FLWSN  TFI+K+PP+IP V LP++  L +ASAL
Sbjct  95   WVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASAL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IE+N+ L +LR+IASG+++KKFL V+A  WVLSV+G+  NFLTLFY   VLLHTVP+LY
Sbjct  155  TIELNQALELLRDIASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD FAEKA  EI KQYAV +   LSKIP GPLK KK+
Sbjct  215  EKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  257



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+E HLLTLVC+ LILAL + FLWSNASTFINKSPP IP V +P++ VL +A+AL
Sbjct  87   WVLFELLECHLLTLVCYFLILALVLLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAAL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EIN   +VLR+IASG+D+KKFL+VIAGLWVLS++G+  NFLTLFY+  VLLHTVP+ Y
Sbjct  147  TTEINWAFSVLRDIASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  EI KQYAV + K LSKIP+GPLK KK
Sbjct  207  EKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKGKK  248



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+E HLLTLVC+ LILALA+ FLWSNASTFINKSPP IP V +P++ VL +A+AL
Sbjct  87   WVLFELLECHLLTLVCYFLILALALLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAAL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN   +VLR+IASG+D+KKFL VIAGLWVLS++G+  NFLTLFY+  VLL+TVP+ Y
Sbjct  147  RIEINWAFSVLRDIASGRDLKKFLTVIAGLWVLSIVGSWCNFLTLFYIAFVLLYTVPVFY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDAFAEKA  EI KQYAV + K LSKIP GPLK KK
Sbjct  207  EKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPMGPLKGKK  248



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLL ++CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS L
Sbjct  110  WVLFELMEYHLLAVLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGL  169

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ I GLWVLS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  170  RIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLVY  229

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED++D + EKA AE+ KQYAV + K LSKIP+GPLK+KK
Sbjct  230  DKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  271



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHI+I  L++ FLWSN + FINK PP IP V L ++  + VA AL
Sbjct  96   WVLFELLEYHLLTLVCHIVIFTLSMLFLWSNVTIFINKRPPPIPVVSLSEEPFVGVALAL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINRT AVLREIASG+D+KKFL V+A LW  S++G+  NFLTLFYL+ VLLHTVP+LY
Sbjct  156  RNEINRTCAVLREIASGRDLKKFLVVVAVLWFFSIVGSCCNFLTLFYLVFVLLHTVPVLY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKY +++DAF EKA  EI KQYAV + K+L KIPKGP  DKK A
Sbjct  216  EKYNEKIDAFTEKATVEIKKQYAVFDAKFLCKIPKGPF-DKKRA  258



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LF+++EYH LTL+CH LIL L   FL SNASTF+ K+PP+IP V+LP++ VL  ASAL
Sbjct  94   WFLFDVLEYHFLTLICHGLILGLVAMFLLSNASTFVKKAPPRIPEVVLPEEPVLKFASAL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  A LR+IASGKD+KKFL VI GLWVLSV+G   +F+TL + I +LL TVP LY
Sbjct  154  RIEINRVFADLRDIASGKDLKKFLYVIGGLWVLSVVGGICDFMTLIFSITLLLFTVPFLY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK EDQVD +AEKA AE+ KQYAV + K LSKIP+GPLKDKK
Sbjct  214  EKNEDQVDCYAEKAIAELKKQYAVFDAKVLSKIPRGPLKDKK  255



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL EYHLL  +CH  I ALA  FLWSNA TFI+KS P IP V +P+D +L + S L
Sbjct  91   WVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR L +LR IASGKDVKKF+ VIAGLWVLS++G+ +NFLTLFY   VLL T+P+LY
Sbjct  151  RIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYED+VDA+ EKA  EI KQYAVL+EK L    SKIP+G L  KK
Sbjct  211  EKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVISKIPRGALNKKK  256



>gb|KJB24288.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=233

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LILALA+ FLWSNA+TFI+KSPP+IP V +P+D VL  A AL
Sbjct  66   WVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQAL  125

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFL+VIAGLWVLS++GN  NFLTLFY++ VLLHT+P+LY
Sbjct  126  RFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGNWCNFLTLFYIVFVLLHTLPVLY  185

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPL  289
            EKYED+VD   EKA  EI KQYAV + K LSKIPK PL
Sbjct  186  EKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRPL  223



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FEL+EYHLLTLVCHI IL LA+ FLWSNA TFI+K+PP IP+V LP++ +   ASAL
Sbjct  79   WIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASAL  138

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR  A L  I SG+D+K FL +I G W++S++G+  NFLTLFY++ VLLHTVP++Y
Sbjct  139  TIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIY  198

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            +KYED++D  AEKA  E  KQYAV +EK L+KIPKGPLK KKLA
Sbjct  199  DKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  242



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LILALA+ FLWSNA+TFI+KSPP+IP V +P+D VL  A AL
Sbjct  88   WVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IASG+D+KKFL+VIAGLWVLS++GN  NFLTLFY++ VLLHT+P+LY
Sbjct  148  RFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGNWCNFLTLFYIVFVLLHTLPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPL  289
            EKYED+VD   EKA  EI KQYAV + K LSKIPK PL
Sbjct  208  EKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRPL  245



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W LFEL+EYHLLTL+CHILI  LA+ FLWSNAS FI+K+PP+IP V +P + +L   S L
Sbjct  123  WFLFELLEYHLLTLLCHILIFTLAVLFLWSNASAFIHKAPPRIPDVHIPDNALLEFISVL  182

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR L+VLR+IASGK++KKF  VIAGLWV+SV+G+ FNFLTL YL+ VLLHTVP+LY
Sbjct  183  RFEINRALSVLRDIASGKELKKFFGVIAGLWVVSVVGSWFNFLTLVYLLFVLLHTVPVLY  242

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            EKYED VDAFAEKA  E+ KQYAV +EK+LSKIP+GPLKDKK A
Sbjct  243  EKYEDHVDAFAEKAAIELKKQYAVADEKFLSKIPRGPLKDKKSA  286



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LI AL I FLWSNA  FINKSP  IP V +P+D V+  A AL
Sbjct  85   WVLFELLEYHLLTLVCHVLIFALVILFLWSNAYAFINKSPLCIPEVHIPKDPVIEFAEAL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E N    VLR+IA G+D+KKFL VIAGLW+LS++G+  NF+TLFYL+ VLLH+VP+LY
Sbjct  145  RFESNLAFTVLRDIAPGRDLKKFLYVIAGLWILSIVGSWCNFVTLFYLVFVLLHSVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED+VD FAEKA  EI KQ AV N K LSKIP+GP K+K
Sbjct  205  EKYEDKVDPFAEKAMHEIKKQCAVFNAKVLSKIPRGPSKEK  245



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FEL+EYHLLTLVCHI IL LA+ FLWSNA TFI+K+PP IP+V LP++ +   ASAL
Sbjct  93   WIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR  A L  I SG+D+K FL +I G W++S++G+  NFLTLFY++ VLLHTVP++Y
Sbjct  153  TIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            +KYED++D  AEKA  E  KQYAV +EK L+KIPKGPLK KKLA
Sbjct  213  DKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  256



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+ H++IL LA+ FLWSNA+ FI+KSPP+IP + +P++ +L +AS L
Sbjct  96   WVLFELMEYHLLTLLSHVMILLLAVLFLWSNATMFIHKSPPKIPQLHIPEEPLLQLASGL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+VIAGLWVLS++G   +FLTL Y+ +VLL TVP+LY
Sbjct  156  RIEINRGFSSLHEIASGRDLKKFLSVIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLLY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD + EKA  E+ KQYAV + K LSKIP GPLK+KK
Sbjct  216  DKYEDKVDPYGEKAMLELKKQYAVFDAKVLSKIPMGPLKNKK  257



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+LVCHILILAL++ FLWSNA +FINKSPPQIP + L ++  L VASAL
Sbjct  91   WVLFELVEYHLLSLVCHILILALSVLFLWSNAHSFINKSPPQIPEIHLHEEHFLLVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   VLR+IA G+D+KKFL V+AGLWV+SV+G+  +FLTL Y+  VLLHTVP+LY
Sbjct  151  RNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVISVVGSWCHFLTLIYICFVLLHTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY VL+EK LSKIP GPLK K
Sbjct  211  EKHEDKVDPMAEKAFVELKKQYGVLDEKVLSKIPIGPLKAK  251



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 134/190 (71%), Gaps = 29/190 (15%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLF+LMEYHLL LVCH LIL+LAI FLWSNA+TFINKSPP+IP V +P+D  ++ A +L
Sbjct  89   WVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSL  148

Query  582  RIEINRTLAVLREIASGKDVKKFL-----------------------------AVIAGLW  490
            R EINR  AVLR+IASG+D+KKFL                              VIAGLW
Sbjct  149  RYEINRGFAVLRDIASGRDLKKFLMVCCSVFLSNVSGSWSISMGVILFGILVFQVIAGLW  208

Query  489  VLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLS  310
            VLS++G+  NFLTLFY+  V LHT+P+LYEKYED+VD+FAEKA  ++ K YA  N K LS
Sbjct  209  VLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLS  268

Query  309  KIPKGPLKDK  280
            KIP+GPLK K
Sbjct  269  KIPRGPLKKK  278



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE +EYH +TL+CH LIL LA+ FLWSN + FINKSPP IP V +P+D   N+A +L
Sbjct  129  WILFECLEYHFVTLLCHCLILTLALLFLWSNGTAFINKSPPHIPEVKIPEDVATNIALSL  188

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  +VLR+IASG+D+K FL V+AGLWVLS++G+  NFLTLFY+  V+LHTVP+LY
Sbjct  189  RYEINRAFSVLRDIASGRDLKMFLTVVAGLWVLSILGSCCNFLTLFYITFVVLHTVPVLY  248

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD+F+EKA  EI KQYAV + K LSKIP+GPLK KK
Sbjct  249  EKYEDQVDSFSEKAMIEIKKQYAVFDAKVLSKIPRGPLKSKK  290



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHLLTLV H+LI+ + + FLWSNASTFINKSPP IP V +P+  VL +ASA+
Sbjct  96   WVFFELLEYHLLTLVSHLLIIGIVMLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAI  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EINR   ++REIASGKD+K+FL+ IAGLWV+S++G  +NFLTL Y+ VVLL T+P+ Y
Sbjct  156  TSEINRAFVIVREIASGKDLKQFLSAIAGLWVVSILGKYYNFLTLVYIAVVLLFTLPVFY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKY+DQVDA AEKA  E+ KQYAV + K LSKIP+G  K KK 
Sbjct  216  EKYDDQVDAVAEKALTEMKKQYAVFDAKVLSKIPRGQTKAKKF  258



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+LLTLVCHI IL+LA+ FLWSNA TFI+KSPP+IP V LP++  L VA+AL
Sbjct  93   WVLFELIEYNLLTLVCHISILSLALMFLWSNAHTFIHKSPPRIPEVHLPEEPFLQVAAAL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              E+N+ L +LR+IASG+++KKFL VIA  WVLS++G+  NFLTLFY+  VLLHTV +LY
Sbjct  153  TFELNQALKLLRDIASGRNLKKFLMVIAAFWVLSIVGSWCNFLTLFYISFVLLHTVLVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD  AEKA  EI KQYAV + K LSKIPKGPLK KK+
Sbjct  213  EKYEDKVDPCAEKAMIEIKKQYAVFDAKVLSKIPKGPLKTKKV  255



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LILALA+ FLWSNA+ FINKS P IP V +P++ VL    AL
Sbjct  89   WVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IA G+D+K FL+VIAGLWVLS++G+  NFLTLFY++ VLLHTVP+LY
Sbjct  149  RFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV + K LSKIP+GPLK KK
Sbjct  209  EKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPLKQKK  250



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCH+LILALA+ FLWSNA+ FINKS P IP V +P++ VL  A AL
Sbjct  89   WVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFAMAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  AVLR+IA G+D+K FL+VIAGLWVLS++G+  NFLTLFY++ V+LHTVP+LY
Sbjct  149  RFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVVLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED+VD FAEKA  EI KQYAV + K LSKIP GPLK KK
Sbjct  209  EKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPMGPLKQKK  250



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP+IP V LP++    VASAL
Sbjct  88   WVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASAL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  A+L  I SG+D+KKFL +IAG+W+LS++GN  NFLTLFY+  VLLHTVP+LY
Sbjct  148  RIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLLHTVPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED++D  AEKA  EI KQY V + K LSKIP GPLK K
Sbjct  208  EKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPLKAK  248



>gb|EPS73616.1| hypothetical protein M569_01145, partial [Genlisea aurea]
Length=256

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL LA+ FLWSN S FINKSPP+IP +++P+   L +ASA+
Sbjct  96   WVLFELIEYHLLTLVCHILILTLALLFLWSNTSAFINKSPPKIPEIVIPEKVALGIASAI  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EIN   A LR+IASGKD+KKFLAVIAGLWVL+++G+  NFLTLFY+  V+LHTVP+ Y
Sbjct  156  RTEINTASAELRDIASGKDLKKFLAVIAGLWVLAILGSHVNFLTLFYICFVVLHTVPVAY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED+VD F EK E E  KQYAVL+ K LSK+P   LK K
Sbjct  216  EKYEDEVDEFGEKVEREFKKQYAVLDAKVLSKVPVAQLKSK  256



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLV H LIL+LA  FLWSN   FI+KSPP IP V +P+D  +N+A +L
Sbjct  93   WLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIFIHKSPPNIPEVKIPEDLTVNIALSL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR L  LREI  G+D+KKFL VI GLWVLSV+G+  NFLTL Y++ V+L+TVP+LY
Sbjct  153  RHEINRGLFTLREIGHGRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+D+VDAF EKA  E+ K YA+  EK LSKIPKG LK+KK
Sbjct  213  EKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKGALKNKK  254



>dbj|BAH20346.1| AT4G11220 [Arabidopsis thaliana]
Length=153

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  729  LTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  550
            LTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS LRIEINR ++ L
Sbjct  1    LTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSL  60

Query  549  REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA  370
            REIASG+D+KKFL+ IAGLWVLS++G  ++FLTL Y+ +VLL TVP+ Y+KYED+VD++ 
Sbjct  61   REIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLGYIALVLLFTVPLFYDKYEDKVDSYG  120

Query  369  EKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKA AE+ KQYAVL+ K  SKIP+GPLKDKK
Sbjct  121  EKAMAELKKQYAVLDAKVFSKIPRGPLKDKK  151



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP+IP   LP++  L VASAL
Sbjct  97   WVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR  AVL  I SG+D+KKFL VIA +W+LS++GN  NFLTLFY+  +LLHTVP+LY
Sbjct  157  RIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKY+D++D  AEKA  EI KQYAV + K LSKIP GPLK K
Sbjct  217  EKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGPLKAK  257



>ref|XP_003592173.1| Reticulon family protein [Medicago truncatula]
 gb|AES62424.1| seed maturation protein [Medicago truncatula]
Length=250

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FELM+Y+L+TLVCH++ILALA  FLWSNAS FI+KSP QIP V++PQ+ V   AS L
Sbjct  90   WVFFELMQYNLITLVCHLMILALAALFLWSNASVFIHKSPLQIPHVVIPQECVFEAASVL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEIN+  A+LREI +G+D+KKFL VIAGLW +SV+G+ FNFLTLFY+  V L T+P++Y
Sbjct  150  RIEINQVFAILREIGTGRDIKKFLTVIAGLWFISVIGSCFNFLTLFYIFYVSLFTLPLVY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK  286
            EK EDQVDA AEKA  EI KQYAVL+ K LS+IP    K
Sbjct  210  EKNEDQVDALAEKAMIEIKKQYAVLDAKVLSQIPIAGFK  248



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP+IP V LP++    VASAL
Sbjct  95   WVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASAL  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  A+L  I SG+D+KKFL +IAG+W+LS++GN  NFLTLFY+  VL HTVP+LY
Sbjct  155  RIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLSHTVPVLY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED++D  AEKA  EI KQY V + K LSKIP GPLK K
Sbjct  215  EKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPLKAK  255



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLV +ILI ALAI FLWSNA  FI+K+PP IP V LP++  L VAS L
Sbjct  99   WVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASEL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R++IN   A+L +IASG+D+KKFLAVIAGLWVLSV+G   NFLTLFY+  VLLHTVP++Y
Sbjct  159  RVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D  AEKA  E  KQYAV + K LSKIP G LK K+
Sbjct  219  EKYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP+IP   LP++  L VASAL
Sbjct  97   WVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIE+NR  AVL  I SG+D+KKFL VIA +W+LS++GN  NFLTLFY+  +LLHTVP+LY
Sbjct  157  RIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKY+D++D  AEKA  EI KQYAV + K LSKIP GPLK K
Sbjct  217  EKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGPLKAK  257



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYH LTLVCHILIL LA+ FLWSNA TFI+KSPP+IP V LP++ +L VAS L
Sbjct  94   WVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPDVHLPEEPILQVASVL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVL  I SG+D+KKFL VIAG+W+LS++GN  NFLTLFY+  +LLHT P+LY
Sbjct  154  RIEINRGFAVLHSIGSGRDLKKFLMVIAGVWILSIVGNWCNFLTLFYITFILLHTTPVLY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EKYED++D  AEKA  EI KQYAV + K LSKIP G LK K
Sbjct  214  EKYEDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPVGLLKAK  254



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLV +ILI ALAI FLWSNA  FI+K+PP IP V LP++  L VAS L
Sbjct  99   WVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASEL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R++IN   A+L +IASG+D+KKFLAVIAGLWVLSV+G   NFLTLFY+  VLLHTVP++Y
Sbjct  159  RVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            E+YED++D  AEKA  E  KQYAV + K LSKIP G LK K+
Sbjct  219  ERYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FELMEYHL+TLVCH LIL+LAI FLW NA+TFI+KS P +P V + +D  LNV  +L
Sbjct  90   WVFFELMEYHLITLVCHGLILSLAIIFLWCNATTFISKSRPHVPEVSISEDLALNVVLSL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R  INR L  LR+IASG+D+KKFLA  A LWVLS++ N  +FL LFY+  V L+TVP+LY
Sbjct  150  RYVINRGLVALRDIASGRDLKKFLAAAAALWVLSIIANCCSFLMLFYIAFVALYTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VDAFAEKAEAE  K Y V++ KYLSKIP GPLKDKK 
Sbjct  210  EKYEDRVDAFAEKAEAEFKKHYVVIHVKYLSKIPMGPLKDKKF  252



>ref|XP_008239009.1| PREDICTED: reticulon-like protein B2 [Prunus mume]
Length=257

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+ YHLLTL+ H LIL LA+ FLWSNASTFINKSPP+IP V +P+  VL +ASA+
Sbjct  95   WVFFELLGYHLLTLLSHCLILGLAMLFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAI  154

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR   +LREIASGKD+K+FL+VIAGLWVLS++G  +NFLTL Y++VVLL T+P+ Y
Sbjct  155  TIEINRAFVILREIASGKDLKQFLSVIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFY  214

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQVDA AEKA  EI KQYAV + K LSK+PKG +KDKK
Sbjct  215  EKYDDQVDALAEKAMIEIKKQYAVFDAKVLSKVPKGQMKDKK  256



>ref|XP_004496510.1| PREDICTED: reticulon-like protein B1-like [Cicer arietinum]
Length=253

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYHL+TLVCH++IL+L   FLWSNAS FI+KSP QIP V +PQ+ VL VAS L
Sbjct  93   WVFFELLEYHLITLVCHLMILSLGALFLWSNASVFIHKSPMQIPHVSVPQECVLEVASVL  152

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+E NR +  LREI +G+D+KKFL+V+AGLWV+SV+G+ F+FLTLFYL  V L T+P+LY
Sbjct  153  RVETNRVVTALREIGTGRDIKKFLSVVAGLWVISVVGSWFSFLTLFYLFFVSLFTLPLLY  212

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIP  301
            EK EDQVDA AEKA  EI KQYAVL+ K LS+IP
Sbjct  213  EKNEDQVDALAEKAMIEIKKQYAVLDAKVLSQIP  246



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 128/165 (78%), Gaps = 4/165 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WV FEL+EYH LTL+CHI IL LA+ FLWSNA TF++K+PP IP V LP++  L +ASAL
Sbjct  101  WVFFELLEYHFLTLICHISILVLALLFLWSNAHTFVHKTPPHIPIVHLPEEPFLQIASAL  160

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LR+I +GKDVKKFL VI GLW+LS++G+  NFLTLFY+  VLL TVP +Y
Sbjct  161  RIEINRGFSALRDIGTGKDVKKFLIVIFGLWILSIVGSWSNFLTLFYITFVLLFTVPFVY  220

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDK  280
            +KYED++D  AEKA  EI KQYAV +E    K LSKIPKG LK K
Sbjct  221  DKYEDKIDPLAEKAFIEIKKQYAVFDEKVLSKVLSKIPKGVLKGK  265



>ref|XP_010938076.1| PREDICTED: reticulon-like protein B1 [Elaeis guineensis]
Length=248

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE M YHLLT +CH LI  LA+SF+WSNA++F+N+SPP+ P VILP+D  L++A A+
Sbjct  85   WLLFEWMGYHLLTFICHSLIFLLAVSFIWSNAASFVNRSPPKFPEVILPEDMFLSIAHAV  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R +IN   +    +ASGKD+K+F+ VIAGLWVLSV+G+ F+FLTLFY++ ++ +T P LY
Sbjct  145  RYQINEAFSTFIYVASGKDLKQFMMVIAGLWVLSVIGSWFSFLTLFYIVFLITYTAPALY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD  A KA  EI + YAVL+EK L KIP+GP  DKK
Sbjct  205  EKYEDQVDTVAGKAMVEINRHYAVLDEKVLQKIPRGPFTDKK  246



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLV HILI  LAI FLWSNA TFI+K+PP+IP V LP++  L VAS L
Sbjct  98   WVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  157

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+ IN   A+L  IASGKD+KKFLAVIAGLWVLSV+G   NFLTLFY+  VLLHTVP +Y
Sbjct  158  RVVINCAFALLHSIASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIY  217

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D  AEK   E  KQYAV + K LSKIP+G LK+K+
Sbjct  218  EKYEDKIDPLAEKVIIEFKKQYAVFDAKVLSKIPRG-LKNKR  258



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLV HILI ALAI FLWSNA  FI+K+PP+IP V LP++  L VAS L
Sbjct  99   WVLFELLQYHLLTLVGHILIGALAILFLWSNAHAFIHKTPPRIPEVRLPEEPFLQVASEL  158

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R++IN   A+L +IASG+D+KKFLAVIAGLWVLSV+G   NFLTLFY+  V+LHTVP++Y
Sbjct  159  RVQINCAFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVVLHTVPVIY  218

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D  AE+A  E  KQYA  + K LSKIP G LK+K+
Sbjct  219  EKYEDKIDPLAERATIEFKKQYAXFDAKVLSKIPHG-LKNKR  259



>ref|XP_008788043.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=238

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE + YH LT +CH LI  L + FLWSNA++FIN+SPP  P V+LP+D  L++A ++
Sbjct  75   WLLFECIGYHFLTFICHSLIFFLVVLFLWSNAASFINRSPPNFPEVVLPEDLFLSIAHSV  134

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            + +IN T A+ R +ASGKD+KKFL VI GLWVLS++G+ F+FLT FY++ VLL+++P LY
Sbjct  135  KHKINETFAIFRYVASGKDLKKFLMVITGLWVLSIIGSWFSFLTFFYIVFVLLYSLPALY  194

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVDA AEKA  E+ KQYAVL+EK L KIP+ P  DKK
Sbjct  195  EKYEDQVDAAAEKAAIEMNKQYAVLDEKLLCKIPRCPFSDKK  236



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFI KSPPQIP + +P++  L +AS+L
Sbjct  87   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEAFLVIASSL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL VI GLW++SV+GN FNFLTL Y+  V+LHTVPM+Y
Sbjct  147  RNEVNQAFVILRSIALGRDLKKFLMVIVGLWIISVVGNWFNFLTLVYICFVVLHTVPMMY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD FAEKA  E+ KQY V +EK +SKIP   LK K
Sbjct  207  EKHEDKVDPFAEKAMKELQKQYLVFDEKVISKIPIASLKAK  247



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLV HILI  LA+ FLWSNA +FI+K+PP+IP V LP++  L VAS L
Sbjct  96   WVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASEL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R++IN   AVL +IASG+++KKFL VIAGLWVLS++G   NFLTLFY+  VLLHTVP++Y
Sbjct  156  RLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D FAEKA  E  K YAV + K LSKIP+G LK+K+
Sbjct  216  EKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-LKNKR  256



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CH++I+ LA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS L
Sbjct  102  WVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGL  161

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + LR+IASG+D+KKFL+ I GLWVLSV+G   +FLTL Y+ +VLL T+P+LY
Sbjct  162  RIEINRGFSSLRQIASGRDLKKFLSAIVGLWVLSVLGGCCSFLTLAYIALVLLFTLPLLY  221

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+ KQYAV + K LSKIP+GPLKDKK
Sbjct  222  DKYEDKVDSYGEKAMAELKKQYAVFDAKVLSKIPRGPLKDKK  263



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EY+LLTL  HI ILALA  FLWS+A TFI+K+PP IP + +P++ VL +AS L
Sbjct  90   WVLFELLEYNLLTLFGHITILALACLFLWSSAITFIHKTPPHIPEIHIPEEVVLQLASGL  149

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LR+IASG+D+KKFL VIAGLW+LS++G+S NFLTL Y+  +LL TVP+LY
Sbjct  150  RIEINRGFTTLRDIASGRDLKKFLLVIAGLWLLSIVGSSCNFLTLIYIATILLFTVPVLY  209

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYED+VD F EKA  EI KQYAV +EK L    SKIP+G    KK
Sbjct  210  EKYEDKVDDFGEKAMKEIKKQYAVFDEKVLSKVMSKIPRGAFNKKK  255



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 127/162 (78%), Gaps = 11/162 (7%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+ YHL+TLVC++ I +LA+ FLWSN S F+NK PP+IP V+LP+  V  VAS L
Sbjct  88   WVLFELLGYHLITLVCYLSIFSLAVLFLWSNTSDFLNKPPPKIPEVVLPEKCVREVASVL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  AVLR+IASG+D+KK LAVIAGLWVLS++G             VLLHTVP+LY
Sbjct  148  RIEINRGFAVLRDIASGRDLKKVLAVIAGLWVLSLIGT-----------FVLLHTVPVLY  196

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+EDQVDA++EKA  EI KQYAV +EKYLSKIPKG LK +K
Sbjct  197  EKHEDQVDAYSEKAWIEIKKQYAVFDEKYLSKIPKGALKGEK  238



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+MEYHLLTLV H LIL+LA  FL+SN   F++KSPP IP V +P+D  +N+A +L
Sbjct  91   WLLFEIMEYHLLTLVGHCLILSLATLFLYSNVCIFVHKSPPNIPEVKIPEDMTVNIALSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR    LREI  G+D+KKFL VI GLWVLSV+G+  NFLTL Y++ V+L+TVP+LY
Sbjct  151  RHEINRGFFTLREIGHGRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+D+VDAF EKA  E+ K YA+  EK LSKIPKG LK+KK
Sbjct  211  EKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKGALKNKK  252



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFINK+PPQIP V +P+D  L +AS+L
Sbjct  91   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN  NFLTL Y+  V+LHTVPMLY
Sbjct  151  RNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY V +EK LSKIP   LK K
Sbjct  211  EKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  251



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFINK+PPQIP V +P+D  L +AS+L
Sbjct  91   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN  NFLTL Y+  V+LHTVPMLY
Sbjct  151  RNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY V +EK LSKIP   LK K
Sbjct  211  EKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  251



>ref|XP_010921231.1| PREDICTED: reticulon-like protein B1 isoform X1 [Elaeis guineensis]
 ref|XP_010921232.1| PREDICTED: reticulon-like protein B1 isoform X1 [Elaeis guineensis]
Length=248

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE M YHLLT +CH LI  LA+SF+WSNA++ +N+SPP+ P  ILP+D  LN+A A+
Sbjct  85   WLLFEWMGYHLLTFICHSLIFLLAVSFIWSNAASLVNRSPPKFPEAILPEDMFLNIAQAV  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R  IN   A  R +ASGK++K+FL VIAGLWV+SV+GN F+FLTL Y++ ++++T P LY
Sbjct  145  RYHINGAFATFRYVASGKELKQFLMVIAGLWVVSVIGNWFSFLTLSYMVFLIIYTAPALY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQ D  AEKA  EI K YAVL+EK L KIP+GP  +KK
Sbjct  205  EKYEDQADNIAEKATVEINKHYAVLDEKILQKIPRGPFANKK  246



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 128/165 (78%), Gaps = 4/165 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL +Y+LLTL  HI ILALA+ FLWS+ASTFI+K PP+IP V +P++ VL +AS L
Sbjct  85   WILFELFQYNLLTLFGHISILALAVLFLWSSASTFIHKKPPRIPEVHIPEEVVLQLASGL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   +LR IA G+D+KKFL VIAGLWVLS +G+S NFLTL Y   VLL TVP+LY
Sbjct  145  RIEINRGFTLLRHIALGRDLKKFLMVIAGLWVLSKVGSSCNFLTLVYSATVLLFTVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDK  280
            EKYED+VD F EKA  EI KQYAVL+EK L    SKIPKG  K K
Sbjct  205  EKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVISKIPKGAFKKK  249



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFINK+PPQIP V +P+D  L +AS+L
Sbjct  92   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN  NFLTL Y+  V+LHTVPMLY
Sbjct  152  RNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY V +EK LSKIP   LK K
Sbjct  212  EKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  252



>gb|ABK23818.1| unknown [Picea sitchensis]
Length=164

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE + Y+LLTL+CH+LIL + I F+WSNAS FINK P +IP +   +    +VASAL
Sbjct  2    WLLFEWLGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASAL  61

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   V+ ++ASG+D+KKFL V+AGLW+LSV+G+  NFLTLFY+  V  HTVP+LY
Sbjct  62   RFEINRLFTVIHDVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLY  121

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAF  KA  E  K Y   + K LSKIP+GPLKDKK 
Sbjct  122  EKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  164



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLL+L+ H+LI+ LA+ F+WSNAS FINKSPP+IP V +P++ +L +AS L
Sbjct  104  WVLFELMEYHLLSLLSHVLIVVLAVLFIWSNASMFINKSPPKIPEVHIPEEPILQLASGL  163

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR    LR+IASG+D+KKFL  IAGLWVLS++G   NFLTL Y+ +V+L T+P+LY
Sbjct  164  RIEINRAFTCLRDIASGRDLKKFLTAIAGLWVLSIVGGCCNFLTLSYIGMVMLFTIPVLY  223

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+ED+VDA+ EKA  E+ KQYAVL+EK LSKIP+GPLK KK
Sbjct  224  EKHEDKVDAYGEKAMVEMKKQYAVLDEKVLSKIPRGPLKGKK  265



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFELMEYHLLTL+CH++I+ LA  FLWSNA+ FI KSPP+IP V +P+D +L +AS L
Sbjct  150  WVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIRKSPPKIPEVHIPEDPLLQLASGL  209

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ + GLW+LS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  210  RIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVY  269

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+  QYAVL+ K LSKIP+   K+KK
Sbjct  270  DKYEDKVDSYGEKAMAELKNQYAVLDAKVLSKIPRWTSKNKK  311



>gb|EMS50148.1| Reticulon-like protein B2 [Triticum urartu]
Length=235

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE+++YHLLTL+ H++I  LAI F+WS A TFI KSPP IP V +P+D  +NV+ AL
Sbjct  73   WVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRAL  132

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R ++NR+L +LREIA G D+KKFL VIAGLWVLS +G+  +FLTL Y+ V+++HTVP+LY
Sbjct  133  RSDVNRSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILY  192

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KY+D+VD FA KA  E  K Y VL++K LSKIP+GP K KK
Sbjct  193  DKYQDKVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  234



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EYHLLTLV H+LI A+ + FLWSN   FINKSPP+IP + +P+ T+L + S++
Sbjct  84   WLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFINKSPPKIPEIQIPEKTLLQIVSSI  143

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
              EINR L V+R+IASGKD+K+FL+VIAGLWV+S++G S NFLTL Y+ +VLL +VP+ Y
Sbjct  144  TFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSILGKSCNFLTLLYIAIVLLFSVPVFY  203

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKY+ ++D  AEKA  EI KQYAV + K LSKIP+G LK KK+
Sbjct  204  EKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPRGALKAKKI  246



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL++YHLLTLV HILI  LAI FLWSNA TFI+K+PP+IP V LP++  L VAS L
Sbjct  98   WVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  157

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+ IN + A+L  IASGKD+KKFLAVIAGLWVLSV+G   NFLTLFY+  VLLHTVP +Y
Sbjct  158  RVVINCSFALLHSIASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIY  217

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D  AEK   E  KQY V + K LSKIP G LK+K+
Sbjct  218  EKYEDKIDPLAEKVTIEFKKQYDVFDAKVLSKIPCG-LKNKR  258



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  H+ ILALA+ FLWS+A+TFI+K+PP IP + +P+  VL +AS L
Sbjct  88   WILFELLEYNLLTLFGHVSILALAVLFLWSSATTFIHKTPPHIPEIHIPEKIVLELASGL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR IA G+D+KKFL V+AGLWVLS++G+S  FLTL Y+  V+L TVP+LY
Sbjct  148  RIEINRGFTVLRHIALGRDLKKFLMVVAGLWVLSILGSSCTFLTLVYIATVILFTVPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKKL  274
            EKYED+VD F EKA  EI KQYAVL+EK L    SKIP G L  KKL
Sbjct  208  EKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMSKIPIGALMKKKL  254



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTLV HILI  LAI FLWSNA TFI+K+PP+IP V LP++  L VAS L
Sbjct  94   WILFELLEYNLLTLVAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  153

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+ IN   A+L  IASGKD+KKFLAVIAGLWVLSV+G   NFLTLFY+  VLLHTVP++Y
Sbjct  154  RVVINCAFALLHNIASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPVIY  213

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D  AEK   E  KQYAV + K L+KIP+G LK+K+
Sbjct  214  EKYEDKIDPLAEKVTIEFKKQYAVFDAKVLNKIPRG-LKNKR  254



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL++Y+LLTL  HI ILALA+ FLWS+A+TFI+K+PP IP V +P+D VL +AS L
Sbjct  85   WILFELLQYNLLTLFGHISILALAVLFLWSSATTFIHKTPPHIPEVHIPEDVVLQLASGL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   +LR IA G+D+KKFL V+AGLWVLS +G+S NFLTL Y+  VLL TVP+LY
Sbjct  145  RNEINRGFTLLRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYED+VD F EKA  EI KQYAVL+EK L    SKIP+G    KK
Sbjct  205  EKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLVCHILILA A+ FLWSNA T INKSPP+IP V LP+  VL VASAL
Sbjct  89   WVLFELIEYHLLTLVCHILILAAALLFLWSNACTLINKSPPRIPEVHLPEKLVLQVASAL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             +EIN   A LR +A+GKD KKFL +IAGLWVLS++G+S +FLTLFY+  VLLHTVP+LY
Sbjct  149  CVEINSAFAGLRSVAAGKDFKKFLMIIAGLWVLSIVGSSCHFLTLFYICFVLLHTVPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYED+VD  AEKA  EI KQYAV + K LSKIP   LK K++
Sbjct  209  EKYEDKVDPLAEKAMVEIKKQYAVFDAKVLSKIPVASLKAKRV  251



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL++Y+LLTL  H+ ILALA+ FLWS+A+TFI+K+PP IP V +P++ VL +AS L
Sbjct  85   WILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKTPPHIPEVHIPEEVVLQLASGL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   +LR IA G+D+KKFL V+AGLWVLS +G+S NFLTL Y+  VLL TVP+ Y
Sbjct  145  RIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVFY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKYED+VD F EKA  EI KQYAVL+EK L    SKIP+G    KK
Sbjct  205  EKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 132/194 (68%), Gaps = 32/194 (16%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+ YHLL  + H LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + 
Sbjct  43   WILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALST  102

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYL------------  439
            R EINR  A LR+IA G+D+KKFL VIAGLW+LS++G+  NFLTLFY+            
Sbjct  103  RHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIGEGSQLSIPFLA  162

Query  438  --------------------IVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK  319
                                + V+LHTVP++YEKYEDQ+D + EK   E+ KQYAV + K
Sbjct  163  PLLPNVDLVFTVDLSLLCQTVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAK  222

Query  318  YLSKIPKGPLKDKK  277
             LSK+P+GPLKDKK
Sbjct  223  VLSKVPRGPLKDKK  236



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI ILALA+ FLWS+A+TFI+KSPP IP V +P++ VL +AS L
Sbjct  88   WILFELLEYNLLTLFGHISILALAVLFLWSSATTFIHKSPPHIPEVHIPEEVVLELASGL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  148  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKLGSSCNFLTLIYIATVLLFTIPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLN----EKYLSKIPKGPLKDKK  277
            EKYED+VD F EKA  EI KQY   +     K +SKIPKG    KK
Sbjct  208  EKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKGAFYKKK  253



>gb|EMT25698.1| Reticulon-like protein B2 [Aegilops tauschii]
Length=258

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE+++YHLLTL+ H++I  LAI F+WS A TFI KSPP IP V +P+D  LNV+ AL
Sbjct  96   WVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLALNVSRAL  155

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R ++NR+L +LREIA G D+KKFL VIAGLWVLS +G+  +FLTL Y+ V+++HTVP+LY
Sbjct  156  RNDVNRSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILY  215

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KY+D+VD FA KA  E  K Y VL++K LSKIP+GP K KK
Sbjct  216  DKYQDKVDHFAGKAHTEACKHYQVLDQKVLSKIPRGPAKTKK  257



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTLV HILI  LA+ FLWSNA +FI+K+PP+IP V LP++  L VAS L
Sbjct  178  WVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASEL  237

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R++IN   AVL +IASG+++KKFL VIAGLWVLS++G   NFLTLFY+  VLLHTVP++Y
Sbjct  238  RLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIY  297

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYED++D FAEKA  E  K YAV + K LSKIP+G LK+K+
Sbjct  298  EKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-LKNKR  338



>gb|ABB51093.1| reticulon [Hordeum vulgare]
Length=204

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE+++YHLLTL+ H++I  LAI F+WS A TFI KSPP IP V +P+D  +NV+ AL
Sbjct  42   WVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRAL  101

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R ++NR+L + REIA G D+KKFL VIAGLWVLS +G+  +FLTL Y+ V+++HTVP+LY
Sbjct  102  RNDVNRSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILY  161

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KY+D+VD FA KA  E  K Y VL++K LSKIP+GP K KK
Sbjct  162  DKYQDKVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  203



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYH LT +CH  + ALA  FLWSNA TFI+KS P IP V +P+D VL + S L
Sbjct  91   WVLFELIEYHFLTFLCHFAMAALAALFLWSNACTFIHKSTPHIPEVHIPEDPVLQLVSGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR IASG+D+KKF+ VIAGLWVLS++G+  NFLTLFY+  VLL T+P++Y
Sbjct  151  RIEINRGFTVLRNIASGRDLKKFILVIAGLWVLSIIGSCCNFLTLFYIATVLLFTIPVVY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  EI KQYAVL+E    K LSKIP+G L  KK
Sbjct  211  EKYEDKVDAFGEKAMKEIKKQYAVLDEKVFSKVLSKIPRGALNKKK  256



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ P IP V +P++ VL +AS L
Sbjct  88   WILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGL  147

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  148  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  207

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKY+D+VD F EKA  EI KQY V +EK L    SKIPKG    KK
Sbjct  208  EKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  253



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ P IP V +P++ VL +AS L
Sbjct  89   WILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGL  148

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  149  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  208

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKY+D+VD F EKA  EI KQY V +EK L    SKIPKG    KK
Sbjct  209  EKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  254



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFINK+PPQIP V +P++  L +AS+L
Sbjct  91   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEEAFLTIASSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN  NFLTL Y+  V+LHTVPM+Y
Sbjct  151  RNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVVLHTVPMMY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY V +EK +SKIP   LK K
Sbjct  211  EKHEDKVDPLAEKAMKELQKQYLVFDEKVISKIPIASLKAK  251



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ P IP V +P++ VL +AS L
Sbjct  101  WILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGL  160

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  161  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  220

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDKK  277
            EKY+D+VD F EKA  EI KQY V +EK L    SKIPKG    KK
Sbjct  221  EKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  266



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 4/165 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL++Y+LLTL  H+ ILALA+ FLWS+A+TFI+K PP IP V +P++ VL +AS L
Sbjct  85   WILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKKPPHIPEVHIPEEVVLQLASGL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   +LR IA G+D+KKFL V+AGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  145  RIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIPKGPLKDK  280
            EKYED+VD F EKA  EI KQYAVL+EK L    SKIP+G    K
Sbjct  205  EKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKK  249



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE + Y+LLTL+CH+LIL + I F+WSNAS FINK P +IP +   +    +VASAL
Sbjct  97   WLLFEWLGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   V+ ++ASG+D+KKFL V+AGLW+LSV+G+  NFLTLFY+  V  HTVP+LY
Sbjct  157  RFEINRLFTVIHDVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAF  KA  E  K Y   + K LSKIP+GPLKDKK 
Sbjct  217  EKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+M+YHLLTL+CH LIL LAI FLWSNA+TFINKSPP IP V +P+D  +NVA +L
Sbjct  92   WLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINKSPPNIPEVKIPEDLAVNVARSL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL VIAGLW+LSV+G+  NFLTL Y++ ++L+TVP+LY
Sbjct  152  RYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGSCCNFLTLSYIVFMVLYTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+ED+VDAF EKA  E+ K YA+ +EK LSKIPKGPLKDKK
Sbjct  212  EKHEDKVDAFGEKAMVELKKYYAIFDEKCLSKIPKGPLKDKK  253



>gb|ABK22748.1| unknown [Picea sitchensis]
Length=248

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LF+ MEYH LT VCH+LIL+LAI F+W N++ F+ +SPP IP + + +  + NVAS L
Sbjct  85   WILFKCMEYHFLTFVCHVLILSLAILFIWINSAAFLKRSPPHIPEIAISEVAIHNVASEL  144

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R+E+NR  +VL E+A+G+D KK+L V+AGLW LSV+G+  +FLTL Y+++V+ HTVP+LY
Sbjct  145  RVEVNRAFSVLHEVATGRDFKKYLLVVAGLWFLSVIGSWCDFLTLAYIVLVVTHTVPVLY  204

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKY+DQVD+FA KA  +   QY V++ K L KIP+GPLKDKK
Sbjct  205  EKYQDQVDSFAHKATVKAKDQYKVIDAKILKKIPRGPLKDKK  246



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLLTL+CH++I+ALA+ FLWSNA+ FI+KSPP+IP V +P+D +L +AS L
Sbjct  104  WVLFELLEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGL  163

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR  + L EIASG+D+KKFL+ + GLW+LS++G   +FLTL Y+ +VLL TVP++Y
Sbjct  164  RIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVY  223

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KYED+VD++ EKA AE+ KQYAVL+ K LSKIP+GPLKDKK
Sbjct  224  DKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|XP_003555396.1| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=251

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FELM+YHL+T +CH+LI++LA  FLWSNAS FI+KSP  IP V LP++ V  VASAL
Sbjct  91   WIFFELMQYHLITFICHLLIVSLAALFLWSNASVFIHKSPLHIPHVALPEECVHQVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR   V+REI +GKD+KKFL+VIA LWV+SV+G+ FNF+TLFYL  V L T+P+LY
Sbjct  151  TIEINRAFVVVREIGTGKDLKKFLSVIAVLWVISVIGSWFNFMTLFYLFFVSLFTLPLLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK  286
            EKYEDQVDA  EKA  EI KQYAV + K LS+IP    K
Sbjct  211  EKYEDQVDALGEKAMIEIKKQYAVFDAKVLSQIPIAGFK  249



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FEL+EYHLLTLV HILIL LA+ FLWSNA TFI+K+PP+IP V LP++  L  ASAL
Sbjct  92   WIFFELLEYHLLTLVGHILILLLAVLFLWSNAHTFIHKAPPRIPVVHLPEEPFLQFASAL  151

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR  A L  I SG+D+K FL VI G W+LS++G+  NF+TLFY++ VLLHTVP+LY
Sbjct  152  TIEINRGFAALHAIGSGRDLKTFLVVIVGTWILSIVGSWVNFMTLFYIVFVLLHTVPVLY  211

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKLA  271
            +KYED++D  AEKA  E  KQYAV +EK LSKIPKGPLK KKLA
Sbjct  212  DKYEDKIDPLAEKALIEFKKQYAVFDEKVLSKIPKGPLKYKKLA  255



>ref|XP_008793405.1| PREDICTED: reticulon-like protein B1 [Phoenix dactylifera]
Length=249

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE M YHLLT +CH LI  LAISF+WSNA++F+N+SPP+ P VILP+D  L++A A+
Sbjct  86   WLLFEWMGYHLLTFICHSLIFLLAISFIWSNAASFVNRSPPKFPEVILPEDMFLSIAHAV  145

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R + N   A    +ASGKD+K+FL VIA LWV+S++G+ F+FLTLFY++ ++ +T P LY
Sbjct  146  RYQSNEAFATFIYVASGKDLKQFLMVIASLWVVSIIGSWFSFLTLFYVVFLITYTAPALY  205

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EKYEDQVD   EKA  EI K YAVLNEK L KIP+GP   KK
Sbjct  206  EKYEDQVDTITEKAMVEINKHYAVLNEKVLQKIPRGPFTAKK  247



>gb|KHN12926.1| Reticulon-like protein B1 [Glycine soja]
Length=251

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+ FELM+YHL+T +CH+LI++LA  FLWSNAS FI+KSP  IP V LP++ V  VASAL
Sbjct  91   WIFFELMQYHLITFICHLLIVSLAALFLWSNASVFIHKSPLHIPHVALPEECVHQVASAL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
             IEINR   V+REI +GKD+KKFL+VIA LWV+SV+G+ FNF+TLFYL  V L T+P+LY
Sbjct  151  TIEINRAFVVVREIGTGKDLKKFLSVIAVLWVISVIGSWFNFMTLFYLFFVSLFTLPLLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK  286
            EKYEDQVDA  EKA  EI KQYAV + K LS+IP    K
Sbjct  211  EKYEDQVDALGEKAMIEIKKQYAVFDAKVLSQIPIAGFK  249



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   209 bits (531),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYH LT +CH  + ALA  FLWSNA TFI+K+ P IP V +P+D VL + S L
Sbjct  91   WVLFELIEYHFLTFLCHFAMAALAALFLWSNACTFIHKATPHIPEVHIPEDPVLQLVSGL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR IASG+D+KKF+ VIAGLW+LS++G+  NFLTLFY+  VLL T+P++Y
Sbjct  151  RIEINRGFTVLRNIASGRDLKKFILVIAGLWILSILGSCCNFLTLFYIATVLLFTIPVIY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNE----KYLSKIPKGPLKDKK  277
            EKYED+VDAF EKA  EI KQYAVL+E    K LSKIP+G L  KK
Sbjct  211  EKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE + Y+LLTL+CH+LIL + I F+WSNAS FINK P +IP +   +    +VASAL
Sbjct  97   WLLFEWLGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASAL  156

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR   V+  +ASG+D+KKFL V+AGLW+LSV+G+  NFLTLFY+  V  HTVP+LY
Sbjct  157  RFEINRLFTVIHNVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLY  216

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKKL  274
            EKYEDQVDAF  KA  E  K Y   + K LSKIP+GPLKDKK 
Sbjct  217  EKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>dbj|BAJ94514.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFE+++YHLLTL+ H++I  LAI F+WS A TFI KSPP IP V +P+D  +NV+ AL
Sbjct  98   WVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRAL  157

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R ++NR+L + REIA G D+KKFL VIAGLWVLS +G+  +FLTL Y+ V+++HTVP+LY
Sbjct  158  RNDVNRSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILY  217

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            +KY+D+VD FA KA  E  K Y VL++K LSKIP+GP K KK
Sbjct  218  DKYQDKVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  259



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            WVLFEL+EYHLL+L+CHI ILAL   FLWSNA T INK+ PQIP + +P++  L VAS+L
Sbjct  91   WVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTSPQIPEIHVPEEAFLVVASSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN FNFLTL Y+  V+LHTVPMLY
Sbjct  151  RNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK  280
            EK+ED+VD  AEKA  E+ KQY V +EK LSKIP   LK K
Sbjct  211  EKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPIASLKAK  251



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI ILALA+ FLWS+ASTFI+KSP  IP V +P+D VL +AS L
Sbjct  72   WILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGL  131

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  132  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  191

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLN----EKYLSKIPKG  295
            EKYED+VD F EKA  EI KQY   +     K +SKIPKG
Sbjct  192  EKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG  231



>ref|NP_001130268.1| uncharacterized protein LOC100191362 [Zea mays]
 gb|ACF78438.1| unknown [Zea mays]
 gb|ACG39160.1| seed maturation protein [Zea mays]
 gb|ACL53798.1| unknown [Zea mays]
 gb|AFW78797.1| seed maturation protein [Zea mays]
Length=254

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE+M+YHLLTL+CH LIL LAI FLWSNA+TFINKSPP IP V +P D  +NVA +L
Sbjct  91   WLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINKSPPNIPEVKIPDDLAVNVARSL  150

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R EINR  A LREI  G D+KKFL VIAGLW+LSV+G+  NFLTL Y++ ++L+TVP+LY
Sbjct  151  RYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGSCCNFLTLSYIVFMVLYTVPVLY  210

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK  277
            EK+ED+VDAF EKA  E+ + YA+ +EK LSKIPKGPLKDKK
Sbjct  211  EKHEDKVDAFGEKAMVELKRYYAIFDEKCLSKIPKGPLKDKK  252



>ref|XP_010278922.1| PREDICTED: reticulon-like protein B5 [Nelumbo nucifera]
Length=247

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFE ++YH LT VCH LIL+LAI F+WSN +  +NKSPP  P VILP+D  +++A  L
Sbjct  83   WLLFEWLDYHFLTFVCHSLILSLAILFVWSNFACLVNKSPPNFPEVILPEDIFVSIALTL  142

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            R E NR  +  RE+ASG D+KKFL V+A LW++SV+GN F+FLTLFY++ V+++TVP LY
Sbjct  143  RYEFNRAFSAFREVASGNDMKKFLMVVAVLWIISVVGNWFSFLTLFYIVFVIVYTVPALY  202

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK-DKK  277
            EK+ED+VD+FAEKA  E+ K YAVL+EK L K+PKG L  DKK
Sbjct  203  EKHEDEVDSFAEKAMVEVNKHYAVLDEKVLKKLPKGALNMDKK  245



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  762  WVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASAL  583
            W+LFEL+EY+LLTL  HI ILALA+ FLWS+ASTFI+KSP  IP V +P+D VL +AS L
Sbjct  87   WILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGL  146

Query  582  RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLY  403
            RIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S NFLTL Y+  VLL T+P+LY
Sbjct  147  RIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY  206

Query  402  EKYEDQVDAFAEKAEAEIMKQYAVLN----EKYLSKIPKG  295
            EKYED+VD F EKA  EI KQY   +     K +SKIPKG
Sbjct  207  EKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680