BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF040E12

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789648.1|  PREDICTED: auxin response factor 8-like            284   1e-85   Nicotiana sylvestris
ref|XP_009612885.1|  PREDICTED: auxin response factor 8-like            278   1e-83   Nicotiana tomentosiformis
gb|ABN10955.2|  auxin response factor 8                                 277   4e-83   Ipomoea nil [qian niu]
gb|AFF60411.1|  auxin response factor 8                                 277   5e-83   Nicotiana tabacum [American tobacco]
ref|XP_004231633.1|  PREDICTED: auxin response factor 8                 276   8e-83   Solanum lycopersicum
ref|XP_006350452.1|  PREDICTED: auxin response factor 8-like isof...    274   4e-82   Solanum tuberosum [potatoes]
ref|XP_006350451.1|  PREDICTED: auxin response factor 8-like isof...    274   4e-82   Solanum tuberosum [potatoes]
ref|XP_006350450.1|  PREDICTED: auxin response factor 8-like isof...    270   1e-80   Solanum tuberosum [potatoes]
ref|XP_006350449.1|  PREDICTED: auxin response factor 8-like isof...    270   1e-80   Solanum tuberosum [potatoes]
emb|CBI27335.3|  unnamed protein product                                251   1e-80   Vitis vinifera
ref|XP_009631563.1|  PREDICTED: auxin response factor 8-like isof...    262   1e-77   Nicotiana tomentosiformis
ref|XP_009631564.1|  PREDICTED: auxin response factor 8-like isof...    262   1e-77   Nicotiana tomentosiformis
ref|XP_009769535.1|  PREDICTED: auxin response factor 8-like isof...    260   7e-77   Nicotiana sylvestris
ref|XP_009769536.1|  PREDICTED: auxin response factor 8-like isof...    259   7e-77   Nicotiana sylvestris
ref|XP_009769534.1|  PREDICTED: auxin response factor 8-like isof...    260   7e-77   Nicotiana sylvestris
ref|XP_006343313.1|  PREDICTED: auxin response factor 8-like isof...    255   1e-75   Solanum tuberosum [potatoes]
ref|XP_007221468.1|  hypothetical protein PRUPE_ppa003267mg             251   2e-75   
ref|XP_006343312.1|  PREDICTED: auxin response factor 8-like isof...    255   4e-75   Solanum tuberosum [potatoes]
emb|CDP01733.1|  unnamed protein product                                255   5e-75   Coffea canephora [robusta coffee]
ref|NP_001234783.1|  auxin response factor 8                            254   8e-75   
ref|XP_002266678.2|  PREDICTED: auxin response factor 8                 254   1e-74   Vitis vinifera
ref|XP_010317649.1|  PREDICTED: auxin response factor 8-1 isoform X1    251   5e-74   Solanum lycopersicum
ref|NP_001234552.1|  auxin response factor 8-1                          251   1e-73   Solanum lycopersicum
ref|XP_008343154.1|  PREDICTED: auxin response factor 8 isoform X2      247   3e-72   Malus domestica [apple tree]
ref|XP_008343153.1|  PREDICTED: auxin response factor 8 isoform X1      247   4e-72   
ref|XP_011098000.1|  PREDICTED: auxin response factor 8-like isof...    246   6e-72   
ref|XP_009370590.1|  PREDICTED: auxin response factor 8-like isof...    246   7e-72   Pyrus x bretschneideri [bai li]
ref|XP_011097997.1|  PREDICTED: auxin response factor 8-like isof...    246   7e-72   Sesamum indicum [beniseed]
ref|XP_011097999.1|  PREDICTED: auxin response factor 8-like isof...    246   8e-72   
ref|XP_009370588.1|  PREDICTED: auxin response factor 8-like isof...    246   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_011097996.1|  PREDICTED: auxin response factor 8-like isof...    244   2e-71   
ref|XP_007141982.1|  hypothetical protein PHAVU_008G242400g             245   2e-71   Phaseolus vulgaris [French bean]
ref|XP_011097995.1|  PREDICTED: auxin response factor 8-like isof...    245   2e-71   Sesamum indicum [beniseed]
ref|XP_008348621.1|  PREDICTED: auxin response factor 8-like            242   3e-70   
ref|XP_007146949.1|  hypothetical protein PHAVU_006G084200g             241   5e-70   Phaseolus vulgaris [French bean]
ref|XP_007146950.1|  hypothetical protein PHAVU_006G084200g             241   5e-70   Phaseolus vulgaris [French bean]
ref|XP_009341866.1|  PREDICTED: auxin response factor 8-like isof...    241   6e-70   Pyrus x bretschneideri [bai li]
ref|XP_009341867.1|  PREDICTED: auxin response factor 8-like isof...    241   6e-70   Pyrus x bretschneideri [bai li]
gb|KHN39511.1|  Auxin response factor 8                                 241   6e-70   Glycine soja [wild soybean]
ref|XP_006575467.1|  PREDICTED: auxin response factor 8-like isof...    240   7e-70   Glycine max [soybeans]
ref|XP_010250613.1|  PREDICTED: auxin response factor 8 isoform X2      239   7e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006596491.1|  PREDICTED: auxin response factor 8-like            241   9e-70   Glycine max [soybeans]
gb|KHN41019.1|  Auxin response factor 8                                 240   1e-69   Glycine soja [wild soybean]
ref|XP_003616115.1|  Auxin response factor                              240   2e-69   Medicago truncatula
ref|XP_006575466.1|  PREDICTED: auxin response factor 8-like isof...    240   2e-69   Glycine max [soybeans]
ref|XP_006591281.1|  PREDICTED: auxin response factor 8-like            239   3e-69   Glycine max [soybeans]
ref|XP_010250595.1|  PREDICTED: auxin response factor 8 isoform X1      239   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007032138.1|  Auxin response factor 8-1                          239   4e-69   
ref|XP_004288582.1|  PREDICTED: auxin response factor 8                 237   2e-68   Fragaria vesca subsp. vesca
ref|XP_004490754.1|  PREDICTED: auxin response factor 8-like            236   7e-68   Cicer arietinum [garbanzo]
ref|XP_006430414.1|  hypothetical protein CICLE_v10011065mg             229   1e-67   
ref|XP_008463127.1|  PREDICTED: auxin response factor 8                 234   4e-67   Cucumis melo [Oriental melon]
ref|XP_003553137.1|  PREDICTED: auxin response factor 8-like            233   4e-67   Glycine max [soybeans]
gb|KJB48161.1|  hypothetical protein B456_008G054600                    226   7e-67   Gossypium raimondii
gb|KDO57332.1|  hypothetical protein CISIN_1g003544mg                   230   3e-66   Citrus sinensis [apfelsine]
gb|KDO57329.1|  hypothetical protein CISIN_1g003544mg                   230   3e-66   Citrus sinensis [apfelsine]
gb|KDO57328.1|  hypothetical protein CISIN_1g003544mg                   230   4e-66   Citrus sinensis [apfelsine]
gb|KDO57331.1|  hypothetical protein CISIN_1g003544mg                   230   4e-66   Citrus sinensis [apfelsine]
gb|KDO57330.1|  hypothetical protein CISIN_1g003544mg                   230   4e-66   Citrus sinensis [apfelsine]
gb|KJB48160.1|  hypothetical protein B456_008G054600                    225   5e-66   Gossypium raimondii
ref|XP_006430416.1|  hypothetical protein CICLE_v10011065mg             230   5e-66   Citrus clementina [clementine]
ref|XP_004148912.1|  PREDICTED: auxin response factor 8-like            229   2e-65   
gb|AFQ94050.1|  auxin response factor 1                                 228   3e-65   Camellia sinensis [black tea]
ref|XP_006481965.1|  PREDICTED: auxin response factor 8-like isof...    228   4e-65   Citrus sinensis [apfelsine]
ref|XP_004162834.1|  PREDICTED: auxin response factor 8-like            228   4e-65   
ref|XP_006481964.1|  PREDICTED: auxin response factor 8-like isof...    228   4e-65   Citrus sinensis [apfelsine]
ref|XP_004500428.1|  PREDICTED: auxin response factor 8-like            227   8e-65   
gb|KJB48159.1|  hypothetical protein B456_008G054600                    226   1e-64   Gossypium raimondii
ref|XP_008227867.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    223   4e-63   Prunus mume [ume]
gb|KDP36369.1|  hypothetical protein JCGZ_09784                         222   6e-63   Jatropha curcas
gb|ABK95913.1|  unknown                                                 216   2e-62   Populus trichocarpa [western balsam poplar]
gb|ADG60256.1|  ARF8-like protein                                       202   4e-62   Nicotiana tabacum [American tobacco]
ref|XP_002305917.2|  hypothetical protein POPTR_0004s07640g             217   3e-61   
gb|EYU25686.1|  hypothetical protein MIMGU_mgv1a002020mg                213   3e-60   Erythranthe guttata [common monkey flower]
ref|XP_006372462.1|  hypothetical protein POPTR_0017s01870g             213   7e-60   
ref|XP_002526195.1|  Auxin response factor, putative                    211   3e-59   
ref|XP_011038345.1|  PREDICTED: auxin response factor 8-like            210   1e-58   Populus euphratica
gb|KEH34585.1|  auxin response factor 2                                 204   1e-57   Medicago truncatula
gb|ACB30859.1|  ARF8                                                    191   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870511.1|  hypothetical protein ARALYDRAFT_493698             206   2e-57   
ref|XP_010450467.1|  PREDICTED: auxin response factor 8 isoform X1      205   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010435545.1|  PREDICTED: auxin response factor 8-like            205   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010450468.1|  PREDICTED: auxin response factor 8 isoform X2      205   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010440819.1|  PREDICTED: auxin response factor 8-like isof...    205   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003600594.1|  Auxin response factor                              205   6e-57   Medicago truncatula
ref|XP_011048868.1|  PREDICTED: auxin response factor 8-like            204   8e-57   Populus euphratica
ref|XP_010551627.1|  PREDICTED: auxin response factor 8-like isof...    204   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_006282445.1|  hypothetical protein CARUB_v10004139mg             204   1e-56   
emb|CBA12001.1|  putative auxin response factor 8                       204   1e-56   Illicium parviflorum
ref|XP_006282446.1|  hypothetical protein CARUB_v10004139mg             204   1e-56   Capsella rubella
ref|XP_010528612.1|  PREDICTED: auxin response factor 8-like            202   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_010551611.1|  PREDICTED: auxin response factor 8-like isof...    199   5e-55   Tarenaya hassleriana [spider flower]
gb|KJB10499.1|  hypothetical protein B456_001G204500                    199   9e-55   Gossypium raimondii
ref|XP_009382091.1|  PREDICTED: auxin response factor 12-like           198   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG29290.1|  Auxin response factor 12                                198   2e-54   Gossypium arboreum [tree cotton]
ref|NP_198518.1|  auxin response factor 8                               197   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139710.1|  PREDICTED: auxin response factor 8 isoform X3      195   1e-53   Brassica rapa
ref|XP_009139708.1|  PREDICTED: auxin response factor 8 isoform X1      196   1e-53   Brassica rapa
ref|XP_009139709.1|  PREDICTED: auxin response factor 8 isoform X2      195   1e-53   Brassica rapa
emb|CDY53537.1|  BnaCnng25410D                                          195   2e-53   Brassica napus [oilseed rape]
ref|XP_009397958.1|  PREDICTED: auxin response factor 12-like iso...    194   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940284.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    195   2e-53   
ref|XP_009397956.1|  PREDICTED: auxin response factor 12-like iso...    195   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675199.1|  PREDICTED: auxin response factor 8 isoform X1      194   4e-53   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX74594.1|  BnaA04g07950D                                          193   6e-53   
ref|XP_008813064.1|  PREDICTED: auxin response factor 12-like iso...    191   7e-53   Phoenix dactylifera
ref|XP_008813056.1|  PREDICTED: auxin response factor 12-like iso...    190   2e-52   
ref|XP_010935427.1|  PREDICTED: auxin response factor 12-like iso...    191   3e-52   
ref|XP_010935431.1|  PREDICTED: auxin response factor 12-like iso...    191   4e-52   
ref|XP_008813049.1|  PREDICTED: auxin response factor 12-like iso...    191   4e-52   Phoenix dactylifera
ref|XP_010908226.1|  PREDICTED: auxin response factor 12-like           191   6e-52   Elaeis guineensis
ref|NP_001170351.1|  uncharacterized protein LOC100384328               181   4e-51   
ref|NP_001169029.1|  uncharacterized protein LOC100382863               174   7e-51   
ref|XP_008804149.1|  PREDICTED: auxin response factor 12-like           187   8e-51   Phoenix dactylifera
ref|XP_006391521.1|  hypothetical protein EUTSA_v10018139mg             187   1e-50   Eutrema salsugineum [saltwater cress]
gb|ACI46673.1|  auxin response factor 8                                 172   1e-50   Solanum lycopersicum
gb|AEV41036.1|  putative auxin response factor                          185   5e-50   Oryza minuta
gb|AEV40985.1|  putative auxin response factor                          185   5e-50   Oryza punctata
emb|CBI30949.3|  unnamed protein product                                173   6e-50   Vitis vinifera
gb|AIE88287.1|  hypothetical protein OG_BBa0063K01.18                   185   6e-50   Oryza glaberrima
gb|AEV41081.1|  putative auxin response factor                          185   6e-50   Oryza minuta
sp|Q258Y5.1|ARFL_ORYSI  RecName: Full=Auxin response factor 12; A...    185   7e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001054222.1|  Os04g0671900                                       185   7e-50   
gb|AEV41129.1|  putative auxin response factor                          185   7e-50   Oryza officinalis
gb|EEC78229.1|  hypothetical protein OsI_17874                          185   7e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006653864.1|  PREDICTED: auxin response factor 12-like           185   7e-50   
dbj|BAB85918.1|  auxin response factor 8                                184   7e-50   Oryza sativa [red rice]
emb|CDP16075.1|  unnamed protein product                                185   1e-49   Coffea canephora [robusta coffee]
ref|XP_004960119.1|  PREDICTED: auxin response factor 12-like iso...    184   1e-49   
dbj|BAJ89575.1|  predicted protein                                      179   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBA11998.1|  putative auxin response factor 8                       182   6e-49   Cabomba aquatica
gb|EMS64768.1|  Auxin response factor 12                                181   9e-49   Triticum urartu
gb|EMT27817.1|  Auxin response factor 12                                181   1e-48   
ref|XP_003580798.1|  PREDICTED: auxin response factor 12                181   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_006430415.1|  hypothetical protein CICLE_v10011065mg             180   2e-48   
ref|XP_008662154.1|  PREDICTED: uncharacterized protein LOC100382...    180   2e-48   Zea mays [maize]
ref|XP_010275911.1|  PREDICTED: auxin response factor 6-like isof...    181   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008662153.1|  PREDICTED: uncharacterized protein LOC100382...    180   3e-48   
gb|AFW59850.1|  hypothetical protein ZEAMMB73_643249                    180   3e-48   
tpg|DAA35415.1|  TPA: hypothetical protein ZEAMMB73_535909              180   3e-48   
gb|ADG43164.1|  auxin response factor 30                                180   3e-48   Zea mays [maize]
gb|ADG43137.1|  auxin response factor 3                                 180   3e-48   Zea mays [maize]
gb|KGN50892.1|  hypothetical protein Csa_5G315370                       179   4e-48   Cucumis sativus [cucumbers]
ref|XP_010275910.1|  PREDICTED: auxin response factor 6-like isof...    181   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_002447305.1|  hypothetical protein SORBIDRAFT_06g032500          178   1e-47   
emb|CDQ51986.1|  auxin response factor                                  166   4e-47   Fagus sylvatica
ref|XP_009385053.1|  PREDICTED: auxin response factor 6-like            178   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275037.1|  PREDICTED: auxin response factor 6                 178   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008229616.1|  PREDICTED: auxin response factor 6-like isof...    175   4e-46   Prunus mume [ume]
ref|XP_008229615.1|  PREDICTED: auxin response factor 6-like isof...    175   5e-46   
ref|XP_010941528.1|  PREDICTED: auxin response factor 17-like iso...    174   6e-46   
ref|XP_011085226.1|  PREDICTED: auxin response factor 6-like isof...    174   1e-45   Sesamum indicum [beniseed]
ref|XP_010941526.1|  PREDICTED: auxin response factor 17-like iso...    174   1e-45   Elaeis guineensis
ref|XP_010923656.1|  PREDICTED: auxin response factor 17 isoform X1     174   1e-45   
ref|XP_007048898.1|  Auxin response factor 6 isoform 2                  174   1e-45   
ref|XP_011085227.1|  PREDICTED: auxin response factor 6-like isof...    174   1e-45   Sesamum indicum [beniseed]
ref|XP_010923658.1|  PREDICTED: auxin response factor 17 isoform X2     174   1e-45   
ref|XP_004134558.1|  PREDICTED: auxin response factor 6-like            174   1e-45   
ref|XP_002279808.1|  PREDICTED: auxin response factor 6                 174   1e-45   Vitis vinifera
ref|XP_009797609.1|  PREDICTED: auxin response factor 6-like isof...    173   2e-45   Nicotiana sylvestris
ref|XP_004166469.1|  PREDICTED: auxin response factor 6-like            174   2e-45   
ref|XP_009797608.1|  PREDICTED: auxin response factor 6-like isof...    173   2e-45   Nicotiana sylvestris
gb|KDO57333.1|  hypothetical protein CISIN_1g003544mg                   172   2e-45   Citrus sinensis [apfelsine]
gb|KDO57334.1|  hypothetical protein CISIN_1g003544mg                   172   2e-45   Citrus sinensis [apfelsine]
dbj|BAD19063.1|  auxin response factor 3                                173   2e-45   Cucumis sativus [cucumbers]
gb|KDO57335.1|  hypothetical protein CISIN_1g003544mg                   172   2e-45   Citrus sinensis [apfelsine]
ref|XP_008439586.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    173   3e-45   Cucumis melo [Oriental melon]
ref|XP_004293501.1|  PREDICTED: auxin response factor 6                 172   4e-45   Fragaria vesca subsp. vesca
ref|XP_009627654.1|  PREDICTED: auxin response factor 6-like isof...    172   4e-45   Nicotiana tomentosiformis
ref|XP_009627652.1|  PREDICTED: auxin response factor 6-like isof...    172   4e-45   Nicotiana tomentosiformis
ref|XP_010052021.1|  PREDICTED: auxin response factor 6                 172   5e-45   Eucalyptus grandis [rose gum]
ref|XP_009627653.1|  PREDICTED: auxin response factor 6-like isof...    172   5e-45   Nicotiana tomentosiformis
ref|XP_009602213.1|  PREDICTED: auxin response factor 6-like isof...    172   5e-45   Nicotiana tomentosiformis
ref|XP_009602214.1|  PREDICTED: auxin response factor 6-like isof...    172   5e-45   Nicotiana tomentosiformis
gb|KDP38016.1|  hypothetical protein JCGZ_04659                         171   8e-45   Jatropha curcas
ref|XP_009757615.1|  PREDICTED: auxin response factor 6-like isof...    171   8e-45   Nicotiana sylvestris
ref|XP_009757616.1|  PREDICTED: auxin response factor 6-like isof...    171   8e-45   Nicotiana sylvestris
ref|XP_007024965.1|  Auxin response factor 6 isoform 4                  169   1e-44   
ref|XP_011468187.1|  PREDICTED: auxin response factor 6-like isof...    171   1e-44   Fragaria vesca subsp. vesca
ref|XP_004304523.1|  PREDICTED: auxin response factor 6-like isof...    171   1e-44   Fragaria vesca subsp. vesca
ref|XP_006481966.1|  PREDICTED: auxin response factor 8-like isof...    170   2e-44   
ref|XP_010106165.1|  Auxin response factor 6                            171   2e-44   
ref|XP_006468259.1|  PREDICTED: auxin response factor 6-like isof...    170   2e-44   Citrus sinensis [apfelsine]
ref|XP_007217690.1|  hypothetical protein PRUPE_ppa001069mg             170   2e-44   Prunus persica
ref|XP_006468258.1|  PREDICTED: auxin response factor 6-like isof...    170   2e-44   Citrus sinensis [apfelsine]
ref|XP_006448968.1|  hypothetical protein CICLE_v10014198mg             170   2e-44   Citrus clementina [clementine]
gb|ABK95163.1|  unknown                                                 170   2e-44   Populus trichocarpa [western balsam poplar]
gb|AFW68990.1|  hypothetical protein ZEAMMB73_088581                    167   3e-44   
gb|ADH04265.1|  ARF1                                                    169   4e-44   Nicotiana benthamiana
gb|KHG28199.1|  Auxin response factor 6                                 169   4e-44   Gossypium arboreum [tree cotton]
ref|XP_011096635.1|  PREDICTED: auxin response factor 6 isoform X1      170   4e-44   Sesamum indicum [beniseed]
ref|XP_011096637.1|  PREDICTED: auxin response factor 6 isoform X3      170   4e-44   Sesamum indicum [beniseed]
ref|XP_011096636.1|  PREDICTED: auxin response factor 6 isoform X2      169   4e-44   Sesamum indicum [beniseed]
ref|XP_007024962.1|  Auxin response factor 6 isoform 1                  169   4e-44   Theobroma cacao [chocolate]
ref|XP_007024963.1|  Auxin response factor 6 isoform 2                  169   5e-44   Theobroma cacao [chocolate]
ref|XP_011032737.1|  PREDICTED: auxin response factor 6-like isof...    169   6e-44   Populus euphratica
ref|XP_011032738.1|  PREDICTED: auxin response factor 6-like isof...    169   6e-44   Populus euphratica
ref|XP_011085439.1|  PREDICTED: auxin response factor 6-like            169   6e-44   Sesamum indicum [beniseed]
ref|XP_002307574.2|  hypothetical protein POPTR_0005s22930g             169   6e-44   Populus trichocarpa [western balsam poplar]
gb|KJB57191.1|  hypothetical protein B456_009G152700                    168   9e-44   Gossypium raimondii
ref|XP_003563403.1|  PREDICTED: auxin response factor 17                169   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_008776642.1|  PREDICTED: auxin response factor 17-like           168   1e-43   
ref|XP_006357892.1|  PREDICTED: auxin response factor 6-like isof...    168   1e-43   Solanum tuberosum [potatoes]
ref|XP_009393314.1|  PREDICTED: auxin response factor 17-like           168   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD19064.1|  auxin response factor 4                                167   1e-43   Cucumis sativus [cucumbers]
ref|XP_006357893.1|  PREDICTED: auxin response factor 6-like isof...    168   1e-43   Solanum tuberosum [potatoes]
gb|KJB57190.1|  hypothetical protein B456_009G152700                    168   1e-43   Gossypium raimondii
gb|AHY24213.1|  auxin response factor                                   168   2e-43   Dimocarpus longan [longan]
ref|XP_004150775.1|  PREDICTED: auxin response factor 6-like            168   2e-43   Cucumis sativus [cucumbers]
ref|XP_010090447.1|  Auxin response factor 6                            168   2e-43   Morus notabilis
ref|XP_004164684.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    167   2e-43   
gb|AIF77047.1|  auxin response factor 8                                 154   2e-43   Hevea brasiliensis [jebe]
ref|XP_002298839.1|  auxin response factor 6 family protein             167   2e-43   
ref|XP_008444734.1|  PREDICTED: auxin response factor 6-like            167   2e-43   Cucumis melo [Oriental melon]
gb|ACM66271.1|  ARF8                                                    167   2e-43   Solanum melongena [aubergine]
emb|CBA11997.1|  putative auxin response factor 6                       167   3e-43   Cabomba aquatica
ref|XP_009399037.1|  PREDICTED: auxin response factor 17                167   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW89820.1|  hypothetical protein EUGRSUZ_A020652                    164   3e-43   Eucalyptus grandis [rose gum]
ref|XP_010908740.1|  PREDICTED: auxin response factor 17-like iso...    165   4e-43   
gb|AFW68989.1|  hypothetical protein ZEAMMB73_088581                    166   4e-43   
ref|NP_001234663.1|  auxin response factor 6                            167   4e-43   Solanum lycopersicum
gb|ADK91822.1|  auxin response factor 6                                 167   4e-43   Solanum lycopersicum
ref|NP_001280959.1|  auxin response factor 6-like                       166   5e-43   Malus domestica [apple tree]
ref|XP_008777704.1|  PREDICTED: auxin response factor 17-like           166   5e-43   Phoenix dactylifera
ref|XP_007212802.1|  hypothetical protein PRUPE_ppa001179mg             166   5e-43   
ref|XP_008225531.1|  PREDICTED: auxin response factor 6                 166   6e-43   Prunus mume [ume]
ref|XP_009376828.1|  PREDICTED: auxin response factor 6-like            166   6e-43   Pyrus x bretschneideri [bai li]
gb|KHG10285.1|  Auxin response factor 6 -like protein                   166   7e-43   Gossypium arboreum [tree cotton]
ref|XP_010233862.1|  PREDICTED: auxin response factor 6-like isof...    166   7e-43   
ref|XP_010233861.1|  PREDICTED: auxin response factor 6-like isof...    166   7e-43   Brachypodium distachyon [annual false brome]
ref|XP_003575362.1|  PREDICTED: auxin response factor 6-like isof...    166   7e-43   Brachypodium distachyon [annual false brome]
ref|XP_009105160.1|  PREDICTED: auxin response factor 8-like            165   8e-43   Brassica rapa
emb|CDY07460.1|  BnaA07g25390D                                          165   9e-43   Brassica napus [oilseed rape]
ref|XP_008644237.1|  PREDICTED: uncharacterized protein LOC100502...    166   9e-43   Zea mays [maize]
ref|XP_009402570.1|  PREDICTED: auxin response factor 6-like isof...    166   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371797.1|  PREDICTED: auxin response factor 6-like            166   9e-43   
ref|XP_009402572.1|  PREDICTED: auxin response factor 6-like isof...    166   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB69886.1|  hypothetical protein B456_011G048200                    166   9e-43   Gossypium raimondii
ref|XP_009360948.1|  PREDICTED: auxin response factor 6                 166   9e-43   Pyrus x bretschneideri [bai li]
ref|XP_009377485.1|  PREDICTED: auxin response factor 6-like            166   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_002438851.1|  hypothetical protein SORBIDRAFT_10g027220          166   1e-42   Sorghum bicolor [broomcorn]
ref|XP_010908738.1|  PREDICTED: auxin response factor 17-like iso...    166   1e-42   
gb|ADG43156.1|  auxin response factor 22                                166   1e-42   Zea mays [maize]
ref|XP_010908734.1|  PREDICTED: auxin response factor 17-like iso...    166   1e-42   Elaeis guineensis
ref|XP_006594518.1|  PREDICTED: auxin response factor 6-like isof...    165   1e-42   
ref|XP_007159383.1|  hypothetical protein PHAVU_002G233600g             165   1e-42   Phaseolus vulgaris [French bean]
gb|EYU19157.1|  hypothetical protein MIMGU_mgv1a001449mg                165   1e-42   Erythranthe guttata [common monkey flower]
gb|ACB30835.1|  ARF6                                                    152   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054260.1|  PREDICTED: auxin response factor 6-like            165   2e-42   
ref|XP_006594517.1|  PREDICTED: auxin response factor 6-like isof...    165   2e-42   Glycine max [soybeans]
ref|XP_003542951.1|  PREDICTED: auxin response factor 6-like isof...    165   2e-42   Glycine max [soybeans]
gb|KHN47353.1|  Auxin response factor 6                                 165   2e-42   Glycine soja [wild soybean]
ref|XP_008794474.1|  PREDICTED: auxin response factor 17                165   2e-42   Phoenix dactylifera
ref|XP_011012265.1|  PREDICTED: auxin response factor 6-like            165   2e-42   Populus euphratica
emb|CDY39274.1|  BnaC06g27170D                                          164   3e-42   Brassica napus [oilseed rape]
ref|XP_011047524.1|  PREDICTED: auxin response factor 6-like isof...    164   3e-42   Populus euphratica
ref|XP_011047523.1|  PREDICTED: auxin response factor 6-like isof...    164   3e-42   Populus euphratica
gb|ADG43152.1|  auxin response factor 18                                164   3e-42   Zea mays [maize]
ref|XP_010540604.1|  PREDICTED: auxin response factor 6-like isof...    162   4e-42   Tarenaya hassleriana [spider flower]
gb|KHG06791.1|  Auxin response factor 6 -like protein                   163   4e-42   Gossypium arboreum [tree cotton]
emb|CDP05666.1|  unnamed protein product                                164   4e-42   Coffea canephora [robusta coffee]
gb|ABF69979.1|  transcriptional factor B3 family protein                164   5e-42   Musa acuminata [banana]
ref|XP_010540603.1|  PREDICTED: auxin response factor 6-like isof...    163   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010540601.1|  PREDICTED: auxin response factor 6-like isof...    163   6e-42   Tarenaya hassleriana [spider flower]
gb|ACB30851.1|  ARF6                                                    150   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59345.1|  auxin response factor 3                                 161   6e-42   Genlisea aurea
ref|XP_007141460.1|  hypothetical protein PHAVU_008G197600g             163   7e-42   Phaseolus vulgaris [French bean]
ref|XP_006351989.1|  PREDICTED: auxin response factor 6-like isof...    163   8e-42   Solanum tuberosum [potatoes]
ref|XP_006351990.1|  PREDICTED: auxin response factor 6-like isof...    163   8e-42   Solanum tuberosum [potatoes]
gb|AJE26133.1|  auxin response factors                                  163   9e-42   Salix matsudana [tortured willow]
ref|XP_006597510.1|  PREDICTED: auxin response factor 6-like isof...    162   1e-41   Glycine max [soybeans]
ref|XP_009384197.1|  PREDICTED: auxin response factor 17-like iso...    162   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399230.1|  PREDICTED: auxin response factor 17-like           162   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371645.1|  PREDICTED: auxin response factor 6                 162   2e-41   Malus domestica [apple tree]
ref|XP_003546066.1|  PREDICTED: auxin response factor 6-like isof...    162   2e-41   Glycine max [soybeans]
gb|KHN06947.1|  Auxin response factor 6                                 162   2e-41   Glycine soja [wild soybean]
ref|XP_006597509.1|  PREDICTED: auxin response factor 6-like isof...    162   2e-41   Glycine max [soybeans]
ref|XP_009384193.1|  PREDICTED: auxin response factor 17-like iso...    162   2e-41   
emb|CDY09598.1|  BnaC05g23210D                                          161   3e-41   Brassica napus [oilseed rape]
ref|XP_009115164.1|  PREDICTED: auxin response factor 6 isoform X1      161   3e-41   
ref|XP_009115165.1|  PREDICTED: auxin response factor 6 isoform X2      161   3e-41   
emb|CDY02285.1|  BnaA09g26170D                                          161   3e-41   
ref|XP_011026192.1|  PREDICTED: auxin response factor 6-like isof...    161   4e-41   
ref|XP_011026193.1|  PREDICTED: auxin response factor 6-like isof...    161   4e-41   
ref|XP_004966207.1|  PREDICTED: auxin response factor 17-like           161   4e-41   
gb|KHG01675.1|  Auxin response factor 6 -like protein                   160   4e-41   
ref|XP_010538262.1|  PREDICTED: auxin response factor 6                 161   4e-41   
ref|XP_003593869.1|  Auxin response factor                              160   5e-41   
ref|XP_002300854.2|  hypothetical protein POPTR_0002s05590g             161   6e-41   
gb|KJB49004.1|  hypothetical protein B456_008G097200                    160   7e-41   
dbj|BAB08972.1|  auxin responsive transcription factor                  160   7e-41   
ref|NP_001078672.1|  auxin response factor 8                            159   7e-41   
gb|KJB49005.1|  hypothetical protein B456_008G097200                    160   7e-41   
gb|KFK27496.1|  hypothetical protein AALP_AA8G390400                    160   8e-41   
gb|EYU42851.1|  hypothetical protein MIMGU_mgv1a001422mg                160   9e-41   
gb|EMT11111.1|  Auxin response factor 17                                160   9e-41   
ref|XP_006415484.1|  hypothetical protein EUTSA_v10006747mg             160   9e-41   
ref|XP_006415485.1|  hypothetical protein EUTSA_v10006747mg             160   9e-41   
ref|XP_010657096.1|  PREDICTED: auxin response factor 17-like           160   1e-40   
gb|KHN12428.1|  Auxin response factor 6                                 159   1e-40   
ref|XP_003531170.1|  PREDICTED: auxin response factor 6-like isof...    159   1e-40   
ref|XP_006585093.1|  PREDICTED: auxin response factor 6-like isof...    159   1e-40   
ref|XP_006656378.1|  PREDICTED: auxin response factor 17-like           159   1e-40   
gb|EMT32630.1|  Auxin response factor 6                                 159   2e-40   
gb|EMS51666.1|  Auxin response factor 17                                159   2e-40   
emb|CBI22060.3|  unnamed protein product                                159   2e-40   
ref|NP_001058360.1|  Os06g0677800                                       159   2e-40   
ref|XP_010478417.1|  PREDICTED: auxin response factor 6 isoform X1      159   2e-40   
gb|KJB33383.1|  hypothetical protein B456_006G008700                    159   2e-40   
ref|XP_010499564.1|  PREDICTED: auxin response factor 6-like isof...    159   2e-40   
sp|A2YG67.1|ARFQ_ORYSI  RecName: Full=Auxin response factor 17          159   2e-40   
ref|XP_010478419.1|  PREDICTED: auxin response factor 6 isoform X3      159   2e-40   
ref|XP_010478420.1|  PREDICTED: auxin response factor 6 isoform X4      159   2e-40   
ref|XP_010499562.1|  PREDICTED: auxin response factor 6-like isof...    159   2e-40   
ref|XP_006306714.1|  hypothetical protein CARUB_v10008239mg             159   2e-40   
ref|XP_010499563.1|  PREDICTED: auxin response factor 6-like isof...    159   2e-40   
ref|XP_010478418.1|  PREDICTED: auxin response factor 6 isoform X2      159   2e-40   
ref|XP_002893612.1|  hypothetical protein ARALYDRAFT_473256             159   3e-40   
ref|NP_174323.1|  auxin response factor 6                               159   3e-40   
ref|NP_001031115.1|  auxin response factor 6                            159   3e-40   
ref|XP_010499561.1|  PREDICTED: auxin response factor 6-like isof...    159   3e-40   
ref|XP_010940157.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    159   3e-40   
gb|KJB57192.1|  hypothetical protein B456_009G152700                    159   3e-40   
ref|XP_010462991.1|  PREDICTED: auxin response factor 6-like            158   3e-40   
ref|NP_001045993.1|  Os02g0164900                                       159   3e-40   
gb|KDO63437.1|  hypothetical protein CISIN_1g002390mg                   158   4e-40   
ref|XP_010688801.1|  PREDICTED: auxin response factor 6 isoform X1      159   4e-40   
ref|XP_010688802.1|  PREDICTED: auxin response factor 6 isoform X2      158   4e-40   
gb|KDO63434.1|  hypothetical protein CISIN_1g002390mg                   158   5e-40   
ref|XP_004485979.1|  PREDICTED: auxin response factor 6-like            158   5e-40   
ref|XP_006468969.1|  PREDICTED: auxin response factor 6-like            158   6e-40   
gb|KDO63433.1|  hypothetical protein CISIN_1g002390mg                   158   6e-40   
gb|KHN12007.1|  Auxin response factor 6                                 158   6e-40   
ref|XP_006595764.1|  PREDICTED: auxin response factor 6-like            158   6e-40   
gb|KDO63436.1|  hypothetical protein CISIN_1g002390mg                   158   6e-40   
ref|XP_006646917.1|  PREDICTED: auxin response factor 6-like            157   7e-40   
ref|XP_004504543.1|  PREDICTED: auxin response factor 6-like isof...    157   8e-40   
ref|XP_004504542.1|  PREDICTED: auxin response factor 6-like isof...    157   8e-40   
ref|XP_011007615.1|  PREDICTED: auxin response factor 6-like            157   9e-40   
gb|KEH20527.1|  auxin response factor 2                                 157   1e-39   
ref|XP_006446840.1|  hypothetical protein CICLE_v10014200mg             157   1e-39   
gb|KEH20526.1|  auxin response factor 2                                 157   1e-39   
gb|KEH20525.1|  auxin response factor 2                                 157   1e-39   
ref|XP_010675200.1|  PREDICTED: auxin response factor 8 isoform X2      156   1e-39   
emb|CDX90245.1|  BnaA08g17390D                                          156   1e-39   
gb|EMS45463.1|  Auxin response factor 6                                 157   1e-39   
ref|XP_002316773.1|  auxin response factor 6 family protein             157   1e-39   
ref|XP_006847975.1|  hypothetical protein AMTR_s00029p00157690          156   2e-39   
ref|XP_010549536.1|  PREDICTED: auxin response factor 6-like            155   2e-39   
emb|CDY12048.1|  BnaC03g59640D                                          154   8e-39   
ref|XP_003519519.1|  PREDICTED: auxin response factor 6-like            154   1e-38   
ref|XP_008784820.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    154   1e-38   
gb|KJB69885.1|  hypothetical protein B456_011G048200                    153   2e-38   
ref|XP_002451599.1|  hypothetical protein SORBIDRAFT_04g004430          153   4e-38   
gb|ADG43143.1|  auxin response factor 9                                 152   7e-38   
ref|NP_001146279.1|  uncharacterized protein LOC100279854               152   7e-38   
ref|XP_007158734.1|  hypothetical protein PHAVU_002G177600g             152   8e-38   
ref|XP_002443554.1|  hypothetical protein SORBIDRAFT_08g021460          152   8e-38   
ref|XP_008672720.1|  PREDICTED: uncharacterized protein LOC100279...    152   9e-38   
ref|XP_008679929.1|  PREDICTED: auxin response factor 6 isoform X2      151   1e-37   
ref|XP_008679931.1|  PREDICTED: auxin response factor 6 isoform X3      151   1e-37   
emb|CBA12003.1|  putative auxin response factor 6/8                     151   1e-37   
ref|XP_008679928.1|  PREDICTED: auxin response factor 6 isoform X1      151   1e-37   
gb|ADG43150.1|  auxin response factor 16                                151   2e-37   
ref|XP_004963222.1|  PREDICTED: auxin response factor 25-like           150   2e-37   
emb|CBA11994.1|  putative auxin response factor 6                       149   6e-37   
ref|XP_006580853.1|  PREDICTED: auxin response factor 6-like            149   6e-37   
ref|XP_004951872.1|  PREDICTED: auxin response factor 6-like isof...    149   7e-37   
ref|XP_004951871.1|  PREDICTED: auxin response factor 6-like isof...    149   7e-37   
gb|KHN46047.1|  Auxin response factor 6                                 149   8e-37   
ref|XP_008799332.1|  PREDICTED: auxin response factor 12-like           144   1e-36   
emb|CAE03604.2|  OSJNBb0004A17.6                                        148   1e-36   
ref|XP_009109594.1|  PREDICTED: auxin response factor 6-like            147   3e-36   
ref|XP_010237021.1|  PREDICTED: auxin response factor 25-like           146   5e-36   
ref|XP_006664743.1|  PREDICTED: auxin response factor 25-like           146   5e-36   
dbj|BAB85915.1|  auxin response factor 6b                               146   7e-36   
gb|EAY83881.1|  hypothetical protein OsI_39101                          146   7e-36   
ref|NP_001067266.1|  Os12g0613700                                       146   7e-36   
gb|AIB05454.1|  ARF transcription factor                                145   1e-35   
ref|XP_008662061.1|  PREDICTED: auxin response factor 25-like           145   1e-35   
tpg|DAA35416.1|  TPA: hypothetical protein ZEAMMB73_535909              142   9e-35   
ref|XP_006836327.1|  hypothetical protein AMTR_s00092p00072950          142   2e-34   
emb|CBA12002.1|  putative auxin response factor 6/8                     142   2e-34   
dbj|BAK00026.1|  predicted protein                                      140   9e-34   
gb|EMS45696.1|  Auxin response factor 25                                139   3e-33   
ref|XP_010927184.1|  PREDICTED: auxin response factor 19-like iso...    138   5e-33   
gb|EMT04282.1|  Auxin response factor 25                                138   6e-33   
ref|XP_010927183.1|  PREDICTED: auxin response factor 19-like iso...    138   7e-33   
ref|XP_007048897.1|  Auxin response factor 6 isoform 1                  138   8e-33   
ref|XP_002990954.1|  hypothetical protein SELMODRAFT_451392             137   9e-33   
emb|CBA12004.1|  putative auxin response factor 5/7                     136   2e-32   
ref|XP_008801434.1|  PREDICTED: auxin response factor 19-like           135   6e-32   
ref|XP_002982854.1|  hypothetical protein SELMODRAFT_179736             134   7e-32   
gb|AAN16891.1|  auxin-responsive factor protein                         125   1e-31   
ref|XP_008645235.1|  PREDICTED: auxin response factor 5-like            134   3e-31   
gb|ADG43154.1|  auxin response factor 20                                134   3e-31   
ref|XP_010263345.1|  PREDICTED: auxin response factor 19-like iso...    133   3e-31   
gb|ABR25348.1|  auxin responsive protein                                125   3e-31   
ref|XP_010263344.1|  PREDICTED: auxin response factor 19-like iso...    133   3e-31   
ref|NP_001045857.2|  Os02g0141100                                       127   4e-31   
ref|XP_008798163.1|  PREDICTED: auxin response factor 19-like iso...    132   6e-31   
ref|XP_008798164.1|  PREDICTED: auxin response factor 19-like iso...    132   7e-31   
ref|XP_009390467.1|  PREDICTED: auxin response factor 19-like iso...    132   7e-31   
ref|XP_009390465.1|  PREDICTED: auxin response factor 19-like iso...    132   1e-30   
ref|XP_008648946.1|  PREDICTED: auxin response factor 17-like iso...    128   1e-30   
ref|XP_001771108.1|  predicted protein                                  122   1e-30   
ref|XP_001773496.1|  predicted protein                                  131   1e-30   
ref|XP_010929406.1|  PREDICTED: auxin response factor 19-like iso...    131   1e-30   
ref|XP_010929405.1|  PREDICTED: auxin response factor 19-like iso...    131   2e-30   
emb|CDP12498.1|  unnamed protein product                                130   3e-30   
ref|XP_010246955.1|  PREDICTED: auxin response factor 5-like isof...    130   4e-30   
ref|XP_010246954.1|  PREDICTED: auxin response factor 5-like isof...    130   4e-30   
ref|XP_009627655.1|  PREDICTED: auxin response factor 6-like isof...    129   6e-30   
ref|XP_010048534.1|  PREDICTED: auxin response factor 19-like iso...    129   6e-30   
ref|XP_010048535.1|  PREDICTED: auxin response factor 19-like iso...    129   7e-30   
gb|KCW80808.1|  hypothetical protein EUGRSUZ_C02178                     129   7e-30   
gb|EMT16165.1|  Auxin response factor 5                                 129   7e-30   
ref|XP_010048533.1|  PREDICTED: auxin response factor 19-like iso...    129   7e-30   
gb|AFW76012.1|  hypothetical protein ZEAMMB73_306865                    127   8e-30   
ref|XP_002453284.1|  hypothetical protein SORBIDRAFT_04g003240          129   9e-30   
emb|CAN80371.1|  hypothetical protein VITISV_014723                     129   9e-30   
gb|EMS48643.1|  Auxin response factor 5                                 129   1e-29   
gb|EEC72457.1|  hypothetical protein OsI_05804                          129   1e-29   
ref|XP_010656700.1|  PREDICTED: auxin response factor 19-like           129   1e-29   
emb|CBI24055.3|  unnamed protein product                                129   1e-29   
ref|XP_001764067.1|  predicted protein                                  128   1e-29   
ref|XP_009362016.1|  PREDICTED: auxin response factor 19-like           129   1e-29   
sp|Q6Z2W3.2|ARFE_ORYSJ  RecName: Full=Auxin response factor 5           129   1e-29   
ref|XP_006648299.1|  PREDICTED: auxin response factor 5-like            129   1e-29   
gb|EEE56277.1|  hypothetical protein OsJ_05331                          129   1e-29   
dbj|BAD10267.1|  putative auxin response factor 7a                      128   1e-29   
ref|XP_003630611.1|  Auxin response factor                              128   1e-29   
ref|XP_008391414.1|  PREDICTED: auxin response factor 19-like           128   1e-29   
ref|XP_008648945.1|  PREDICTED: auxin response factor 17-like iso...    128   2e-29   
ref|XP_002437545.1|  hypothetical protein SORBIDRAFT_10g029130          128   2e-29   
ref|XP_010106948.1|  Auxin response factor 5                            128   2e-29   
gb|KDP27747.1|  hypothetical protein JCGZ_19776                         127   2e-29   
ref|XP_003563519.1|  PREDICTED: auxin response factor 19-like           127   3e-29   
gb|EYU25750.1|  hypothetical protein MIMGU_mgv1a0007531mg               127   3e-29   
ref|XP_006372205.1|  auxin response factor 2 family protein             127   3e-29   
ref|XP_010259931.1|  PREDICTED: auxin response factor 19-like           127   3e-29   
gb|KDO63435.1|  hypothetical protein CISIN_1g002390mg                   127   4e-29   
ref|XP_011017617.1|  PREDICTED: auxin response factor 19-like           127   4e-29   
ref|XP_003517174.1|  PREDICTED: auxin response factor 19-like iso...    127   5e-29   
gb|KHN32922.1|  Auxin response factor 5                                 127   5e-29   
ref|XP_008387956.1|  PREDICTED: auxin response factor 5                 126   5e-29   
ref|XP_009417514.1|  PREDICTED: auxin response factor 19-like           127   6e-29   
ref|XP_002519813.1|  Auxin response factor, putative                    126   6e-29   
ref|XP_009413973.1|  PREDICTED: auxin response factor 19-like iso...    126   6e-29   
ref|XP_009399614.1|  PREDICTED: auxin response factor 19-like           126   7e-29   
ref|XP_009413972.1|  PREDICTED: auxin response factor 19-like iso...    126   7e-29   
ref|XP_004951920.1|  PREDICTED: auxin response factor 5-like            126   8e-29   
ref|XP_011077666.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    126   8e-29   
gb|EEC81270.1|  hypothetical protein OsI_24368                          126   8e-29   
gb|EEE66311.1|  hypothetical protein OsJ_22545                          126   8e-29   
gb|AFW69357.1|  hypothetical protein ZEAMMB73_033328                    126   8e-29   
sp|Q0D9R7.2|ARFS_ORYSJ  RecName: Full=Auxin response factor 19; A...    126   8e-29   
ref|XP_008645045.1|  PREDICTED: auxin response factor 19-like iso...    126   8e-29   
ref|XP_004966097.1|  PREDICTED: auxin response factor 19-like iso...    126   8e-29   
dbj|BAB85916.1|  auxin response factor 7a                               126   8e-29   
ref|XP_008645044.1|  PREDICTED: auxin response factor 19-like iso...    126   9e-29   
gb|EPS73545.1|  hypothetical protein M569_01212                         124   9e-29   
ref|XP_009762810.1|  PREDICTED: auxin response factor 19-like iso...    125   1e-28   
ref|XP_008450783.1|  PREDICTED: auxin response factor 19-like           126   1e-28   
ref|NP_001058492.2|  Os06g0702600                                       125   1e-28   
ref|XP_004966098.1|  PREDICTED: auxin response factor 19-like iso...    126   1e-28   
ref|XP_009762809.1|  PREDICTED: auxin response factor 19-like iso...    126   1e-28   
ref|XP_006656453.1|  PREDICTED: auxin response factor 19-like           125   1e-28   
ref|XP_010669598.1|  PREDICTED: auxin response factor 19-like           125   1e-28   
ref|XP_007152995.1|  hypothetical protein PHAVU_004G177600g             125   1e-28   
ref|XP_008341148.1|  PREDICTED: auxin response factor 19-like           125   1e-28   
ref|XP_006850956.1|  hypothetical protein AMTR_s00025p00198750          125   1e-28   
gb|AHK10582.1|  auxin response factor                                   125   1e-28   
ref|NP_001234740.1|  auxin response factor 19                           125   2e-28   
ref|XP_002984990.1|  hypothetical protein SELMODRAFT_181404             125   2e-28   
ref|XP_002986179.1|  hypothetical protein SELMODRAFT_182255             125   2e-28   
gb|KDO75361.1|  hypothetical protein CISIN_1g002624mg                   124   2e-28   
pdb|4CHK|A  Chain A, Crystal Structure Of The Arf5 Oligomerizatio...    115   2e-28   
gb|KHN16698.1|  Auxin response factor 5                                 124   3e-28   
gb|KJB49006.1|  hypothetical protein B456_008G097200                    124   3e-28   
ref|XP_006365636.1|  PREDICTED: auxin response factor 19-like           124   3e-28   
gb|KJB74820.1|  hypothetical protein B456_012G009000                    124   3e-28   
gb|KJB74819.1|  hypothetical protein B456_012G009000                    124   3e-28   
ref|XP_009335256.1|  PREDICTED: auxin response factor 5                 124   3e-28   
dbj|BAD19062.1|  auxin response factor 2                                124   3e-28   
gb|AAZ81522.1|  auxin response factor 2                                 124   3e-28   
ref|XP_007014531.1|  Transcriptional factor B3 family protein / a...    124   3e-28   
gb|KJB74822.1|  hypothetical protein B456_012G009000                    124   3e-28   
ref|XP_004168159.1|  PREDICTED: uncharacterized LOC101205542            124   3e-28   
gb|KHG10687.1|  Auxin response factor 5                                 124   3e-28   
ref|XP_006580496.1|  PREDICTED: auxin response factor 19-like iso...    124   4e-28   
ref|XP_009594540.1|  PREDICTED: auxin response factor 19-like           124   4e-28   
ref|XP_004152893.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   4e-28   
ref|XP_003529091.1|  PREDICTED: auxin response factor 19-like           124   4e-28   
ref|XP_003532453.1|  PREDICTED: auxin response factor 19-like iso...    124   4e-28   
gb|KHN40318.1|  Auxin response factor 5                                 124   4e-28   
ref|XP_006580495.1|  PREDICTED: auxin response factor 19-like iso...    124   4e-28   
gb|EYU26557.1|  hypothetical protein MIMGU_mgv1a000668mg                124   5e-28   
gb|AAB84358.1|  IAA21                                                   120   5e-28   
ref|XP_003524425.1|  PREDICTED: auxin response factor 19-like iso...    124   6e-28   



>ref|XP_009789648.1| PREDICTED: auxin response factor 8-like [Nicotiana sylvestris]
Length=845

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY Y+QDSS+L+H+AG VDPL  T  FVKVYKSGSVGRSLDITRFNSYHEL
Sbjct  686  LGTSGFQNSLYGYVQDSSDLLHNAGQVDPLNATRTFVKVYKSGSVGRSLDITRFNSYHEL  745

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  746  RQELGQMFGIEGFLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQ  805

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+E E+L+R  +ERMN++ ADGRDF+SGLPS+GSLEY
Sbjct  806  KLGKEEVETLNRGSLERMNSNSADGRDFMSGLPSIGSLEY  845



>ref|XP_009612885.1| PREDICTED: auxin response factor 8-like [Nicotiana tomentosiformis]
Length=843

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY Y+QDSS+L+H+AG VD L  T  FVKVYKSGSVGRSLDITRFNSYHEL
Sbjct  684  LGTSGFQNSLYGYVQDSSDLLHNAGQVDSLNATRTFVKVYKSGSVGRSLDITRFNSYHEL  743

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  744  RQELGQMFGIEGFLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  803

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+E ESL+R  +ERMN++ ADGRDF+SGLPS+GSLEY
Sbjct  804  KLGKEEVESLNRGSLERMNSNSADGRDFMSGLPSIGSLEY  843



>gb|ABN10955.2| auxin response factor 8 [Ipomoea nil]
Length=838

 Score =   277 bits (708),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            GASGFQNS Y Y+QDSSEL+ SAG VDP TP + F+KVYKSG VGRSLDITR +SYHELR
Sbjct  681  GASGFQNSPYGYVQDSSELVSSAGQVDPSTPRT-FIKVYKSGYVGRSLDITRISSYHELR  739

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            QEL QM+GIEGLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ 
Sbjct  740  QELAQMFGIEGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQK  799

Query  355  LGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            LGKQEA+SLSRN +ERMN SGADGRD LSG PSLGSLEY
Sbjct  800  LGKQEAKSLSRNTMERMNGSGADGRDHLSGFPSLGSLEY  838



>gb|AFF60411.1| auxin response factor 8 [Nicotiana tabacum]
Length=843

 Score =   277 bits (708),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY Y+QDSS+L+H+AG VD L  T  FVKVYKSGSVGRSLDITRFNSYHEL
Sbjct  684  LGTSGFQNSLYGYVQDSSDLLHNAGQVDSLNATRTFVKVYKSGSVGRSLDITRFNSYHEL  743

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  744  RQELGQMFGIEGFLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  803

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+E ESL+R  +ERMN++ ADGRDF+SGLPS+GSL+Y
Sbjct  804  KLGKEEVESLNRGSLERMNSNSADGRDFMSGLPSIGSLDY  843



>ref|XP_004231633.1| PREDICTED: auxin response factor 8 [Solanum lycopersicum]
Length=842

 Score =   276 bits (706),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG+QNSLY Y+QDSSEL+H+AG +DP   T  FVKVYKSG VGRSLDIT+F+SYHEL
Sbjct  683  LGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHEL  742

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  743  RRELGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  802

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+EAESL+R  VERM+++ AD RD +SG+PSLGSLEY
Sbjct  803  KLGKEEAESLNRGAVERMSSTNADDRDLISGMPSLGSLEY  842



>ref|XP_006350452.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum]
Length=839

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG+QNSLY Y+QDSSEL+H+AG +DP   T  FVKVYKSG VGRSLDIT+F+SYHEL
Sbjct  680  LGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHEL  739

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  740  RRELGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  799

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+E ESL+R  VERM+++ AD RD +SG+PSLGSLEY
Sbjct  800  KLGKEEVESLNRGAVERMSSTSADDRDLISGMPSLGSLEY  839



>ref|XP_006350451.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum]
Length=840

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG+QNSLY Y+QDSSEL+H+AG +DP   T  FVKVYKSG VGRSLDIT+F+SYHEL
Sbjct  681  LGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHEL  740

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  741  RRELGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  800

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+E ESL+R  VERM+++ AD RD +SG+PSLGSLEY
Sbjct  801  KLGKEEVESLNRGAVERMSSTSADDRDLISGMPSLGSLEY  840



>ref|XP_006350450.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum]
Length=837

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG+QNSLY Y+QDSSEL+H+AG +DP   T  FVKVYKSG VGRSLDIT+F+SYHEL
Sbjct  678  LGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHEL  737

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG L+DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  738  RRELGQMFGIEGFLKDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  797

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+EAESL+   VERM+++ AD +D +SG+PSLGSLEY
Sbjct  798  KLGKEEAESLNHGAVERMSSTSADDQDLISGMPSLGSLEY  837



>ref|XP_006350449.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum]
Length=838

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG+QNSLY Y+QDSSEL+H+AG +DP   T  FVKVYKSG VGRSLDIT+F+SYHEL
Sbjct  679  LGASGYQNSLYGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHEL  738

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG L+DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  739  RRELGQMFGIEGFLKDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  798

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+EAESL+   VERM+++ AD +D +SG+PSLGSLEY
Sbjct  799  KLGKEEAESLNHGAVERMSSTSADDQDLISGMPSLGSLEY  838



>emb|CBI27335.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASGFQ SL+  +QD SEL+ +AG VDP TP+  FVKVYKSGSVGRSLDITRF+SYHEL
Sbjct  3    LGASGFQGSLFGCVQDPSELLQNAGQVDPPTPSRTFVKVYKSGSVGRSLDITRFSSYHEL  62

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  63   REELGQMFGIEGKLENPLRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQ  122

Query  358  TLGKQEAES-LSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +GKQ  ES  S N  +RMN+SG D RD +SGLPS GSLEY
Sbjct  123  KMGKQGIESGFSPNSAQRMNSSGTDDRDLVSGLPSAGSLEY  163



>ref|XP_009631563.1| PREDICTED: auxin response factor 8-like isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SG+QNSLY Y+QDSSEL+H+AG  DP   + +FVKVYKSG VGRSLDIT+F+SYHELR+E
Sbjct  684  SGYQNSLYGYVQDSSELLHNAGQNDPPNASHSFVKVYKSGCVGRSLDITQFHSYHELRRE  743

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LG
Sbjct  744  LGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLG  803

Query  349  KQEAESLSRNVVERMNTS-GADGRDFLSGLPSLGSLEY  239
            K+EA+SL+R VVERM++S  AD RD +SG+PSLGSLEY
Sbjct  804  KEEAKSLNRGVVERMSSSTSADDRDLVSGMPSLGSLEY  841



>ref|XP_009631564.1| PREDICTED: auxin response factor 8-like isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SG+QNSLY Y+QDSSEL+H+AG  DP   + +FVKVYKSG VGRSLDIT+F+SYHELR+E
Sbjct  682  SGYQNSLYGYVQDSSELLHNAGQNDPPNASHSFVKVYKSGCVGRSLDITQFHSYHELRRE  741

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LG
Sbjct  742  LGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLG  801

Query  349  KQEAESLSRNVVERMNTS-GADGRDFLSGLPSLGSLEY  239
            K+EA+SL+R VVERM++S  AD RD +SG+PSLGSLEY
Sbjct  802  KEEAKSLNRGVVERMSSSTSADDRDLVSGMPSLGSLEY  839



>ref|XP_009769535.1| PREDICTED: auxin response factor 8-like isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SG+QNSLY Y+QDSSEL+H+AG  DP   +  FVKVYKSG VGRSLDIT+F+SYHELR+E
Sbjct  684  SGYQNSLYGYVQDSSELLHNAGQNDPPNASHTFVKVYKSGCVGRSLDITQFHSYHELRRE  743

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LG
Sbjct  744  LGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLG  803

Query  349  KQEAESLSRNVVERMNTSGADG-RDFLSGLPSLGSLEY  239
            K+EAESL+R  VERM++S + G RD +SG+PSLGSLEY
Sbjct  804  KEEAESLNRGAVERMSSSTSAGDRDLVSGMPSLGSLEY  841



>ref|XP_009769536.1| PREDICTED: auxin response factor 8-like isoform X3 [Nicotiana 
sylvestris]
Length=808

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SG+QNSLY Y+QDSSEL+H+AG  DP   +  FVKVYKSG VGRSLDIT+F+SYHELR+E
Sbjct  651  SGYQNSLYGYVQDSSELLHNAGQNDPPNASHTFVKVYKSGCVGRSLDITQFHSYHELRRE  710

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LG
Sbjct  711  LGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLG  770

Query  349  KQEAESLSRNVVERMNTSGADG-RDFLSGLPSLGSLEY  239
            K+EAESL+R  VERM++S + G RD +SG+PSLGSLEY
Sbjct  771  KEEAESLNRGAVERMSSSTSAGDRDLVSGMPSLGSLEY  808



>ref|XP_009769534.1| PREDICTED: auxin response factor 8-like isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SG+QNSLY Y+QDSSEL+H+AG  DP   +  FVKVYKSG VGRSLDIT+F+SYHELR+E
Sbjct  686  SGYQNSLYGYVQDSSELLHNAGQNDPPNASHTFVKVYKSGCVGRSLDITQFHSYHELRRE  745

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LG
Sbjct  746  LGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLG  805

Query  349  KQEAESLSRNVVERMNTSGADG-RDFLSGLPSLGSLEY  239
            K+EAESL+R  VERM++S + G RD +SG+PSLGSLEY
Sbjct  806  KEEAESLNRGAVERMSSSTSAGDRDLVSGMPSLGSLEY  843



>ref|XP_006343313.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum]
Length=752

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NSLY Y+QDSS+++H+ G VD  T    FVKVYKS S+GRSLDITRFNSYHEL
Sbjct  592  LGTSGFSNSLYGYVQDSSDMLHNVGQVDAQTAPRTFVKVYKSASLGRSLDITRFNSYHEL  651

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LEDPQRSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDVQ
Sbjct  652  RQELGQMFGIEGFLEDPQRSGWQLVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQ  711

Query  358  TLGKQEAESLSRNVVERMNTSG-ADGRDFLSGLPSLGSLEY  239
             LGK+E  SL+R + ERM+++  ADGRDF+SGL S+GSLEY
Sbjct  712  KLGKEEVGSLNRGLPERMSSNNSADGRDFMSGLSSIGSLEY  752



>ref|XP_007221468.1| hypothetical protein PRUPE_ppa003267mg [Prunus persica]
 gb|EMJ22667.1| hypothetical protein PRUPE_ppa003267mg [Prunus persica]
Length=588

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+SLY  MQDSSEL+HSAG VDP TP   FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  429  LGDSGFQSSLYGCMQDSSELLHSAGQVDPPTPNCTFVKVYKSGSVGRSLDISRFSSYHEL  488

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LED  RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV 
Sbjct  489  REELGQMFGIEGKLEDRLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVH  548

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G Q  E  S N  +R+N+ G + +D +SGLPSLGSLEY
Sbjct  549  KMGDQAVEPFSPNTGQRLNSGGGEAQDIVSGLPSLGSLEY  588



>ref|XP_006343312.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum]
Length=848

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NSLY Y+QDSS+++H+ G VD  T    FVKVYKS S+GRSLDITRFNSYHEL
Sbjct  688  LGTSGFSNSLYGYVQDSSDMLHNVGQVDAQTAPRTFVKVYKSASLGRSLDITRFNSYHEL  747

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LEDPQRSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDVQ
Sbjct  748  RQELGQMFGIEGFLEDPQRSGWQLVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQ  807

Query  358  TLGKQEAESLSRNVVERMNTSG-ADGRDFLSGLPSLGSLEY  239
             LGK+E  SL+R + ERM+++  ADGRDF+SGL S+GSLEY
Sbjct  808  KLGKEEVGSLNRGLPERMSSNNSADGRDFMSGLSSIGSLEY  848



>emb|CDP01733.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQN LY ++ DSSEL+H  G   P T    FVKV+K G VGRSLDI+RFNSYHEL
Sbjct  687  LGDSGFQNPLYGFVHDSSELLHGTGQDSP-TRARTFVKVHKLGCVGRSLDISRFNSYHEL  745

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQMYGIEGLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPE+VQ
Sbjct  746  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEEVQ  805

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGKQE ESLSR   ERMN+S  DGRD ++  PSLGSLEY
Sbjct  806  KLGKQEGESLSRIAAERMNSSSGDGRDMVARFPSLGSLEY  845



>ref|NP_001234783.1| auxin response factor 8 [Solanum lycopersicum]
 gb|ABS83388.1| auxin response factor 8 [Solanum lycopersicum]
Length=844

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF N LY Y+QDS++L+H+ G  D  T    FVKVYKS S+GRSLDITRFNSYHEL
Sbjct  684  LGTSGFPNPLYSYVQDSTDLLHNVGQADAQTVPRTFVKVYKSASLGRSLDITRFNSYHEL  743

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEGLLEDPQRSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDVQ
Sbjct  744  RQELGQMFGIEGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQ  803

Query  358  TLGKQEAESLSRNVVERMNTSG-ADGRDFLSGLPSLGSLEY  239
             LGK+E  SL+R   ERM+++  ADGRDF+SGLPS+GSL+Y
Sbjct  804  KLGKEEVGSLNRGPPERMSSNNSADGRDFMSGLPSIGSLDY  844



>ref|XP_002266678.2| PREDICTED: auxin response factor 8 [Vitis vinifera]
Length=846

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASGFQ SL+  +QD SEL+ +AG VDP TP+  FVKVYKSGSVGRSLDITRF+SYHEL
Sbjct  686  LGASGFQGSLFGCVQDPSELLQNAGQVDPPTPSRTFVKVYKSGSVGRSLDITRFSSYHEL  745

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  746  REELGQMFGIEGKLENPLRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQ  805

Query  358  TLGKQEAES-LSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +GKQ  ES  S N  +RMN+SG D RD +SGLPS GSLEY
Sbjct  806  KMGKQGIESGFSPNSAQRMNSSGTDDRDLVSGLPSAGSLEY  846



>ref|XP_010317649.1| PREDICTED: auxin response factor 8-1 isoform X1 [Solanum lycopersicum]
Length=748

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF N LY Y+QDS++L+H+ G  D  T    FVKVYKS S+GRSLDITRFNSYHEL
Sbjct  588  LGTSGFPNPLYSYVQDSTDLLHNVGQADAQTVPRTFVKVYKSASLGRSLDITRFNSYHEL  647

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LE+PQRSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDVQ
Sbjct  648  RQELGQMFGIEGFLENPQRSGWQLVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQ  707

Query  358  TLGKQEAESLSRNVVERMNTSG-ADGRDFLSGLPSLGSLEY  239
             LGK+E  SL+R   ERM+++  ADGRDF+SGLPS+GSL+Y
Sbjct  708  KLGKEEVGSLNRGPPERMSSNNSADGRDFMSGLPSIGSLDY  748



>ref|NP_001234552.1| auxin response factor 8-1 [Solanum lycopersicum]
 gb|ADK92393.1| auxin response factor 8-1 [Solanum lycopersicum]
Length=844

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF N LY Y+QDS++L+H+ G  D  T    FVKVYKS S+GRSLDITRFNSYHEL
Sbjct  684  LGTSGFPNPLYSYVQDSTDLLHNVGQADAQTVPRTFVKVYKSASLGRSLDITRFNSYHEL  743

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GIEG LE+PQRSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDVQ
Sbjct  744  RQELGQMFGIEGFLENPQRSGWQLVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQ  803

Query  358  TLGKQEAESLSRNVVERMNTSG-ADGRDFLSGLPSLGSLEY  239
             LGK+E  SL+R   ERM+++  ADGRDF+SGLPS+GSL+Y
Sbjct  804  KLGKEEVGSLNRGPPERMSSNNSADGRDFMSGLPSIGSLDY  844



>ref|XP_008343154.1| PREDICTED: auxin response factor 8 isoform X2 [Malus domestica]
Length=793

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SG Q SLY  MQDSSEL+HSAG VDP TP +  FVKVYKSGSVGRSLDI+RF+SYHE
Sbjct  633  LGDSGLQRSLYGCMQDSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRFSSYHE  692

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LED  RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  693  LREELGQMFGIEGKLEDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  752

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+ G +G+D +SGLPSLGSLEY
Sbjct  753  HKMGHQAVESFSPNTGQRLNSGGGEGQDIVSGLPSLGSLEY  793



>ref|XP_008343153.1| PREDICTED: auxin response factor 8 isoform X1 [Malus domestica]
Length=847

 Score =   247 bits (631),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SG Q SLY  MQDSSEL+HSAG VDP TP +  FVKVYKSGSVGRSLDI+RF+SYHE
Sbjct  687  LGDSGLQRSLYGCMQDSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRFSSYHE  746

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LED  RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  747  LREELGQMFGIEGKLEDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  806

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+ G +G+D +SGLPSLGSLEY
Sbjct  807  HKMGHQAVESFSPNTGQRLNSGGGEGQDIVSGLPSLGSLEY  847



>ref|XP_011098000.1| PREDICTED: auxin response factor 8-like isoform X3 [Sesamum indicum]
Length=804

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG Q+ LY Y+QDSS+++HS G VD  TP   FVKVYK+GSVGRSLDI RFNSY EL
Sbjct  647  LGASGHQSPLYGYVQDSSDVLHSTGQVDQSTPDHTFVKVYKTGSVGRSLDIGRFNSYQEL  706

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GI+GLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  707  RQELGQMFGIKGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  766

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK EAESLSR+ VER+     D ++ + GLPSLGSLEY
Sbjct  767  RLGKDEAESLSRSAVERIPND--DTQNPVCGLPSLGSLEY  804



>ref|XP_009370590.1| PREDICTED: auxin response factor 8-like isoform X2 [Pyrus x bretschneideri]
Length=794

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SG Q+SLY  MQDSSEL+HSAG VDP TP +  FVKVYKSGSVGRSLDI+R +SYHE
Sbjct  634  LGDSGLQSSLYGCMQDSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRVSSYHE  693

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LED  RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  694  LREELGQMFGIEGKLEDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  753

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+SG +G+D +SGLPSLGSLEY
Sbjct  754  HKMGHQAVESFSPNTGQRLNSSGGEGQDIVSGLPSLGSLEY  794



>ref|XP_011097997.1| PREDICTED: auxin response factor 8-like isoform X1 [Sesamum indicum]
 ref|XP_011097998.1| PREDICTED: auxin response factor 8-like isoform X1 [Sesamum indicum]
Length=832

 Score =   246 bits (629),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG Q+ LY Y+QDSS+++HS G VD  TP   FVKVYK+GSVGRSLDI RFNSY EL
Sbjct  675  LGASGHQSPLYGYVQDSSDVLHSTGQVDQSTPDHTFVKVYKTGSVGRSLDIGRFNSYQEL  734

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GI+GLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  735  RQELGQMFGIKGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  794

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK EAESLSR+ VER+     D ++ + GLPSLGSLEY
Sbjct  795  RLGKDEAESLSRSAVERIPND--DTQNPVCGLPSLGSLEY  832



>ref|XP_011097999.1| PREDICTED: auxin response factor 8-like isoform X2 [Sesamum indicum]
Length=817

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG Q+ LY Y+QDSS+++HS G VD  TP   FVKVYK+GSVGRSLDI RFNSY EL
Sbjct  660  LGASGHQSPLYGYVQDSSDVLHSTGQVDQSTPDHTFVKVYKTGSVGRSLDIGRFNSYQEL  719

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GI+GLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  720  RQELGQMFGIKGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  779

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK EAESLSR+ VER+     D ++ + GLPSLGSLEY
Sbjct  780  RLGKDEAESLSRSAVERIPND--DTQNPVCGLPSLGSLEY  817



>ref|XP_009370588.1| PREDICTED: auxin response factor 8-like isoform X1 [Pyrus x bretschneideri]
Length=848

 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SG Q+SLY  MQDSSEL+HSAG VDP TP +  FVKVYKSGSVGRSLDI+R +SYHE
Sbjct  688  LGDSGLQSSLYGCMQDSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRVSSYHE  747

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LED  RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  748  LREELGQMFGIEGKLEDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  807

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+SG +G+D +SGLPSLGSLEY
Sbjct  808  HKMGHQAVESFSPNTGQRLNSSGGEGQDIVSGLPSLGSLEY  848



>ref|XP_011097996.1| PREDICTED: auxin response factor 8-like isoform X2 [Sesamum indicum]
Length=741

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG Q+ LY Y+QDSS+++HS G VD  TP   FVKVYK+GSVGRSLDI RFNSY EL
Sbjct  584  LGASGHQSPLYGYVQDSSDVLHSTGQVDQPTPDHTFVKVYKTGSVGRSLDIGRFNSYQEL  643

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GI+GLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  644  RQELGQMFGIKGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  703

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+EAESLSR+ VER+++   + ++ +  LPSLGSLEY
Sbjct  704  RLGKEEAESLSRSAVERIHSD--ETQNPVCSLPSLGSLEY  741



>ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
 gb|ESW13976.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
Length=844

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ SLY  +QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  685  LGESGFQASLYPCVQDSSELLRSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  744

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  745  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  804

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +  +R+N++GAD  + +SGLPS+GSLEY
Sbjct  805  KMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY  844



>ref|XP_011097995.1| PREDICTED: auxin response factor 8-like isoform X1 [Sesamum indicum]
Length=837

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASG Q+ LY Y+QDSS+++HS G VD  TP   FVKVYK+GSVGRSLDI RFNSY EL
Sbjct  680  LGASGHQSPLYGYVQDSSDVLHSTGQVDQPTPDHTFVKVYKTGSVGRSLDIGRFNSYQEL  739

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            RQELGQM+GI+GLLEDPQRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDV 
Sbjct  740  RQELGQMFGIKGLLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVL  799

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGK+EAESLSR+ VER+++   + ++ +  LPSLGSLEY
Sbjct  800  RLGKEEAESLSRSAVERIHSD--ETQNPVCSLPSLGSLEY  837



>ref|XP_008348621.1| PREDICTED: auxin response factor 8-like [Malus domestica]
Length=841

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG +GFQ+SLY  MQDSSEL+H AG VDP TP +  FVKVYKSGSVGRS+DI+RF+SYHE
Sbjct  681  LGNTGFQSSLYGCMQDSSELLHGAGQVDPPTPNNCTFVKVYKSGSVGRSIDISRFSSYHE  740

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LE   RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  741  LREELGQMFGIEGKLEYRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  800

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+SG +G+D +SG PSLGSLEY
Sbjct  801  HKMGHQAVESFSPNTGQRLNSSGCEGQDIVSGPPSLGSLEY  841



>ref|XP_007146949.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
 gb|ESW18943.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
Length=840

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ SL+  MQDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  681  LGESGFQGSLFGCMQDSSELLQSAGHVDPQNQTQTFVKVYKSGSVGRSLDISRFSSYHEL  740

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  741  REELAQMFGIEGKLEDPPRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  800

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL+    +R+N +GA+ +D +SG PS+GSL+Y
Sbjct  801  KMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLDY  840



>ref|XP_007146950.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
 gb|ESW18944.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
Length=841

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ SL+  MQDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  682  LGESGFQGSLFGCMQDSSELLQSAGHVDPQNQTQTFVKVYKSGSVGRSLDISRFSSYHEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  742  REELAQMFGIEGKLEDPPRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  801

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL+    +R+N +GA+ +D +SG PS+GSL+Y
Sbjct  802  KMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLDY  841



>ref|XP_009341866.1| PREDICTED: auxin response factor 8-like isoform X1 [Pyrus x bretschneideri]
Length=844

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SGFQ+SLY  MQDSSEL+H AG VDP TP +  FVKVYKSGSVGRS+DI+RF+SYHE
Sbjct  685  LGNSGFQSSLYGCMQDSSELLHGAGQVDPPTPNNCTFVKVYKSGSVGRSIDISRFSSYHE  744

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LE   RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  745  LREELGQMFGIEGKLEYRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  804

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+SG +G+D +SGLPSLGSLEY
Sbjct  805  HKMGHQAVESFSPNTGQRLNSSGCEGQD-VSGLPSLGSLEY  844



>ref|XP_009341867.1| PREDICTED: auxin response factor 8-like isoform X2 [Pyrus x bretschneideri]
Length=841

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSA-FVKVYKSGSVGRSLDITRFNSYHE  542
            LG SGFQ+SLY  MQDSSEL+H AG VDP TP +  FVKVYKSGSVGRS+DI+RF+SYHE
Sbjct  682  LGNSGFQSSLYGCMQDSSELLHGAGQVDPPTPNNCTFVKVYKSGSVGRSIDISRFSSYHE  741

Query  541  LRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            LR+ELGQM+GIEG LE   RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV
Sbjct  742  LREELGQMFGIEGKLEYRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDV  801

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
              +G Q  ES S N  +R+N+SG +G+D +SGLPSLGSLEY
Sbjct  802  HKMGHQAVESFSPNTGQRLNSSGCEGQD-VSGLPSLGSLEY  841



>gb|KHN39511.1| Auxin response factor 8 [Glycine soja]
Length=823

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            +G SGFQ+ LY  +QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  664  IGESGFQSPLYPCVQDSSELVQSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  723

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+ 
Sbjct  724  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIH  783

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +   R+N++GAD  + +SGLPS+GSLEY
Sbjct  784  KMGEQAVESLGPSSGHRLNSTGADSHEIVSGLPSIGSLEY  823



>ref|XP_006575467.1| PREDICTED: auxin response factor 8-like isoform X2 [Glycine max]
Length=750

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+ LY   QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  591  LGESGFQSPLYPCGQDSSELVQSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  650

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+ 
Sbjct  651  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIH  710

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +  +R+N++GAD  + +SGLPS+GSLEY
Sbjct  711  KMGEQALESLGPSPGQRLNSTGADSHEIVSGLPSIGSLEY  750



>ref|XP_010250613.1| PREDICTED: auxin response factor 8 isoform X2 [Nelumbo nucifera]
Length=704

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
             G SGFQNSLY  M++SS+L++SAG VDP  PT  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  547  FGGSGFQNSLYGCMENSSDLLNSAGQVDP--PTRTFVKVYKSGSVGRSLDISRFSSYHEL  604

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIE  LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ
Sbjct  605  REELGQMFGIEEQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQ  664

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGKQE ++LS N  +R + S  D R+F SG+ S+GSLEY
Sbjct  665  KLGKQEVDALSSNGDQRHSNSSYDVRNFTSGISSVGSLEY  704



>ref|XP_006596491.1| PREDICTED: auxin response factor 8-like [Glycine max]
Length=843

 Score =   241 bits (614),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            +G SGFQ+ LY  +QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  684  IGESGFQSPLYPCVQDSSELVQSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  743

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+ 
Sbjct  744  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIH  803

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +   R+N++GAD  + +SGLPS+GSLEY
Sbjct  804  KMGEQAVESLGPSSGHRLNSTGADSHEIVSGLPSIGSLEY  843



>gb|KHN41019.1| Auxin response factor 8 [Glycine soja]
Length=846

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+ LY   QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  687  LGESGFQSPLYPCGQDSSELVQSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  746

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+ 
Sbjct  747  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIH  806

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +  +R+N++GAD  + +SGLPS+GSLEY
Sbjct  807  KMGEQALESLGPSPGQRLNSTGADSHEIVSGLPSIGSLEY  846



>ref|XP_003616115.1| Auxin response factor [Medicago truncatula]
 gb|AES99073.1| auxin response factor 2 [Medicago truncatula]
Length=841

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG S FQ S Y  MQDSSEL+ SAG VD    T  FVKVYKSGSVGRSLDI+RFNSYHEL
Sbjct  682  LGESSFQGSPYPCMQDSSELLQSAGQVDAQNQTPIFVKVYKSGSVGRSLDISRFNSYHEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  742  REELAQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  801

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G++  ESL  +  +RMN +GA+  D +SGLPSLGSLEY
Sbjct  802  KMGEEAIESLGPSSGQRMNNTGAESHDIVSGLPSLGSLEY  841



>ref|XP_006575466.1| PREDICTED: auxin response factor 8-like isoform X1 [Glycine max]
Length=847

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+ LY   QDSSEL+ SAG VDP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  688  LGESGFQSPLYPCGQDSSELVQSAGQVDPQNQTRTFVKVYKSGSVGRSLDISRFSSYHEL  747

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+ 
Sbjct  748  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIH  807

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +  +R+N++GAD  + +SGLPS+GSLEY
Sbjct  808  KMGEQALESLGPSPGQRLNSTGADSHEIVSGLPSIGSLEY  847



>ref|XP_006591281.1| PREDICTED: auxin response factor 8-like [Glycine max]
Length=844

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            L  SGFQ SLY  MQDSSEL+ SAG  DP   T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  685  LAESGFQGSLYGCMQDSSELLQSAGHTDPENQTQTFVKVYKSGSVGRSLDISRFSSYHEL  744

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  745  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  804

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G Q  ESL+    +R+N +GA+ +D +SG PS+GSLEY
Sbjct  805  KMGDQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY  844



>ref|XP_010250595.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
 ref|XP_010250602.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
Length=844

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
             G SGFQNSLY  M++SS+L++SAG VDP  PT  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  687  FGGSGFQNSLYGCMENSSDLLNSAGQVDP--PTRTFVKVYKSGSVGRSLDISRFSSYHEL  744

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIE  LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ
Sbjct  745  REELGQMFGIEEQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQ  804

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             LGKQE ++LS N  +R + S  D R+F SG+ S+GSLEY
Sbjct  805  KLGKQEVDALSSNGDQRHSNSSYDVRNFTSGISSVGSLEY  844



>ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao]
 gb|EOY03064.1| Auxin response factor 8-1 [Theobroma cacao]
Length=838

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG   FQN L+  MQDSSEL  S G VDP TPT  FVKVYKSGSVGRSLDI+RF+SYH
Sbjct  678  IPLGDPSFQNPLFGCMQDSSEL-QSTGQVDPPTPTRTFVKVYKSGSVGRSLDISRFSSYH  736

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPW+AFVNNVWYIKILSPED
Sbjct  737  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWDAFVNNVWYIKILSPED  796

Query  364  VQTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            VQ +G+Q  E  S    +RMN+SG   RD +SGL S+GSLEY
Sbjct  797  VQKMGEQRVEPFSPTPGQRMNSSGTGARDRVSGLSSVGSLEY  838



>ref|XP_004288582.1| PREDICTED: auxin response factor 8 [Fragaria vesca subsp. vesca]
Length=835

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+SLY  +QDS+EL+H AG VDP TP   FVKVYKSGSVGRSLDI+RF+SY++L
Sbjct  676  LGDSGFQSSLYGCIQDSTELLHGAGQVDPPTPNCTFVKVYKSGSVGRSLDISRFSSYNQL  735

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LED  RSGWQLVFVDRE+D+LLLGDDPWE+FVNNVWYIKILSPEDV 
Sbjct  736  REELAQMFGIEGKLEDCLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDVH  795

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G Q  +S + N  +R+N+S  + +D +SGLPSLGSLEY
Sbjct  796  KMGDQAVDSFTPNAGQRVNSSANETQDHISGLPSLGSLEY  835



>ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cicer arietinum]
Length=833

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ S Y  MQDSSEL+ SAG +D    T  FVKVYK GSVGRSLDI+RFNSYHEL
Sbjct  674  LGESGFQGSPYPCMQDSSELLQSAGQIDNQNQTPTFVKVYKVGSVGRSLDISRFNSYHEL  733

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
             +EL QM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  734  WEELAQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  793

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL  +  +R+N +GA+  D +SGLPSLGSLEY
Sbjct  794  KMGEQAIESLGPSSGQRLNNTGAESHDIVSGLPSLGSLEY  833



>ref|XP_006430414.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
 gb|ESR43654.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
Length=523

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  370  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  429

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  430  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  489

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  490  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  523



>ref|XP_008463127.1| PREDICTED: auxin response factor 8 [Cucumis melo]
Length=852

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + +G SGFQNSLY  +QDSSEL+H++G VDP  PT  FVKVYKSGSVGRSLDI+RF+SY 
Sbjct  692  IPMGDSGFQNSLYSCVQDSSELLHNSGQVDPSNPTRTFVKVYKSGSVGRSLDISRFSSYQ  751

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWEAFVNNV YIKILSPED
Sbjct  752  ELREELAQMFGIEGQLEDPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVGYIKILSPED  811

Query  364  VQTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             Q LG+Q  ES +  V +R+ TSG +    +SGLPS+GSLEY
Sbjct  812  FQKLGEQAIESFNPIVGQRL-TSGGNEAGNVSGLPSVGSLEY  852



>ref|XP_003553137.1| PREDICTED: auxin response factor 8-like [Glycine max]
 gb|KHN08745.1| Auxin response factor 8 [Glycine soja]
Length=841

 Score =   233 bits (595),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            L  SGFQ SLY  M DSSEL+ SAG VDP   +  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  683  LADSGFQGSLYGCM-DSSELLQSAGHVDPENQSQTFVKVYKSGSVGRSLDISRFSSYHEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED+Q
Sbjct  742  REELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQ  801

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ESL+    +R+N +GA+ +D +SG PS+GSLEY
Sbjct  802  KMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY  841



>gb|KJB48161.1| hypothetical protein B456_008G054600 [Gossypium raimondii]
Length=458

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 130/166 (78%), Gaps = 10/166 (6%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG S FQN LY  MQDSSEL  S G VDP TPT  FVKVYKSGSVGRSLDI+RF+SYH
Sbjct  299  IPLGDSSFQNPLYGCMQDSSEL-QSRGQVDPPTPTPTFVKVYKSGSVGRSLDISRFSSYH  357

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED
Sbjct  358  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  417

Query  364  VQTLGKQEAESLSRNVV-ERMNTSGAD---GRDFLSGLPSLGSLEY  239
            VQ +G+Q AE  S     +RMN++G D   GR     L S+G LEY
Sbjct  418  VQKMGEQRAEPFSPTTPGQRMNSTGTDTGTGR-----LSSVGYLEY  458



>gb|KDO57332.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=728

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  575  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  634

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  635  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  694

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  695  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  728



>gb|KDO57329.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=784

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  631  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  690

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  691  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  750

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  751  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  784



>gb|KDO57328.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=778

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  625  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  684

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  685  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  744

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  745  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  778



>gb|KDO57331.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=799

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  646  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  705

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  706  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  765

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  766  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  799



>gb|KDO57330.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=811

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  658  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  717

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  718  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  777

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  778  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  811



>gb|KJB48160.1| hypothetical protein B456_008G054600 [Gossypium raimondii]
Length=527

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 130/166 (78%), Gaps = 10/166 (6%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG S FQN LY  MQDSSEL  S G VDP TPT  FVKVYKSGSVGRSLDI+RF+SYH
Sbjct  368  IPLGDSSFQNPLYGCMQDSSEL-QSRGQVDPPTPTPTFVKVYKSGSVGRSLDISRFSSYH  426

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED
Sbjct  427  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  486

Query  364  VQTLGKQEAESLSRNVV-ERMNTSGAD---GRDFLSGLPSLGSLEY  239
            VQ +G+Q AE  S     +RMN++G D   GR     L S+G LEY
Sbjct  487  VQKMGEQRAEPFSPTTPGQRMNSTGTDTGTGR-----LSSVGYLEY  527



>ref|XP_006430416.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
 gb|ESR43656.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
Length=835

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  682  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  742  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  801

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  802  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  835



>ref|XP_004148912.1| PREDICTED: auxin response factor 8-like [Cucumis sativus]
Length=836

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+H++G VDP  PT  FVKVYK+GSVGRSLDI+RF+SY EL
Sbjct  677  LGDSGFQNSLYSCVQDSSELLHNSGQVDPSNPTRTFVKVYKTGSVGRSLDISRFSSYQEL  736

Query  538  RQELGQMYGIEG-LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            R+EL QM+GIEG L+EDP+RSGWQLVFVDREND+LLLGDDPWEAFVNNV +IKILSPED 
Sbjct  737  REELAQMFGIEGQLVEDPRRSGWQLVFVDRENDVLLLGDDPWEAFVNNVGFIKILSPEDF  796

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            Q LG+Q  ES +  V +R+ TSG +    +SGLPS+GSLEY
Sbjct  797  QKLGEQAIESFNPIVGQRL-TSGGNEAGNVSGLPSVGSLEY  836



>gb|AFQ94050.1| auxin response factor 1 [Camellia sinensis]
Length=820

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LGASGFQ+SLY  MQDSSEL+HSA  VDP T    FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  678  LGASGFQSSLYGCMQDSSELLHSAAQVDPPTANRTFVKVYKSGSVGRSLDISRFSSYNEL  737

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEGLL+DPQRSGWQLVFVDRE+D+LLLGD PWEAFVNNVWYIKILSPEDV 
Sbjct  738  REELGQMFGIEGLLKDPQRSGWQLVFVDREDDVLLLGDGPWEAFVNNVWYIKILSPEDVL  797

Query  358  TLGKQEAESLSRNVVER  308
             LGKQE ES S N  ER
Sbjct  798  KLGKQEVESFSHNTGER  814



>ref|XP_006481965.1| PREDICTED: auxin response factor 8-like isoform X2 [Citrus sinensis]
Length=811

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D  TPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  658  LGDSGFHNSMYGCMQDSSELLHNVGQIDQPTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  717

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  718  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  777

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  778  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  811



>ref|XP_004162834.1| PREDICTED: auxin response factor 8-like [Cucumis sativus]
Length=854

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+H++G VDP  PT  FVKVYK+GSVGRSLDI+RF+SY EL
Sbjct  695  LGDSGFQNSLYSCVQDSSELLHNSGQVDPSNPTRTFVKVYKTGSVGRSLDISRFSSYQEL  754

Query  538  RQELGQMYGIEG-LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDV  362
            R+EL QM+GIEG L+EDP+RSGWQLVFVDREND+LLLGDDPWEAFVNNV +IKILSPED 
Sbjct  755  REELAQMFGIEGQLVEDPRRSGWQLVFVDRENDVLLLGDDPWEAFVNNVGFIKILSPEDF  814

Query  361  QTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            Q LG+Q  ES +  V +R+ TSG +    +SGLPS+GSLEY
Sbjct  815  QKLGEQAIESFNPIVGQRL-TSGGNEAGNVSGLPSVGSLEY  854



>ref|XP_006481964.1| PREDICTED: auxin response factor 8-like isoform X1 [Citrus sinensis]
Length=835

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D  TPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  682  LGDSGFHNSMYGCMQDSSELLHNVGQIDQPTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWEAFV+NVWYIKILSPEDVQ
Sbjct  742  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQ  801

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G+Q  ES S +  +R N+ G  GRD       +GSLEY
Sbjct  802  KMGEQGVESFSPSSGQRANSRGNCGRD------PVGSLEY  835



>ref|XP_004500428.1| PREDICTED: auxin response factor 8-like [Cicer arietinum]
Length=853

 Score =   227 bits (579),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            +QLG SGFQ SLY  MQDSS  +H+AG +DP      FVKVYK GSVGRSLDI+RFNSYH
Sbjct  691  MQLGESGFQGSLYACMQDSSSFLHNAGQIDPQNQNPTFVKVYKLGSVGRSLDISRFNSYH  750

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            EL +EL QM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED
Sbjct  751  ELWEELAQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPED  810

Query  364  VQTLGKQEAESLSRNVVERMNTSGADGRDFLSGL-PSLGSLEY  239
            +Q +G+Q  E+ +    +R++ SGAD    +SG  PS+GSLEY
Sbjct  811  IQKMGEQAVETHALGSGQRLSDSGADSHHVVSGQPPSIGSLEY  853



>gb|KJB48159.1| hypothetical protein B456_008G054600 [Gossypium raimondii]
Length=822

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 130/166 (78%), Gaps = 10/166 (6%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG S FQN LY  MQDSSEL  S G VDP TPT  FVKVYKSGSVGRSLDI+RF+SYH
Sbjct  663  IPLGDSSFQNPLYGCMQDSSEL-QSRGQVDPPTPTPTFVKVYKSGSVGRSLDISRFSSYH  721

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED
Sbjct  722  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  781

Query  364  VQTLGKQEAESLSRNVV-ERMNTSGAD---GRDFLSGLPSLGSLEY  239
            VQ +G+Q AE  S     +RMN++G D   GR     L S+G LEY
Sbjct  782  VQKMGEQRAEPFSPTTPGQRMNSTGTDTGTGR-----LSSVGYLEY  822



>ref|XP_008227867.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 8 [Prunus 
mume]
Length=838

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQ+SLY  MQDSSEL+HSAG VDP TP   FVKVYKSGSVGRSLDI+RF      
Sbjct  685  LGDSGFQSSLYGCMQDSSELLHSAGQVDPPTPNCTFVKVYKSGSVGRSLDISRFXX----  740

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
                  M+GIEG LED  RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV 
Sbjct  741  --XXXXMFGIEGKLEDRLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVH  798

Query  358  TLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
             +G Q  E  + N  +R+N+SG + +D +SGLPSLGSLEY
Sbjct  799  KMGDQAVEPFNPNTGQRLNSSGGEAQDIVSGLPSLGSLEY  838



>gb|KDP36369.1| hypothetical protein JCGZ_09784 [Jatropha curcas]
Length=830

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNS+Y  +QDSSE + SAG VDP T +  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  692  LGDSGFQNSMYGGVQDSSEFVQSAGQVDPPTSSRTFVKVYKSGSVGRSLDISRFSSYHEL  751

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  752  REELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQ  811

Query  358  TLGKQEAESLSRNVVERM  305
             LG+Q  ES S NV +R+
Sbjct  812  KLGEQGVESFSPNVSQRI  829



>gb|ABK95913.1| unknown [Populus trichocarpa]
Length=533

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+ +AG +DP TP+  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  391  LGDSGFQNSLYGCVQDSSELLSNAGQMDPPTPSGTFVKVYKSGSVGRSLDISRFSSYHEL  450

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDV 
Sbjct  451  RGELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  510

Query  358  TLGKQEAESLSRNVVERMN  302
             LG+Q  E    N V RM+
Sbjct  511  KLGEQGVEPSGPNAVHRMS  529



>gb|ADG60256.1| ARF8-like protein [Nicotiana tabacum]
Length=119

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -1

Query  592  GSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWE  413
            G  GRSLDIT+F+SYHELR+ELGQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWE
Sbjct  1    GVCGRSLDITQFHSYHELRRELGQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWE  60

Query  412  AFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTS-GADGRDFLSGLPSLGSLEY  239
            AFVNNVWYIKILSPEDVQ LGK+EA+SL+R  VERM++S  AD RD +SG+PSLGSLEY
Sbjct  61   AFVNNVWYIKILSPEDVQKLGKEEAKSLNRGAVERMSSSTSADDRDLVSGMPSLGSLEY  119



>ref|XP_002305917.2| hypothetical protein POPTR_0004s07640g [Populus trichocarpa]
 gb|EEE86428.2| hypothetical protein POPTR_0004s07640g [Populus trichocarpa]
Length=827

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+ +AG +DP TP+  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  685  LGDSGFQNSLYGCVQDSSELLSNAGQMDPPTPSGTFVKVYKSGSVGRSLDISRFSSYHEL  744

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDV 
Sbjct  745  RGELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  804

Query  358  TLGKQEAESLSRNVVERMN  302
             LG+Q  E    N V RM+
Sbjct  805  KLGEQGVEPSGPNAVHRMS  823



>gb|EYU25686.1| hypothetical protein MIMGU_mgv1a002020mg [Erythranthe guttata]
Length=725

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 135/167 (81%), Gaps = 9/167 (5%)
 Frame = -1

Query  718  LGAS-GFQNS-LYDYMQDSSE--LMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            LG+S G+Q + LY Y+QDSS+  ++H+A  VD  TP   FVKVYK+GSVGRSLDI RFNS
Sbjct  561  LGSSVGYQTTPLYGYVQDSSDNNMLHAAAQVDQQTPNPTFVKVYKTGSVGRSLDIGRFNS  620

Query  550  YHELRQELGQMYGIEGLLEDP--QRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKIL  377
            Y ELR ELG+M+GI+GLLED   QRSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKIL
Sbjct  621  YEELRNELGEMFGIQGLLEDHHRQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKIL  680

Query  376  SPEDVQTLGKQEAESLS-RNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            SPEDV  LGK+EAESL+  +  +R+N   AD +  + GLPSLGSL+Y
Sbjct  681  SPEDVMKLGKEEAESLNISSTDQRINN--ADAQTLIPGLPSLGSLDY  725



>ref|XP_006372462.1| hypothetical protein POPTR_0017s01870g [Populus trichocarpa]
 gb|ERP50259.1| hypothetical protein POPTR_0017s01870g [Populus trichocarpa]
Length=813

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+ +AG +DP TP+  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  677  LGDSGFQNSLYGCVQDSSELLPNAGQMDPPTPSRTFVKVYKSGSVGRSLDISRFSSYHEL  736

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDV 
Sbjct  737  REELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  796

Query  358  TLGKQEAESLSRNVVE  311
             +G+Q  ES   N V+
Sbjct  797  KMGEQGFESSGPNAVK  812



>ref|XP_002526195.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF36199.1| Auxin response factor, putative [Ricinus communis]
Length=826

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            +G SGFQ+S+Y  +QDSSEL+ SAG VDP T +  FVKVYK GSVGRSLDI+RF+SYHEL
Sbjct  692  IGDSGFQSSIYGGVQDSSELLPSAGQVDPPTLSRTFVKVYKLGSVGRSLDISRFSSYHEL  751

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSPEDVQ
Sbjct  752  REELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQ  811

Query  358  TLGKQEAESLSRNV  317
             +G+Q  +S S+N+
Sbjct  812  KMGEQGVDSFSQNI  825



>ref|XP_011038345.1| PREDICTED: auxin response factor 8-like [Populus euphratica]
Length=815

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+ +AG +DP T +  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  679  LGDSGFQNSLYGCVQDSSELLPNAGQMDPPTSSRTFVKVYKSGSVGRSLDISRFSSYHEL  738

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDV 
Sbjct  739  REELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  798

Query  358  TLGKQEAESLSRNVVE  311
             +G+Q  ES   N V+
Sbjct  799  KMGEQGFESSGPNAVK  814



>gb|KEH34585.1| auxin response factor 2 [Medicago truncatula]
Length=612

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
             QLG SGFQ SLY  MQDSS  + +A  +D       FVKVYKSGSVGRSLDI+RF+ Y 
Sbjct  452  TQLGESGFQGSLYACMQDSS-FLQNAEQIDTQNQNPTFVKVYKSGSVGRSLDISRFSCYR  510

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+ELGQM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED
Sbjct  511  ELREELGQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPED  570

Query  364  VQTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            +Q +G Q  E       +R+N +G          PS+GSL+Y
Sbjct  571  IQKMGDQAVEMHGLGSGQRLNGTGESHHIVSGQPPSIGSLDY  612



>gb|ACB30859.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30860.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30861.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30862.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30863.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30864.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30865.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30866.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30867.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30868.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30869.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30870.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30871.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30872.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30873.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30874.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30875.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30876.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30877.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30878.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30879.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30880.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30881.1| ARF8, partial [Arabidopsis thaliana]
 gb|ACB30882.1| ARF8, partial [Arabidopsis thaliana]
Length=130

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++    T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  11   MSLTDSGFQNSLYSCMQDTTHELLHGAGQINSSNQTKNFVKVYKSGSVGRSLDISRFSSY  70

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  71   HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  130



>ref|XP_002870511.1| hypothetical protein ARALYDRAFT_493698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46770.1| hypothetical protein ARALYDRAFT_493698 [Arabidopsis lyrata subsp. 
lyrata]
Length=805

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + L  SGFQNSL+  MQD+ EL+H AG ++P T T  FVKVYKSGSVGRSLDI+RF+SYH
Sbjct  664  MSLTDSGFQNSLFGCMQDTHELLHGAGQINPSTQTKNFVKVYKSGSVGRSLDISRFSSYH  723

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPED
Sbjct  724  ELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPED  783

Query  364  VQTLG  350
            VQ +G
Sbjct  784  VQQMG  788



>ref|XP_010450467.1| PREDICTED: auxin response factor 8 isoform X1 [Camelina sativa]
Length=738

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P T T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  596  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSTQTKNFVKVYKSGSVGRSLDISRFSSY  655

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  656  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  715

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  716  DVQQMGDQ  723



>ref|XP_010435545.1| PREDICTED: auxin response factor 8-like [Camelina sativa]
Length=820

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P T T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  678  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPPTQTKNFVKVYKSGSVGRSLDISRFSSY  737

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  738  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  797

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  798  DVQQMGDQ  805



>ref|XP_010450468.1| PREDICTED: auxin response factor 8 isoform X2 [Camelina sativa]
Length=820

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P T T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  678  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSTQTKNFVKVYKSGSVGRSLDISRFSSY  737

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  738  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  797

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  798  DVQQMGDQ  805



>ref|XP_010440819.1| PREDICTED: auxin response factor 8-like isoform X1 [Camelina 
sativa]
 ref|XP_010440820.1| PREDICTED: auxin response factor 8-like isoform X2 [Camelina 
sativa]
Length=820

 Score =   205 bits (522),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P T T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  678  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSTQTKNFVKVYKSGSVGRSLDISRFSSY  737

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  738  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  797

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  798  DVQQMGDQ  805



>ref|XP_003600594.1| Auxin response factor [Medicago truncatula]
 gb|AES70845.1| auxin response factor 2 [Medicago truncatula]
Length=849

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
             QLG SGFQ SLY  MQDSS  + +A  +D       FVKVYKSGSVGRSLDI+RF+ Y 
Sbjct  689  TQLGESGFQGSLYACMQDSS-FLQNAEQIDTQNQNPTFVKVYKSGSVGRSLDISRFSCYR  747

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+ELGQM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPED
Sbjct  748  ELREELGQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPED  807

Query  364  VQTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            +Q +G Q  E       +R+N +G          PS+GSL+Y
Sbjct  808  IQKMGDQAVEMHGLGSGQRLNGTGESHHIVSGQPPSIGSLDY  849



>ref|XP_011048868.1| PREDICTED: auxin response factor 8-like [Populus euphratica]
Length=831

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGFQNSLY  +QDSSEL+ +AG +DP TP+  FVKVYKSGSVGRSLDI+R  SYHEL
Sbjct  690  LGDSGFQNSLYGCVQDSSELLSNAGQMDPPTPSGTFVKVYKSGSVGRSLDISR--SYHEL  747

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R EL QM+GIEG LE+P RSGWQLVFVDREND+LLLGDDPWE FVNNVWYIKILSPEDV 
Sbjct  748  RGELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  807

Query  358  TLGKQEA-ESLSRNVVERMN  302
             LG+Q   E    N V RM+
Sbjct  808  KLGEQGGVEPSGPNAVHRMS  827



>ref|XP_010551627.1| PREDICTED: auxin response factor 8-like isoform X2 [Tarenaya 
hassleriana]
Length=818

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            SGFQNSLY  MQ++ EL+H AG ++    T  FVKVYKSGSVGRSLDI+RF+SYHELR+E
Sbjct  685  SGFQNSLYSCMQNAPELLHGAGDINTSNQTENFVKVYKSGSVGRSLDISRFSSYHELREE  744

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+M+G+EGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPEDVQ +G
Sbjct  745  LGKMFGVEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPEDVQKMG  804

Query  349  KQEAESLSRN  320
            +    S  +N
Sbjct  805  ENGVGSFPQN  814



>ref|XP_006282445.1| hypothetical protein CARUB_v10004139mg [Capsella rubella]
 gb|EOA15343.1| hypothetical protein CARUB_v10004139mg [Capsella rubella]
Length=742

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P   T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  600  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSNQTKNFVKVYKSGSVGRSLDISRFSSY  659

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  660  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  719

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  720  DVQQMGDQ  727



>emb|CBA12001.1| putative auxin response factor 8 [Illicium parviflorum]
Length=794

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = -1

Query  712  ASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQ  533
            A   QNSLY  + +SS L+ + G +DP  PT  FVKVYKSGSVGRSLDI +F+SYHELR+
Sbjct  639  APSLQNSLYGCIDESSGLLQNEGQMDP--PTRTFVKVYKSGSVGRSLDIAQFSSYHELRE  696

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELGQM+G+ G L DP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSP+DVQ +
Sbjct  697  ELGQMFGLGGKLRDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPDDVQNM  756

Query  352  GKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            GK + E L+     R N+   + +  +SG+PS+G L Y
Sbjct  757  GKHDVEPLNPMGGRRHNSGDYESQSLISGIPSVGQLRY  794



>ref|XP_006282446.1| hypothetical protein CARUB_v10004139mg [Capsella rubella]
 gb|EOA15344.1| hypothetical protein CARUB_v10004139mg [Capsella rubella]
Length=824

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++P   T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  682  MSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSNQTKNFVKVYKSGSVGRSLDISRFSSY  741

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  742  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  801

Query  367  DVQTLGKQ  344
            DVQ +G Q
Sbjct  802  DVQQMGDQ  809



>ref|XP_010528612.1| PREDICTED: auxin response factor 8-like [Tarenaya hassleriana]
Length=825

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + L  SGFQNSLY  MQD+ EL+H AG ++       FVKVYKSGSVGRSLDI+RF+SY+
Sbjct  687  MSLTDSGFQNSLYSCMQDAPELLHGAGDINASNQIKNFVKVYKSGSVGRSLDISRFSSYN  746

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+ELG+M+GIEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPED
Sbjct  747  ELREELGKMFGIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPED  806

Query  364  VQTLGKQEAESLSRN  320
            VQ +G+Q   S  +N
Sbjct  807  VQKMGQQGDGSFLQN  821



>ref|XP_010551611.1| PREDICTED: auxin response factor 8-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551620.1| PREDICTED: auxin response factor 8-like isoform X1 [Tarenaya 
hassleriana]
Length=819

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -1

Query  709  SGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKV-YKSGSVGRSLDITRFNSYHELRQ  533
            SGFQNSLY  MQ++ EL+H AG ++    T  FVKV YKSGSVGRSLDI+RF+SYHELR+
Sbjct  685  SGFQNSLYSCMQNAPELLHGAGDINTSNQTENFVKVVYKSGSVGRSLDISRFSSYHELRE  744

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELG+M+G+EGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPEDVQ +
Sbjct  745  ELGKMFGVEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPEDVQKM  804

Query  352  GKQEAESLSRN  320
            G+    S  +N
Sbjct  805  GENGVGSFPQN  815



>gb|KJB10499.1| hypothetical protein B456_001G204500 [Gossypium raimondii]
Length=802

 Score =   199 bits (505),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG   FQN LY  MQ SSEL  S G VDP T +  F+KVYKSGSVGRSLDI+RF+SYH
Sbjct  679  IPLGDPSFQNPLYGCMQYSSEL-QSTGQVDPPTSSQTFIKVYKSGSVGRSLDISRFSSYH  737

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED
Sbjct  738  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  797

Query  364  VQTLG  350
            VQ +G
Sbjct  798  VQKMG  802



>ref|XP_009382091.1| PREDICTED: auxin response factor 12-like [Musa acuminata subsp. 
malaccensis]
Length=800

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -1

Query  712  ASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQ  533
            AS  QNSLY Y+ +SS L+ ++G V P + T  FVKVYKSGSVGRSLDI+RFN+Y ELR 
Sbjct  674  ASCIQNSLYGYLDESSSLLQNSGEVGPQSQT--FVKVYKSGSVGRSLDISRFNNYDELRV  731

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELG M+GIEGLLEDP+RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV  +
Sbjct  732  ELGHMFGIEGLLEDPRRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVHKM  791

Query  352  GKQEAESLS  326
            GKQ AE+++
Sbjct  792  GKQGAEAIA  800



>gb|KHG29290.1| Auxin response factor 12 [Gossypium arboreum]
Length=932

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYH  545
            + LG   FQN LY  MQ SSEL  S G VDP T +  F+KVYKSGSVGRSLDI+RF+SYH
Sbjct  809  IPLGDPSFQNPLYGCMQYSSEL-QSTGQVDPPTSSRTFIKVYKSGSVGRSLDISRFSSYH  867

Query  544  ELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  365
            ELR+EL QM+GIEG LEDP RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED
Sbjct  868  ELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPED  927

Query  364  VQTLG  350
            VQ +G
Sbjct  928  VQKMG  932



>ref|NP_198518.1| auxin response factor 8 [Arabidopsis thaliana]
 sp|Q9FGV1.2|ARFH_ARATH RecName: Full=Auxin response factor 8; AltName: Full=Protein 
FRUIT WITHOUT FERTILIZATION [Arabidopsis thaliana]
 gb|AAD02219.1| auxin response factor 8 [Arabidopsis thaliana]
 gb|AAT67074.1| ARF8 [Arabidopsis thaliana]
 gb|AED94137.1| auxin response factor 8 [Arabidopsis thaliana]
Length=811

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -1

Query  724  VQLGASGFQNSLYDYMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSY  548
            + L  SGFQNSLY  MQD++ EL+H AG ++    T  FVKVYKSGSVGRSLDI+RF+SY
Sbjct  669  MSLTDSGFQNSLYSCMQDTTHELLHGAGQINSSNQTKNFVKVYKSGSVGRSLDISRFSSY  728

Query  547  HELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPE  368
            HELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FVNNVWYIKILSPE
Sbjct  729  HELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPE  788

Query  367  DVQTLG  350
            DV  +G
Sbjct  789  DVHQMG  794



>ref|XP_009139710.1| PREDICTED: auxin response factor 8 isoform X3 [Brassica rapa]
Length=807

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  724  VQLGASGFQNSLYD-YMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            + LG SGF+NSLY+  MQD++ EL+H  G + P   T  FVKVYKSGSVGRSLDI+RF+S
Sbjct  664  MSLGDSGFENSLYNSCMQDTTHELLHGVGQISPSNQTKNFVKVYKSGSVGRSLDISRFSS  723

Query  550  YHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSP  371
            YHELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FV+NVWYIKILSP
Sbjct  724  YHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVSNVWYIKILSP  783

Query  370  EDVQTLG  350
            EDVQ +G
Sbjct  784  EDVQEMG  790



>ref|XP_009139708.1| PREDICTED: auxin response factor 8 isoform X1 [Brassica rapa]
 gb|AFD01306.1| auxin response factor 8-2 [Brassica rapa subsp. pekinensis]
Length=844

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  724  VQLGASGFQNSLYD-YMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            + LG SGF+NSLY+  MQD++ EL+H  G + P   T  FVKVYKSGSVGRSLDI+RF+S
Sbjct  701  MSLGDSGFENSLYNSCMQDTTHELLHGVGQISPSNQTKNFVKVYKSGSVGRSLDISRFSS  760

Query  550  YHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSP  371
            YHELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FV+NVWYIKILSP
Sbjct  761  YHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVSNVWYIKILSP  820

Query  370  EDVQTLG  350
            EDVQ +G
Sbjct  821  EDVQEMG  827



>ref|XP_009139709.1| PREDICTED: auxin response factor 8 isoform X2 [Brassica rapa]
Length=819

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  724  VQLGASGFQNSLYD-YMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            + LG SGF+NSLY+  MQD++ EL+H  G + P   T  FVKVYKSGSVGRSLDI+RF+S
Sbjct  676  MSLGDSGFENSLYNSCMQDTTHELLHGVGQISPSNQTKNFVKVYKSGSVGRSLDISRFSS  735

Query  550  YHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSP  371
            YHELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FV+NVWYIKILSP
Sbjct  736  YHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVSNVWYIKILSP  795

Query  370  EDVQTLG  350
            EDVQ +G
Sbjct  796  EDVQEMG  802



>emb|CDY53537.1| BnaCnng25410D [Brassica napus]
Length=814

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  724  VQLGASGFQNSLYD-YMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            V L  SGF+NSLY+  MQD++ EL+H  G ++P   T  FVKVYKSGSVGRSLDI+RF+S
Sbjct  671  VSLADSGFENSLYNSCMQDTTPELLHGVGQINPSNQTKNFVKVYKSGSVGRSLDISRFSS  730

Query  550  YHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSP  371
            YHELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FV+NVWYIKILSP
Sbjct  731  YHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVSNVWYIKILSP  790

Query  370  EDVQTLG  350
            EDVQ +G
Sbjct  791  EDVQEMG  797



>ref|XP_009397958.1| PREDICTED: auxin response factor 12-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -1

Query  712  ASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQ  533
            +S FQNS Y Y+ DS  L+H AG  D  + T  FVKVYKSGSVGRSLDI+RF++Y ELR+
Sbjct  542  SSCFQNSFYGYLDDSPSLLHGAGETDLQSQT--FVKVYKSGSVGRSLDISRFSNYEELRE  599

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELGQM+GIEGLLEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV  +
Sbjct  600  ELGQMFGIEGLLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVLKM  659

Query  352  GKQEAESLS  326
            GKQ  +S  
Sbjct  660  GKQGVDSFC  668



>ref|XP_010940284.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 12-like 
[Elaeis guineensis]
Length=835

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +A   DP T T  FVKVYKSGSVGRSLDITRFNSY ELR
Sbjct  676  ASSSLQNSIYGGLKESSAVLQNAEEADPTTKT--FVKVYKSGSVGRSLDITRFNSYGELR  733

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GIEG LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ 
Sbjct  734  EELGQMFGIEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQE  793

Query  355  LGKQEAESLSRNVVER  308
            +GK   E    + +ER
Sbjct  794  MGKPAIEPRXSSQIER  809



>ref|XP_009397956.1| PREDICTED: auxin response factor 12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397957.1| PREDICTED: auxin response factor 12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=801

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -1

Query  712  ASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQ  533
            +S FQNS Y Y+ DS  L+H AG  D  + T  FVKVYKSGSVGRSLDI+RF++Y ELR+
Sbjct  675  SSCFQNSFYGYLDDSPSLLHGAGETDLQSQT--FVKVYKSGSVGRSLDISRFSNYEELRE  732

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELGQM+GIEGLLEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV  +
Sbjct  733  ELGQMFGIEGLLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVLKM  792

Query  352  GKQEAESLS  326
            GKQ  +S  
Sbjct  793  GKQGVDSFC  801



>ref|XP_010675199.1| PREDICTED: auxin response factor 8 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            GASGF NS+Y    +S EL HS G  D   PT  +VKVYKSGSVGRSLDI+RF+SYHELR
Sbjct  685  GASGFHNSMYGCNSNSPEL-HSEGQGDLQNPTRTYVKVYKSGSVGRSLDISRFSSYHELR  743

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GIEG+L+DP RSGWQLVFVDREND+LLLGDDPWEAFV NV YIKILSPEDVQ 
Sbjct  744  EELGQMFGIEGMLDDPLRSGWQLVFVDRENDVLLLGDDPWEAFVYNVSYIKILSPEDVQK  803

Query  355  LGKQEAESLS  326
            LGK   E+ S
Sbjct  804  LGKHGTEAYS  813



>emb|CDX74594.1| BnaA04g07950D [Brassica napus]
Length=819

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -1

Query  724  VQLGASGFQNSLYD-YMQDSS-ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNS  551
            + L  SGF+NSLY+  MQD++ EL+H  G + P   T  FVKVYKSGSVGRSLDI+RF+S
Sbjct  676  MSLADSGFENSLYNSCMQDTTHELLHGVGQISPSNQTKNFVKVYKSGSVGRSLDISRFSS  735

Query  550  YHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSP  371
            YHELR+ELG+M+ IEGLLEDP RSGWQLVFVD+ENDILLLGDDPWE+FV+NVWYIKILSP
Sbjct  736  YHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVSNVWYIKILSP  795

Query  370  EDVQTLG  350
            EDVQ +G
Sbjct  796  EDVQEMG  802



>ref|XP_008813064.1| PREDICTED: auxin response factor 12-like isoform X3 [Phoenix 
dactylifera]
Length=531

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +A   DP T T  FVKVYKSGSVGRSLDITRFNSY ELR
Sbjct  405  ASSSLQNSIYGSLKESSGVLQNAEEADPTTKT--FVKVYKSGSVGRSLDITRFNSYDELR  462

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +EL QM+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ 
Sbjct  463  EELSQMFGIKGRLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQE  522

Query  355  LGKQEAE  335
            +GKQ  E
Sbjct  523  MGKQATE  529



>ref|XP_008813056.1| PREDICTED: auxin response factor 12-like isoform X2 [Phoenix 
dactylifera]
Length=591

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +A   DP T T  FVKVYKSGSVGRSLDITRFNSY ELR
Sbjct  465  ASSSLQNSIYGSLKESSGVLQNAEEADPTTKT--FVKVYKSGSVGRSLDITRFNSYDELR  522

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +EL QM+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ 
Sbjct  523  EELSQMFGIKGRLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQE  582

Query  355  LGKQEAE  335
            +GKQ  E
Sbjct  583  MGKQATE  589



>ref|XP_010935427.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
 ref|XP_010935429.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
 ref|XP_010935430.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
Length=804

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +AG  DP T T  FVKVYKSGSVGRSLDITRFN+Y ELR
Sbjct  678  ASSSLQNSIYGSLEESSGVLQNAGEADPTTKT--FVKVYKSGSVGRSLDITRFNNYDELR  735

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV  
Sbjct  736  EELGQMFGIKGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVHK  795

Query  355  LGKQEAE  335
            +GK+  E
Sbjct  796  MGKRAIE  802



>ref|XP_010935431.1| PREDICTED: auxin response factor 12-like isoform X2 [Elaeis guineensis]
Length=708

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +AG  DP T T  FVKVYKSGSVGRSLDITRFN+Y ELR
Sbjct  582  ASSSLQNSIYGSLEESSGVLQNAGEADPTTKT--FVKVYKSGSVGRSLDITRFNNYDELR  639

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDV  
Sbjct  640  EELGQMFGIKGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVHK  699

Query  355  LGKQEAE  335
            +GK+  E
Sbjct  700  MGKRAIE  706



>ref|XP_008813049.1| PREDICTED: auxin response factor 12-like isoform X1 [Phoenix 
dactylifera]
Length=804

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++SS ++ +A   DP T T  FVKVYKSGSVGRSLDITRFNSY ELR
Sbjct  678  ASSSLQNSIYGSLKESSGVLQNAEEADPTTKT--FVKVYKSGSVGRSLDITRFNSYDELR  735

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +EL QM+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ 
Sbjct  736  EELSQMFGIKGRLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQE  795

Query  355  LGKQEAE  335
            +GKQ  E
Sbjct  796  MGKQATE  802



>ref|XP_010908226.1| PREDICTED: auxin response factor 12-like [Elaeis guineensis]
Length=809

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = -1

Query  712  ASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQ  533
            AS FQNSLY Y+  SS  + SA  +D  T T  FVKVYKSGS+GR LDITRF+SY ELR+
Sbjct  683  ASCFQNSLYGYLDGSSGSLQSAAEIDRATRT--FVKVYKSGSIGRLLDITRFSSYDELRE  740

Query  532  ELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTL  353
            ELGQM+GIEGLL+DP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKIL PEDV  L
Sbjct  741  ELGQMFGIEGLLDDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILPPEDVLKL  800

Query  352  GKQEAESL  329
            GKQ  ES+
Sbjct  801  GKQGVESV  808



>ref|NP_001170351.1| uncharacterized protein LOC100384328 [Zea mays]
 gb|ACN36719.1| unknown [Zea mays]
Length=326

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  197  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  254

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  255  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  314

Query  355  LGK  347
            +GK
Sbjct  315  MGK  317



>ref|NP_001169029.1| uncharacterized protein LOC100382863 [Zea mays]
 gb|ACN31454.1| unknown [Zea mays]
Length=122

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -1

Query  691  LYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYG  512
            +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR+ELGQM+G
Sbjct  1    MYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELREELGQMFG  58

Query  511  IEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGK  347
            I+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  +GK
Sbjct  59   IKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGK  113



>ref|XP_008804149.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
 ref|XP_008804156.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
 ref|XP_008804164.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
Length=804

 Score =   187 bits (476),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
             +S  QNS+Y  +++S  ++ +AG  DP T T  FVKVYKSGSVGRSLDITRFN+Y ELR
Sbjct  678  ASSSLQNSIYGSLEESPGVLQNAGESDPTTKT--FVKVYKSGSVGRSLDITRFNNYGELR  735

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELG M+GI+G LEDP RSGWQLVFVDREND+LLLGDDPWE+FVNNVWYIKILSPEDVQ 
Sbjct  736  EELGLMFGIKGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQK  795

Query  355  LGKQEAE  335
            +GK+  E
Sbjct  796  MGKRAIE  802



>ref|XP_006391521.1| hypothetical protein EUTSA_v10018139mg [Eutrema salsugineum]
 dbj|BAJ33846.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28807.1| hypothetical protein EUTSA_v10018139mg [Eutrema salsugineum]
Length=801

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 6/125 (5%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            L  SGFQNSLY  MQD++EL+H AG       T  FVKVYKSGSVGRSLDI+RF+SYHEL
Sbjct  667  LTDSGFQNSLYGSMQDTTELLHGAGQ------TKNFVKVYKSGSVGRSLDISRFSSYHEL  720

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELG+M+ I+GLLED  RSGWQLVFVD+E+D+LLLGDDPWE+FVN+VWYIKILSPEDVQ
Sbjct  721  REELGKMFDIKGLLEDAFRSGWQLVFVDKEDDVLLLGDDPWESFVNSVWYIKILSPEDVQ  780

Query  358  TLGKQ  344
             +G+ 
Sbjct  781  KMGEH  785



>gb|ACI46673.1| auxin response factor 8 [Solanum lycopersicum]
Length=96

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  526  GQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGK  347
            GQM+GIEG LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ LGK
Sbjct  1    GQMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLGK  60

Query  346  QEAESLSRNVVERMNTSGADGRDFLSGLPSLGSLEY  239
            +EAESL+R  VERM+++ AD RD +SG+PSLGSLEY
Sbjct  61   EEAESLNRGAVERMSSTNADDRDLISGMPSLGSLEY  96



>gb|AEV41036.1| putative auxin response factor [Oryza minuta]
Length=818

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  689  GSTYLQNAMYACLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  746

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  747  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  806

Query  355  LGKQ  344
            +GKQ
Sbjct  807  MGKQ  810



>gb|AEV40985.1| putative auxin response factor [Oryza punctata]
Length=818

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  689  GSTYLQNAMYACLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  746

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  747  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  806

Query  355  LGKQ  344
            +GKQ
Sbjct  807  MGKQ  810



>emb|CBI30949.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 110/146 (75%), Gaps = 9/146 (6%)
 Frame = -1

Query  655  HSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSG  476
             + G V+P  PT  FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP+RSG
Sbjct  17   ENVGQVNP--PTRTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGQLEDPRRSG  74

Query  475  WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTS  296
            WQLVFVDREND+LLLGDDPW  FVN+VW IKILS ++VQ +GK+  E L+   ++R+ +S
Sbjct  75   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSLQEVQQMGKRGLELLNSVPIQRLTSS  134

Query  295  GA-------DGRDFLSGLPSLGSLEY  239
                     D R+  +G+ S+GSL+Y
Sbjct  135  SCDDYASRQDSRNLSTGITSVGSLDY  160



>gb|AIE88287.1| hypothetical protein OG_BBa0063K01.18 [Oryza glaberrima]
Length=802

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  673  GSTYLQNAMYGCLDDSSGLLQNTGENDPATRT--FVKVYKSGSVGRSLDITRFSNYAELR  730

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  731  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  790

Query  355  LGKQ  344
            +GKQ
Sbjct  791  MGKQ  794



>gb|AEV41081.1| putative auxin response factor [Oryza minuta]
Length=821

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  692  GSTYLQNAMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  749

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  750  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  809

Query  355  LGKQ  344
            +GKQ
Sbjct  810  MGKQ  813



>sp|Q258Y5.1|ARFL_ORYSI RecName: Full=Auxin response factor 12; AltName: Full=OsARF8 
[Oryza sativa Indica Group]
 emb|CAH67705.1| H0624F09.13 [Oryza sativa Indica Group]
Length=816

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  687  GSTYLQNAMYGCLDDSSGLLQNTGENDPATRT--FVKVYKSGSVGRSLDITRFSNYAELR  744

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  745  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  804

Query  355  LGKQ  344
            +GKQ
Sbjct  805  MGKQ  808



>ref|NP_001054222.1| Os04g0671900 [Oryza sativa Japonica Group]
 sp|Q0J951.1|ARFL_ORYSJ RecName: Full=Auxin response factor 12; AltName: Full=OsARF8 
[Oryza sativa Japonica Group]
 dbj|BAF16136.1| Os04g0671900 [Oryza sativa Japonica Group]
 gb|EEE61886.1| hypothetical protein OsJ_16583 [Oryza sativa Japonica Group]
Length=818

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  689  GSTYLQNAMYGCLDDSSGLLQNTGENDPATRT--FVKVYKSGSVGRSLDITRFSNYAELR  746

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  747  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  806

Query  355  LGKQ  344
            +GKQ
Sbjct  807  MGKQ  810



>gb|AEV41129.1| putative auxin response factor [Oryza officinalis]
Length=819

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  690  GSTYLQNAMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  747

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  748  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  807

Query  355  LGKQ  344
            +GKQ
Sbjct  808  MGKQ  811



>gb|EEC78229.1| hypothetical protein OsI_17874 [Oryza sativa Indica Group]
Length=833

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  704  GSTYLQNAMYGCLDDSSGLLQNTGENDPATRT--FVKVYKSGSVGRSLDITRFSNYAELR  761

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  762  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  821

Query  355  LGKQ  344
            +GKQ
Sbjct  822  MGKQ  825



>ref|XP_006653864.1| PREDICTED: auxin response factor 12-like, partial [Oryza brachyantha]
Length=808

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  679  GSTYLQNAMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  736

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  737  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  796

Query  355  LGKQ  344
            +GKQ
Sbjct  797  MGKQ  800



>dbj|BAB85918.1| auxin response factor 8 [Oryza sativa]
Length=795

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN++Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  666  GSTYLQNAMYGCLDDSSGLLQNTGENDPATRT--FVKVYKSGSVGRSLDITRFSNYAELR  723

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  724  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  783

Query  355  LGKQ  344
            +GKQ
Sbjct  784  MGKQ  787



>emb|CDP16075.1| unnamed protein product [Coffea canephora]
Length=894

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 114/155 (74%), Gaps = 10/155 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  M SA  VD   P T  FVKV+KSGS GRSLDI++F+SYHELR EL +M+G+EGLL
Sbjct  740  DESVFMQSAENVDQANPPTKTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  799

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+  +  +   
Sbjct  800  EDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGIDLPNSAP  859

Query  316  VERMNTSGADGRDFLS---------GLPSLGSLEY  239
            + R+ +SG    D++S         G+P++GSL Y
Sbjct  860  LHRLPSSGNSCDDYMSQKETRNSMNGIPTVGSLHY  894



>ref|XP_004960119.1| PREDICTED: auxin response factor 12-like isoform X1 [Setaria 
italica]
 ref|XP_004960120.1| PREDICTED: auxin response factor 12-like isoform X2 [Setaria 
italica]
Length=815

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  686  GSTYLQNPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  743

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  744  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  803

Query  355  LGKQ  344
            +GKQ
Sbjct  804  MGKQ  807



>dbj|BAJ89575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS +  + G  DP + T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  320  GSTYLQSPMYGCLDDSSGIFQNTGENDPTSRT--FVKVYKSGSVGRSLDITRFSNYAELR  377

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  378  EELGQMFGIRGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  437

Query  355  LGKQ  344
            LGKQ
Sbjct  438  LGKQ  441



>emb|CBA11998.1| putative auxin response factor 8, partial [Cabomba aquatica]
Length=795

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = -1

Query  724  VQLGASGFQNSL---YDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFN  554
            +Q  ASGF + L   YD ++ S  L+H  G +DP   T  FVKVYKSG VGRSLDI RF+
Sbjct  650  MQFTASGFHHPLPSAYDSLEVSPGLLHDPGQLDPHCQT--FVKVYKSGCVGRSLDIARFS  707

Query  553  SYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILS  374
            SY+ELR EL QM+G+EGLLEDPQRSGWQLV VDRENDILL+GDDPWEAFVN+VW IKILS
Sbjct  708  SYNELRDELCQMFGLEGLLEDPQRSGWQLVLVDRENDILLMGDDPWEAFVNSVWSIKILS  767

Query  373  PEDVQTLGKQEAESLSRN  320
            P+DVQ +G Q+ +  S N
Sbjct  768  PQDVQQMGAQQNDGESYN  785



>gb|EMS64768.1| Auxin response factor 12 [Triticum urartu]
Length=737

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS +  + G  DP + T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  608  GSTYLQSPMYGCLDDSSGIFQNTGENDPTSRT--FVKVYKSGSVGRSLDITRFSNYAELR  665

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQMYGI G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  666  EELGQMYGIRGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  725

Query  355  LGKQ  344
            LGKQ
Sbjct  726  LGKQ  729



>gb|EMT27817.1| Auxin response factor 12 [Aegilops tauschii]
Length=828

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS +  + G  DP + T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  699  GSTYLQSPMYGCLDDSSGIFQNTGENDPTSRT--FVKVYKSGSVGRSLDITRFSNYSELR  756

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQMYGI G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  757  EELGQMYGIRGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  816

Query  355  LGKQ  344
            LGKQ
Sbjct  817  LGKQ  820



>ref|XP_003580798.1| PREDICTED: auxin response factor 12 [Brachypodium distachyon]
Length=831

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 2/124 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  QN +Y  + DSS +  + G  DP + T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  702  GSTYLQNPMYGCLDDSSGIFQNTGENDPTSRT--FVKVYKSGSVGRSLDITRFSNYAELR  759

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  760  EELGQMFGIRGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  819

Query  355  LGKQ  344
            LGKQ
Sbjct  820  LGKQ  823



>ref|XP_006430415.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
 gb|ESR43655.1| hypothetical protein CICLE_v10011065mg [Citrus clementina]
Length=731

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = -1

Query  607  KVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLG  428
            +VYKSGSVGRSLDI+RF+SY+ELR+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLG
Sbjct  615  QVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLG  674

Query  427  DDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRDFLSGLPSLGS  248
            DDPWEAFV+NVWYIKILSPEDVQ +G+Q  ES S +  +R N+ G  GRD       +GS
Sbjct  675  DDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNCGRD------PVGS  728

Query  247  LEY  239
            LEY
Sbjct  729  LEY  731



>ref|XP_008662154.1| PREDICTED: uncharacterized protein LOC100382863 isoform X2 [Zea 
mays]
Length=781

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  652  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  709

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  710  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  769

Query  355  LGK  347
            +GK
Sbjct  770  MGK  772



>ref|XP_010275911.1| PREDICTED: auxin response factor 6-like isoform X2 [Nelumbo nucifera]
Length=897

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            D S  + S    G V+P  PT  FVKVYKSGS GRSLDITRF+SYHELR EL +M+G+EG
Sbjct  745  DESTFLQSPENVGQVNP--PTRTFVKVYKSGSFGRSLDITRFSSYHELRSELARMFGLEG  802

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGDDPW+ FVN+VW IKILSP++VQ +GKQ  E L+ 
Sbjct  803  QLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQQMGKQGVELLNS  862

Query  322  NVVERMNTSGA-------DGRDFLSGLPSLGSLEY  239
              ++R++++         D R+  +G+ S+GSL+Y
Sbjct  863  VPIQRLSSNSCDDYVNRQDSRNLSTGITSVGSLDY  897



>ref|XP_008662153.1| PREDICTED: uncharacterized protein LOC100382863 isoform X1 [Zea 
mays]
Length=809

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  680  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  737

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  738  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  797

Query  355  LGK  347
            +GK
Sbjct  798  MGK  800



>gb|AFW59850.1| hypothetical protein ZEAMMB73_643249 [Zea mays]
 gb|AFW59851.1| hypothetical protein ZEAMMB73_643249 [Zea mays]
Length=834

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  705  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  762

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  763  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  822

Query  355  LGK  347
            +GK
Sbjct  823  MGK  825



>tpg|DAA35415.1| TPA: hypothetical protein ZEAMMB73_535909 [Zea mays]
Length=817

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  688  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  745

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  746  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  805

Query  355  LGK  347
            +GK
Sbjct  806  MGK  808



>gb|ADG43164.1| auxin response factor 30 [Zea mays]
Length=809

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  680  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  737

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  738  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  797

Query  355  LGK  347
            +GK
Sbjct  798  MGK  800



>gb|ADG43137.1| auxin response factor 3 [Zea mays]
Length=816

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP T T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  687  GSTYLQSPMYGCLDDSSGLLQNTGENDPTTRT--FVKVYKSGSVGRSLDITRFSNYAELR  744

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  745  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  804

Query  355  LGK  347
            +GK
Sbjct  805  MGK  807



>gb|KGN50892.1| hypothetical protein Csa_5G315370 [Cucumis sativus]
Length=783

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG-LLEDPQRSGWQLVFVDR  452
            +P+     VYK+GSVGRSLDI+RF+SY ELR+EL QM+GIEG L+EDP+RSGWQLVFVDR
Sbjct  654  SPSPTLFGVYKTGSVGRSLDISRFSSYQELREELAQMFGIEGQLVEDPRRSGWQLVFVDR  713

Query  451  ENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRDFL  272
            END+LLLGDDPWEAFVNNV +IKILSPED Q LG+Q  ES +  V +R+ TSG +    +
Sbjct  714  ENDVLLLGDDPWEAFVNNVGFIKILSPEDFQKLGEQAIESFNPIVGQRL-TSGGNEAGNV  772

Query  271  SGLPSLGSLEY  239
            SGLPS+GSLEY
Sbjct  773  SGLPSVGSLEY  783



>ref|XP_010275910.1| PREDICTED: auxin response factor 6-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKVYKSGS GRSLDITRF+SYHELR EL +M+G+EG LEDP RSGW
Sbjct  782  NVGQVNP--PTRTFVKVYKSGSFGRSLDITRFSSYHELRSELARMFGLEGQLEDPLRSGW  839

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW+ FVN+VW IKILSP++VQ +GKQ  E L+   ++R++++ 
Sbjct  840  QLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQQMGKQGVELLNSVPIQRLSSNS  899

Query  292  A-------DGRDFLSGLPSLGSLEY  239
                    D R+  +G+ S+GSL+Y
Sbjct  900  CDDYVNRQDSRNLSTGITSVGSLDY  924



>ref|XP_002447305.1| hypothetical protein SORBIDRAFT_06g032500 [Sorghum bicolor]
 gb|EES11633.1| hypothetical protein SORBIDRAFT_06g032500 [Sorghum bicolor]
Length=821

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = -1

Query  715  GASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELR  536
            G++  Q+ +Y  + DSS L+ + G  DP   T  FVKVYKSGSVGRSLDITRF++Y ELR
Sbjct  692  GSTYLQSPMYGCLDDSSGLLQNTGENDPAART--FVKVYKSGSVGRSLDITRFSNYAELR  749

Query  535  QELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQT  356
            +ELGQM+GI+G L+DP RSGWQLVFVDREND+LLLGDDPWE+FVN+VWYIKILSPEDV  
Sbjct  750  EELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHK  809

Query  355  LGK  347
            +GK
Sbjct  810  MGK  812



>emb|CDQ51986.1| auxin response factor, partial [Fagus sylvatica]
Length=169

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = -1

Query  655  HSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSG  476
             + G V+P  PT  FVKVYKSGS GRSLDIT+F SYHELR EL +M+G+EG LEDP RSG
Sbjct  36   ENVGQVNP--PTRTFVKVYKSGSFGRSLDITKFTSYHELRGELARMFGLEGELEDPLRSG  93

Query  475  WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTS  296
            WQLVFVDREND+LLLGDDPWE FVN+VW IKILSP++VQ +GK+  E L+   ++R+++S
Sbjct  94   WQLVFVDRENDVLLLGDDPWE-FVNSVWCIKILSPQEVQQMGKRGLELLNSVPIQRLSSS  152

Query  295  GAD  287
              D
Sbjct  153  SCD  155



>ref|XP_009385053.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385054.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 8/149 (5%)
 Frame = -1

Query  661  LMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQ  485
             +HS   VD L P S   VKVYKSGS+GRSLDI +F+SYHELR ELG ++G+EG LEDP 
Sbjct  765  FLHSPENVDSLNPKSRTSVKVYKSGSLGRSLDIAKFSSYHELRSELGHLFGLEGQLEDPL  824

Query  484  RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM  305
            RSGWQLVFVDRENDILL+GDDPW+ FVN+VW IKILSP++VQ +GKQ  E L+   ++R+
Sbjct  825  RSGWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQEVQQMGKQSVEFLNSTCIKRL  884

Query  304  NTSGA-------DGRDFLSGLPSLGSLEY  239
              +         D R   +G+ S+G+LEY
Sbjct  885  PNNSCDDYINRQDSRTVSTGIASVGTLEY  913



>ref|XP_010275037.1| PREDICTED: auxin response factor 6 [Nelumbo nucifera]
Length=958

 Score =   178 bits (451),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKV+KSGS GRSLDITRF+SYHELR EL +++G+EG LEDP RSGW
Sbjct  816  NVGQVNP--PTRTFVKVHKSGSFGRSLDITRFSSYHELRSELARLFGLEGQLEDPLRSGW  873

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW+ FVNNVW IKILSP++VQ +GKQ  E L+   ++R++++ 
Sbjct  874  QLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGKQGIELLNSVPIQRLSSNS  933

Query  292  A-------DGRDFLSGLPSLGSLEY  239
                    D R+  SG+ S+G L+Y
Sbjct  934  CDDYVSRQDSRNLSSGITSVGLLDY  958



>ref|XP_008229616.1| PREDICTED: auxin response factor 6-like isoform X2 [Prunus mume]
Length=915

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLE  494
            D S  + S+  VD + PT  FVKV+KSGS GRSLDI++F+SY ELR EL +M+G+EG LE
Sbjct  761  DESGFLQSSENVDQVNPTRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLE  820

Query  493  DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---EAESLSR  323
            DPQRSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+    A S+  
Sbjct  821  DPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGHNRAASVPS  880

Query  322  NVVERMNTSGADG-------RDFLSGLPSLGSLEY  239
            N +     +  D        R+  +G+ SLGSL+Y
Sbjct  881  NKLSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  915



>ref|XP_008229615.1| PREDICTED: auxin response factor 6-like isoform X1 [Prunus mume]
Length=947

 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLE  494
            D S  + S+  VD + PT  FVKV+KSGS GRSLDI++F+SY ELR EL +M+G+EG LE
Sbjct  793  DESGFLQSSENVDQVNPTRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLE  852

Query  493  DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---EAESLSR  323
            DPQRSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+    A S+  
Sbjct  853  DPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGHNRAASVPS  912

Query  322  NVVERMNTSGADG-------RDFLSGLPSLGSLEY  239
            N +     +  D        R+  +G+ SLGSL+Y
Sbjct  913  NKLSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  947



>ref|XP_010941528.1| PREDICTED: auxin response factor 17-like isoform X2 [Elaeis guineensis]
Length=823

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 9/154 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLT-PTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGL  500
            D+S  + S   VD ++ P S  FVKVYK+GS GRSLDITRF+SYHELR ELG+++G+EG 
Sbjct  670  DASRFLQSPENVDQVSHPQSGTFVKVYKAGSFGRSLDITRFSSYHELRSELGRLFGLEGQ  729

Query  499  LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRN  320
            LEDP RSGWQLVFVDREND+LL+GDDPW+ FVN V+ IKILSP++VQ +G+Q  + LS  
Sbjct  730  LEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQEVQQMGRQGVDLLSSA  789

Query  319  VVERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++R+ ++  DG       R+  SG+ S+GSL+Y
Sbjct  790  PIKRLPSNSCDGYVSRQDSRNLSSGVTSVGSLDY  823



>ref|XP_011085226.1| PREDICTED: auxin response factor 6-like isoform X1 [Sesamum indicum]
Length=910

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 9/135 (7%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKVYKSGS GRSLDIT+F+SYHELR EL QM+G+EG LEDP RSGWQLVFVDREND+L
Sbjct  776  TFVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGQLEDPLRSGWQLVFVDRENDVL  835

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVER--MNTSGADG-------  284
            LLGDDPW+ FVN+VW IKILSP++VQ +GKQ  E L+   V+R  +    +DG       
Sbjct  836  LLGDDPWQEFVNSVWCIKILSPQEVQEMGKQRLEILTSVPVQRPPLPNGTSDGYVSRQEA  895

Query  283  RDFLSGLPSLGSLEY  239
            R+  +G+PS+G+L++
Sbjct  896  RNINAGIPSVGTLDF  910



>ref|XP_010941526.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=919

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 9/154 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLT-PTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGL  500
            D+S  + S   VD ++ P S  FVKVYK+GS GRSLDITRF+SYHELR ELG+++G+EG 
Sbjct  766  DASRFLQSPENVDQVSHPQSGTFVKVYKAGSFGRSLDITRFSSYHELRSELGRLFGLEGQ  825

Query  499  LEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRN  320
            LEDP RSGWQLVFVDREND+LL+GDDPW+ FVN V+ IKILSP++VQ +G+Q  + LS  
Sbjct  826  LEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQEVQQMGRQGVDLLSSA  885

Query  319  VVERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++R+ ++  DG       R+  SG+ S+GSL+Y
Sbjct  886  PIKRLPSNSCDGYVSRQDSRNLSSGVTSVGSLDY  919



>ref|XP_010923656.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
 ref|XP_010923657.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
Length=950

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P   T  FVKVYKSGS GRSLDITRFNSY ELR ELG+++G+EG LEDP RSGW
Sbjct  808  NGGHVNPQNGT--FVKVYKSGSFGRSLDITRFNSYPELRSELGRLFGLEGQLEDPMRSGW  865

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW+ FVNNVW IKILSP++VQ +GK+  E LS    +R+  SG
Sbjct  866  QLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGKEGGELLSTAPSKRLPGSG  925

Query  292  ADG-------RDFLSGLPSLGSLEY  239
             DG       R   +G+ S+  L+Y
Sbjct  926  CDGYSSRQDSRSMRNGIASVMPLDY  950



>ref|XP_007048898.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOX93055.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=913

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + PT+  F+KV+KSGS GRSLDI++F+SY ELR EL +M+G+EG L
Sbjct  759  DESGYLQSSENVDQVNPTTGTFLKVHKSGSFGRSLDISKFSSYDELRCELARMFGLEGQL  818

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVFVDRENDILLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +   
Sbjct  819  EDPQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGLTPATSVP  878

Query  316  VERMNTSGADGRDFLS---------GLPSLGSLEY  239
             +R+  S     D++S         GL S+GSLEY
Sbjct  879  SQRLTHSSNHCDDYMSRQDLRSSGNGLASMGSLEY  913



>ref|XP_011085227.1| PREDICTED: auxin response factor 6-like isoform X2 [Sesamum indicum]
Length=909

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 9/135 (7%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKVYKSGS GRSLDIT+F+SYHELR EL QM+G+EG LEDP RSGWQLVFVDREND+L
Sbjct  775  TFVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGQLEDPLRSGWQLVFVDRENDVL  834

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVER--MNTSGADG-------  284
            LLGDDPW+ FVN+VW IKILSP++VQ +GKQ  E L+   V+R  +    +DG       
Sbjct  835  LLGDDPWQEFVNSVWCIKILSPQEVQEMGKQRLEILTSVPVQRPPLPNGTSDGYVSRQEA  894

Query  283  RDFLSGLPSLGSLEY  239
            R+  +G+PS+G+L++
Sbjct  895  RNINAGIPSVGTLDF  909



>ref|XP_010923658.1| PREDICTED: auxin response factor 17 isoform X2 [Elaeis guineensis]
Length=949

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P   T  FVKVYKSGS GRSLDITRFNSY ELR ELG+++G+EG LEDP RSGW
Sbjct  807  NGGHVNPQNGT--FVKVYKSGSFGRSLDITRFNSYPELRSELGRLFGLEGQLEDPMRSGW  864

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW+ FVNNVW IKILSP++VQ +GK+  E LS    +R+  SG
Sbjct  865  QLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGKEGGELLSTAPSKRLPGSG  924

Query  292  ADG-------RDFLSGLPSLGSLEY  239
             DG       R   +G+ S+  L+Y
Sbjct  925  CDGYSSRQDSRSMRNGIASVMPLDY  949



>ref|XP_004134558.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
Length=902

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 108/146 (74%), Gaps = 10/146 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKVYKSGS GRSLDI++F+SYH+LR EL  M+G+EG LEDP RSGW
Sbjct  759  NTGQVNP--PTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRSGW  816

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++R++   
Sbjct  817  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGKRGLELLNSVPIQRLSNGS  876

Query  292  ADG--------RDFLSGLPSLGSLEY  239
             D         R+  SG+ S+GSLEY
Sbjct  877  CDNYANRQESSRNMNSGITSVGSLEY  902



>ref|XP_002279808.1| PREDICTED: auxin response factor 6 [Vitis vinifera]
Length=908

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 110/145 (76%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP+RSGW
Sbjct  766  NVGQVNP--PTRTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGQLEDPRRSGW  823

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILS ++VQ +GK+  E L+   ++R+ +S 
Sbjct  824  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSLQEVQQMGKRGLELLNSVPIQRLTSSS  883

Query  292  A-------DGRDFLSGLPSLGSLEY  239
                    D R+  +G+ S+GSL+Y
Sbjct  884  CDDYASRQDSRNLSTGITSVGSLDY  908



>ref|XP_009797609.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=891

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRE  449
            +P + FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EGLLEDP RSGWQLVFVDRE
Sbjct  755  SPHNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGWQLVFVDRE  814

Query  448  NDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------  287
            ND+LLLGDDPW  FVN+VW IKILSP DVQ +GKQ  E L+   + R + +  D      
Sbjct  815  NDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGKQGLELLNSVSMSRSSNNSCDDFANRS  874

Query  286  -GRDFLSGLPSLGSLEY  239
              R+  SG+ S+ +L+Y
Sbjct  875  ESRNMASGIMSVATLDY  891



>ref|XP_004166469.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
 gb|KGN49430.1| hypothetical protein Csa_6G524670 [Cucumis sativus]
Length=916

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 108/146 (74%), Gaps = 10/146 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKVYKSGS GRSLDI++F+SYH+LR EL  M+G+EG LEDP RSGW
Sbjct  773  NTGQVNP--PTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRSGW  830

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++R++   
Sbjct  831  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGKRGLELLNSVPIQRLSNGS  890

Query  292  ADG--------RDFLSGLPSLGSLEY  239
             D         R+  SG+ S+GSLEY
Sbjct  891  CDNYANRQESSRNMNSGITSVGSLEY  916



>ref|XP_009797608.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=899

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRE  449
            +P + FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EGLLEDP RSGWQLVFVDRE
Sbjct  763  SPHNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGWQLVFVDRE  822

Query  448  NDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------  287
            ND+LLLGDDPW  FVN+VW IKILSP DVQ +GKQ  E L+   + R + +  D      
Sbjct  823  NDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGKQGLELLNSVSMSRSSNNSCDDFANRS  882

Query  286  -GRDFLSGLPSLGSLEY  239
              R+  SG+ S+ +L+Y
Sbjct  883  ESRNMASGIMSVATLDY  899



>gb|KDO57333.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=766

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  658  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  717

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWE  413
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE
Sbjct  718  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWE  759



>gb|KDO57334.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=773

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  658  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  717

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWE  413
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE
Sbjct  718  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWE  759



>dbj|BAD19063.1| auxin response factor 3 [Cucumis sativus]
Length=916

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 13/156 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            + S  +HS    G V+P  PT+ FVKVYKSGS GRSLDI++F+ YH+LR EL  M+G+EG
Sbjct  763  EDSGFLHSPENTGQVNP--PTTTFVKVYKSGSFGRSLDISKFSRYHQLRSELAHMFGLEG  820

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+ 
Sbjct  821  ELEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGKRGLELLNS  880

Query  322  NVVERMNTSGADG--------RDFLSGLPSLGSLEY  239
              ++R++    D         R+  SG+ S+GSLEY
Sbjct  881  VPIQRLSNGSCDNYANRQESSRNMNSGITSVGSLEY  916



>gb|KDO57335.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis]
Length=797

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D LTPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  682  LGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWE  413
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE
Sbjct  742  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWE  783



>ref|XP_008439586.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6 [Cucumis 
melo]
Length=915

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 108/146 (74%), Gaps = 10/146 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  PT  FVKVYKSGS GRSLDI++F+SYH+LR EL  M+G+EG LEDP RSGW
Sbjct  772  NTGQVNP--PTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGKLEDPLRSGW  829

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++V+ +GK+  E L+   ++R++   
Sbjct  830  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVEDMGKRGLELLNSVPIQRLSNGS  889

Query  292  ADG--------RDFLSGLPSLGSLEY  239
             D         R+  SG+ S+GSLEY
Sbjct  890  CDNYANRQESSRNLSSGITSVGSLEY  915



>ref|XP_004293501.1| PREDICTED: auxin response factor 6 [Fragaria vesca subsp. vesca]
Length=880

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 8/137 (6%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P   FVKVYKSGS GRSLDIT+F+SYHELR+EL +M+G++G LEDP RSGWQLVFVDREN
Sbjct  744  PNGNFVKVYKSGSYGRSLDITKFSSYHELRRELARMFGLDGELEDPVRSGWQLVFVDREN  803

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA--------  290
            D+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L    ++R++++          
Sbjct  804  DVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLKSVPMQRLSSNSCDDYGGSRQ  863

Query  289  DGRDFLSGLPSLGSLEY  239
            D R+  SG+ S+GSLEY
Sbjct  864  DSRNLSSGITSVGSLEY  880



>ref|XP_009627654.1| PREDICTED: auxin response factor 6-like isoform X3 [Nicotiana 
tomentosiformis]
Length=891

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRE  449
            +P + FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EGLLEDP RSGWQLVFVDRE
Sbjct  755  SPHNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGWQLVFVDRE  814

Query  448  NDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------  287
            ND+LLLGDDPW  FVN+VW IKILSP DVQ +G+Q  E L+   + R + +  D      
Sbjct  815  NDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGRQGLELLNSVSMSRSSNNSCDDFANRS  874

Query  286  -GRDFLSGLPSLGSLEY  239
              R+  SG+ S+ +L+Y
Sbjct  875  ESRNMTSGIMSVATLDY  891



>ref|XP_009627652.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=906

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRE  449
            +P + FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EGLLEDP RSGWQLVFVDRE
Sbjct  770  SPHNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGWQLVFVDRE  829

Query  448  NDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------  287
            ND+LLLGDDPW  FVN+VW IKILSP DVQ +G+Q  E L+   + R + +  D      
Sbjct  830  NDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGRQGLELLNSVSMSRSSNNSCDDFANRS  889

Query  286  -GRDFLSGLPSLGSLEY  239
              R+  SG+ S+ +L+Y
Sbjct  890  ESRNMTSGIMSVATLDY  906



>ref|XP_010052021.1| PREDICTED: auxin response factor 6 [Eucalyptus grandis]
 gb|KCW75878.1| hypothetical protein EUGRSUZ_D00264 [Eucalyptus grandis]
Length=897

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 7/136 (5%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            PT  FVKVYKSGS GRSLDIT+F+SY+ELR EL +M+ +EG LEDP RSGWQLVFVDREN
Sbjct  759  PTRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFSLEGQLEDPVRSGWQLVFVDREN  818

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-------D  287
            D LLLGD PW  FVN+VW IKILSP++VQ +GKQ+ E L+   V+R +  G        D
Sbjct  819  DSLLLGDGPWPEFVNSVWCIKILSPQEVQQMGKQDLELLNSIPVQRHSNGGCDEFTNRQD  878

Query  286  GRDFLSGLPSLGSLEY  239
             R   SG+PS+GSL+Y
Sbjct  879  SRTINSGIPSVGSLDY  894



>ref|XP_009627653.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = -1

Query  628  TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRE  449
            +P + FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EGLLEDP RSGWQLVFVDRE
Sbjct  763  SPHNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGWQLVFVDRE  822

Query  448  NDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------  287
            ND+LLLGDDPW  FVN+VW IKILSP DVQ +G+Q  E L+   + R + +  D      
Sbjct  823  NDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGRQGLELLNSVSMSRSSNNSCDDFANRS  882

Query  286  -GRDFLSGLPSLGSLEY  239
              R+  SG+ S+ +L+Y
Sbjct  883  ESRNMTSGIMSVATLDY  899



>ref|XP_009602213.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=893

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 15/157 (10%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV+KSGS GRSLDI++F+SYHELR EL  M+G+EGLL
Sbjct  740  DESGFLQSSENGDQANPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLL  799

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ--------E  341
            EDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK         +
Sbjct  800  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKAGLDLPNAGQ  859

Query  340  AESLSRNVV---ERMNTSGADGRDFLSGLPSLGSLEY  239
            A+ L  N V   + MN  G+  R+ ++G+P LGSL+Y
Sbjct  860  AQRLPSNGVGCDDYMNQKGS--RNTMNGIP-LGSLDY  893



>ref|XP_009602214.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=892

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 15/157 (10%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV+KSGS GRSLDI++F+SYHELR EL  M+G+EGLL
Sbjct  739  DESGFLQSSENGDQANPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLL  798

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ--------E  341
            EDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK         +
Sbjct  799  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKAGLDLPNAGQ  858

Query  340  AESLSRNVV---ERMNTSGADGRDFLSGLPSLGSLEY  239
            A+ L  N V   + MN  G+  R+ ++G+P LGSL+Y
Sbjct  859  AQRLPSNGVGCDDYMNQKGS--RNTMNGIP-LGSLDY  892



>gb|KDP38016.1| hypothetical protein JCGZ_04659 [Jatropha curcas]
Length=899

 Score =   171 bits (434),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 9/143 (6%)
 Frame = -1

Query  646  GPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQL  467
            G V+P  P+  FVKVYKSGS GRSLDIT+F+SY+ELR EL +M+G+EG LEDP RSGWQL
Sbjct  759  GQVNP--PSRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQL  816

Query  466  VFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-----  302
            VFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++R++     
Sbjct  817  VFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPIQRLSNGSCD  876

Query  301  --TSGADGRDFLSGLPSLGSLEY  239
               S  D R+  +G+ S+GSL+Y
Sbjct  877  DYASRQDSRNLSTGITSVGSLDY  899



>ref|XP_009757615.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=893

 Score =   171 bits (434),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 11/155 (7%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV+KSGS GRSLDI++F+SYHELR EL  M+G+EGLL
Sbjct  740  DESGFLQSSENGDQGNPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLL  799

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK   +  +  +
Sbjct  800  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKDGLDLPNAGL  859

Query  316  VERMNTSGADGRDF---------LSGLPSLGSLEY  239
            V+R+ ++G    D+         ++G+P LGSL+Y
Sbjct  860  VQRLPSNGVGCDDYMNQKGSQNAMNGIP-LGSLDY  893



>ref|XP_009757616.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=892

 Score =   171 bits (434),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 11/155 (7%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV+KSGS GRSLDI++F+SYHELR EL  M+G+EGLL
Sbjct  739  DESGFLQSSENGDQGNPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLL  798

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK   +  +  +
Sbjct  799  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKDGLDLPNAGL  858

Query  316  VERMNTSGADGRDF---------LSGLPSLGSLEY  239
            V+R+ ++G    D+         ++G+P LGSL+Y
Sbjct  859  VQRLPSNGVGCDDYMNQKGSQNAMNGIP-LGSLDY  892



>ref|XP_007024965.1| Auxin response factor 6 isoform 4 [Theobroma cacao]
 gb|EOY27587.1| Auxin response factor 6 isoform 4 [Theobroma cacao]
Length=604

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  470  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  529

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  530  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYVSRQDS  589

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  590  RNLSSGIASVGSLDY  604



>ref|XP_011468187.1| PREDICTED: auxin response factor 6-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=949

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 118/180 (66%), Gaps = 20/180 (11%)
 Frame = -1

Query  718  LGASGFQNSLYDY----------MQDSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSL  572
             GAS +  +  DY            D S  + S+  VD + P T  FVKV+K GS GRSL
Sbjct  770  FGASNYTTTGNDYPLNSDMTTSSCVDESGFLQSSENVDQINPPTRTFVKVHKLGSFGRSL  829

Query  571  DITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVW  392
            DI++F+SY ELR ELG M+G+EG LEDPQRSGWQLVFVDREND+LLLGDDPW+ FVNNVW
Sbjct  830  DISKFSSYDELRSELGSMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  889

Query  391  YIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRDFLS---------GLPSLGSLEY  239
            YIKILSP +VQ +GK+   S++    ++ +   +   D++S         G+ SLGSL+Y
Sbjct  890  YIKILSPLEVQQMGKEGLNSVASVPSQKQSNGNSTCDDYVSRQDMRNSSNGIASLGSLDY  949



>ref|XP_004304523.1| PREDICTED: auxin response factor 6-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 118/180 (66%), Gaps = 20/180 (11%)
 Frame = -1

Query  718  LGASGFQNSLYDY----------MQDSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSL  572
             GAS +  +  DY            D S  + S+  VD + P T  FVKV+K GS GRSL
Sbjct  736  FGASNYTTTGNDYPLNSDMTTSSCVDESGFLQSSENVDQINPPTRTFVKVHKLGSFGRSL  795

Query  571  DITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVW  392
            DI++F+SY ELR ELG M+G+EG LEDPQRSGWQLVFVDREND+LLLGDDPW+ FVNNVW
Sbjct  796  DISKFSSYDELRSELGSMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  855

Query  391  YIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRDFLS---------GLPSLGSLEY  239
            YIKILSP +VQ +GK+   S++    ++ +   +   D++S         G+ SLGSL+Y
Sbjct  856  YIKILSPLEVQQMGKEGLNSVASVPSQKQSNGNSTCDDYVSRQDMRNSSNGIASLGSLDY  915



>ref|XP_006481966.1| PREDICTED: auxin response factor 8-like isoform X3 [Citrus sinensis]
Length=783

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            LG SGF NS+Y  MQDSSEL+H+ G +D  TPT  FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  682  LGDSGFHNSMYGCMQDSSELLHNVGQIDQPTPTRTFVKVYKSGSVGRSLDISRFSSYNEL  741

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWE  413
            R+ELGQM+GIEG  EDP RSGWQLVFVDREND+LLLGDDPWE
Sbjct  742  REELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWE  783



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 9/138 (7%)
 Frame = -1

Query  625   PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
             PT  FVKV+KSGS GRSLDI++F+SY ELR EL +M+G+EG LEDPQRSGWQLVFVDREN
Sbjct  898   PTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDREN  957

Query  445   DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRDFLS-  269
             D+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     S     +++ S     D++S 
Sbjct  958   DVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSPASSVPSHKLSNSNNACDDYISR  1017

Query  268   --------GLPSLGSLEY  239
                     G+PS+G L+Y
Sbjct  1018  QDMRNSSNGIPSMGDLDY  1035



>ref|XP_006468259.1| PREDICTED: auxin response factor 6-like isoform X2 [Citrus sinensis]
 gb|KDO75359.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=896

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = -1

Query  646  GPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQL  467
            G V+P  P   FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP RSGWQL
Sbjct  756  GQVNP--PNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQL  813

Query  466  VFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-  290
            VFVDREND+LLLGD PW  FVN+VW IKILSP +VQ +GK+  E L+   ++R++ S   
Sbjct  814  VFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGKRGNELLNSVPIQRLSNSSCD  873

Query  289  ------DGRDFLSGLPSLGSLEY  239
                  D R+  +G+ S+GSL++
Sbjct  874  DYATRQDSRNLSAGITSVGSLDF  896



>ref|XP_007217690.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
 gb|EMJ18889.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
Length=919

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 109/155 (70%), Gaps = 10/155 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLE  494
            D S  + S+  VD + PT  FVKV+KSGS GRSLDI++F+SY ELR EL +M+G+EG LE
Sbjct  765  DESGFLQSSENVDQVNPTRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLE  824

Query  493  DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVV  314
            DPQRSGWQLVF DREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +    
Sbjct  825  DPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLNCAASVPS  884

Query  313  ERMNTSG----------ADGRDFLSGLPSLGSLEY  239
             +++  G           D R+  +G+ SLGSL+Y
Sbjct  885  NKLSNGGNTTCDDYVSRQDVRNSTNGIASLGSLDY  919



>ref|XP_006468258.1| PREDICTED: auxin response factor 6-like isoform X1 [Citrus sinensis]
 gb|KDO75360.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=899

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = -1

Query  646  GPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQL  467
            G V+P  P   FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP RSGWQL
Sbjct  759  GQVNP--PNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQL  816

Query  466  VFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-  290
            VFVDREND+LLLGD PW  FVN+VW IKILSP +VQ +GK+  E L+   ++R++ S   
Sbjct  817  VFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGKRGNELLNSVPIQRLSNSSCD  876

Query  289  ------DGRDFLSGLPSLGSLEY  239
                  D R+  +G+ S+GSL++
Sbjct  877  DYATRQDSRNLSAGITSVGSLDF  899



>ref|XP_006448968.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
 gb|ESR62208.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
Length=899

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = -1

Query  646  GPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQL  467
            G V+P  P   FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP RSGWQL
Sbjct  759  GQVNP--PNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQL  816

Query  466  VFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-  290
            VFVDREND+LLLGD PW  FVN+VW IKILSP +VQ +GK+  E L+   ++R++ S   
Sbjct  817  VFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGKRGNELLNSVPIQRLSNSSCD  876

Query  289  ------DGRDFLSGLPSLGSLEY  239
                  D R+  +G+ S+GSL++
Sbjct  877  DYATRQDSRNLSAGITSVGSLDF  899



>gb|ABK95163.1| unknown [Populus trichocarpa]
Length=907

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSGS GRSLDI++F+SY ELR EL +++ +EGLL
Sbjct  755  DESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLL  814

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVF DREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +   
Sbjct  815  EDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSPAASVP  874

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++++ S +DG       R+  +G+ S+GSL+Y
Sbjct  875  CQKLSNSNSDGHMNTQGFRNSSNGIASMGSLDY  907



>gb|AFW68990.1| hypothetical protein ZEAMMB73_088581 [Zea mays]
Length=510

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 14/162 (9%)
 Frame = -1

Query  685  DYMQDSSELMHSAGPVDPLT--------PTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            D+  +SS  +  +G V P +        P + FVKVYKSG+ GRSLDITRF+SYHELR+E
Sbjct  347  DHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRE  406

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+++G+EG LEDP RSGWQLVFVDRE D+LL+GDDPW+ FV+ V  IKILSP++VQ +G
Sbjct  407  LGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMG  466

Query  349  KQEAESLSRNVVERMNTSGAD------GRDFLSGLPSLGSLE  242
            KQ  E LS     R+ +S  D       R   +G+ S+GS+E
Sbjct  467  KQGLELLSSAPARRLGSSCDDYVSRQESRSLSTGIASVGSVE  508



>gb|ADH04265.1| ARF1 [Nicotiana benthamiana]
Length=889

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 11/155 (7%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV+KSGS GRSLDI++F++YHELR EL  M+G+EGLL
Sbjct  736  DESGFLQSSENGDQRNPTNRTFVKVHKSGSFGRSLDISKFSNYHELRSELAHMFGLEGLL  795

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK   +  +  +
Sbjct  796  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKDGLDLPNAGL  855

Query  316  VERMNTSGADGRDF---------LSGLPSLGSLEY  239
             +R+ ++G    D+         ++G+P LGSL+Y
Sbjct  856  AQRLPSNGVGCDDYMNQKGSRNTMNGIP-LGSLDY  889



>gb|KHG28199.1| Auxin response factor 6 [Gossypium arboreum]
Length=892

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  758  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  817

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  818  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYASQQDS  877

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  878  RNLSSGIASVGSLDY  892



>ref|XP_011096635.1| PREDICTED: auxin response factor 6 isoform X1 [Sesamum indicum]
Length=903

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 11/147 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  P   FVKVYKSGS GRSLDI++F+SYHELR EL QM+G+EG LEDP RSGW
Sbjct  759  NVGHVNP--PNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGW  816

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++++    
Sbjct  817  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGKRGLELLNSVPIQKLPLPN  876

Query  292  A---------DGRDFLSGLPSLGSLEY  239
                      + R+  +G+PS+G+L++
Sbjct  877  GTCDGFANRQEARNMSAGIPSVGTLDF  903



>ref|XP_011096637.1| PREDICTED: auxin response factor 6 isoform X3 [Sesamum indicum]
Length=901

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 11/147 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  P   FVKVYKSGS GRSLDI++F+SYHELR EL QM+G+EG LEDP RSGW
Sbjct  757  NVGHVNP--PNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGW  814

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++++    
Sbjct  815  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGKRGLELLNSVPIQKLPLPN  874

Query  292  A---------DGRDFLSGLPSLGSLEY  239
                      + R+  +G+PS+G+L++
Sbjct  875  GTCDGFANRQEARNMSAGIPSVGTLDF  901



>ref|XP_011096636.1| PREDICTED: auxin response factor 6 isoform X2 [Sesamum indicum]
Length=902

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 11/147 (7%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            + G V+P  P   FVKVYKSGS GRSLDI++F+SYHELR EL QM+G+EG LEDP RSGW
Sbjct  758  NVGHVNP--PNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGW  815

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSG  293
            QLVFVDREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++++    
Sbjct  816  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGKRGLELLNSVPIQKLPLPN  875

Query  292  A---------DGRDFLSGLPSLGSLEY  239
                      + R+  +G+PS+G+L++
Sbjct  876  GTCDGFANRQEARNMSAGIPSVGTLDF  902



>ref|XP_007024962.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
 gb|EOY27584.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
Length=899

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  765  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  824

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  825  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYVSRQDS  884

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  885  RNLSSGIASVGSLDY  899



>ref|XP_007024963.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOY27585.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=902

 Score =   169 bits (429),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  768  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  827

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  828  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYVSRQDS  887

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  888  RNLSSGIASVGSLDY  902



>ref|XP_011032737.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=909

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSGS GRSLDI++F+SY ELR EL +++ +EGLL
Sbjct  757  DESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLL  816

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVF DREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +   
Sbjct  817  EDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSPAASVP  876

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++++ S  DG       R+  +G+ S+GSL+Y
Sbjct  877  SQKLSNSNCDGHMNRQGFRNSSNGIASMGSLDY  909



>ref|XP_011032738.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=908

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSGS GRSLDI++F+SY ELR EL +++ +EGLL
Sbjct  756  DESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLL  815

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVF DREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +   
Sbjct  816  EDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSPAASVP  875

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++++ S  DG       R+  +G+ S+GSL+Y
Sbjct  876  SQKLSNSNCDGHMNRQGFRNSSNGIASMGSLDY  908



>ref|XP_011085439.1| PREDICTED: auxin response factor 6-like [Sesamum indicum]
Length=929

 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 115/159 (72%), Gaps = 20/159 (13%)
 Frame = -1

Query  682  YMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            Y+Q SSE +    P     P   FVKV+KSGS GRSLDI++F+SY+ELR EL  M+G+EG
Sbjct  780  YLQ-SSENVDQTNP-----PPGTFVKVHKSGSFGRSLDISKFSSYNELRSELAHMFGLEG  833

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
            LLEDPQRSGWQLVFVDREND+LLLGDDPW+ FVN+VWYIKILSP +VQ +GK   E L  
Sbjct  834  LLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWYIKILSPLEVQQMGK---EGLDP  890

Query  322  NVVER--MNTSG---------ADGRDFLSGLPSLGSLEY  239
            N V+   ++++G          D R  L+G+PS+G+L+Y
Sbjct  891  NSVQSHYLSSNGNSCDEFMSRNDPRTSLNGIPSVGTLDY  929



>ref|XP_002307574.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
 gb|EEE94570.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
Length=907

 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSGS GRSLDI++F+SY ELR EL +++ +EGLL
Sbjct  755  DESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLL  814

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDPQRSGWQLVF DREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+     +   
Sbjct  815  EDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSPAASVP  874

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
             ++++ S +DG       R+  +G+ S+GSL+Y
Sbjct  875  SQKLSNSNSDGHMNTQGFRNSSNGIASMGSLDY  907



>gb|KJB57191.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
 gb|KJB57195.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=820

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  686  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  745

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM-------NTSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R+         S  D 
Sbjct  746  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLLNGSCDDYASQQDS  805

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  806  RNLSSGIASVGSLDY  820



>ref|XP_003563403.1| PREDICTED: auxin response factor 17 [Brachypodium distachyon]
Length=907

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 6/135 (4%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P + FVKVYKSG+ GRSLDITRF+SYHELR+ELG+++G+EG LEDP RSGWQLVFVDRE 
Sbjct  773  PPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVDREE  832

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGAD------G  284
            D+LL+GDDPW+ FVN+V+ IKILSP++VQ +GKQ  E LS    +R+ +S  D       
Sbjct  833  DVLLVGDDPWQEFVNSVFCIKILSPQEVQQMGKQGLELLSSAPSKRLGSSCDDYASRQES  892

Query  283  RDFLSGLPSLGSLEY  239
            R   +G+ S+GS+E+
Sbjct  893  RSLSTGIASVGSVEF  907



>ref|XP_008776642.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=912

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 7/133 (5%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKVYKSGS GRSLDITRF+SYHELR ELG+++G+EG LEDP RSGWQLVFVDREND+L
Sbjct  780  TFVKVYKSGSFGRSLDITRFSSYHELRGELGRLFGLEGQLEDPVRSGWQLVFVDRENDVL  839

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADG-------RD  278
            L+GDDPW+ FVN V+ IKILSP++VQ +GKQ    L+   ++R  ++  DG       R+
Sbjct  840  LVGDDPWQEFVNTVYCIKILSPQEVQQMGKQGVNLLNSAPIKRPPSNSCDGYVSRQDSRN  899

Query  277  FLSGLPSLGSLEY  239
              S + S+GSL+Y
Sbjct  900  LSSSITSVGSLDY  912



>ref|XP_006357892.1| PREDICTED: auxin response factor 6-like isoform X1 [Solanum tuberosum]
Length=893

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 17/159 (11%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV KSGS GRSLDI++F+SYHELR EL +M+G+EGLL
Sbjct  738  DESGFLQSSENGDQANPTNRIFVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  797

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---------  344
            EDP+RSGWQLV VDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+         
Sbjct  798  EDPERSGWQLVIVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGLDLPNGVQ  857

Query  343  -EAESLSRNVV---ERMNTSGADGRDFLSGLPSLGSLEY  239
             + ++L  NV    + MN  G+  R+ ++G+P LGSL+Y
Sbjct  858  AQTQTLPGNVNGCDDYMNQKGS--RNTMNGIP-LGSLDY  893



>ref|XP_009393314.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393315.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393316.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393317.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 7/133 (5%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKV KSGS GRSLDITRF+SY+ELR ELG+M+G+EG LEDP RSGWQLVFVDRENDIL
Sbjct  777  TFVKVSKSGSFGRSLDITRFSSYNELRSELGRMFGLEGQLEDPLRSGWQLVFVDRENDIL  836

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-------DGRD  278
            L+GDDPW+ FVNNVW IKILSP++VQ +GK +   L+   ++ + T+G        D R+
Sbjct  837  LVGDDPWQEFVNNVWCIKILSPQEVQQMGKHDVNFLNSGSIKMLPTNGCDDYISRQDSRN  896

Query  277  FLSGLPSLGSLEY  239
              + + S+GSLE+
Sbjct  897  LSTRVASMGSLEH  909



>dbj|BAD19064.1| auxin response factor 4 [Cucumis sativus]
Length=816

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            D S L+ S    G V+P  P   FVKV+KSG+  RSLDIT+FNSY ELR EL +M+G+EG
Sbjct  664  DESGLLQSHENVGQVNP--PNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEG  721

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSPE+VQ +GK+  E L+ 
Sbjct  722  ELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGKRGLELLNS  781

Query  322  NVVERMNTSGA-------DGRDFLSGLPSLGSLEY  239
              ++R++ S         D R+ +SG+ S+G L+Y
Sbjct  782  VPIQRLSNSTCDDYGSRQDSRNLISGIASVGPLDY  816



>ref|XP_006357893.1| PREDICTED: auxin response factor 6-like isoform X2 [Solanum tuberosum]
Length=892

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 17/159 (11%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+   D   PT+  FVKV KSGS GRSLDI++F+SYHELR EL +M+G+EGLL
Sbjct  737  DESGFLQSSENGDQANPTNRIFVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  796

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---------  344
            EDP+RSGWQLV VDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+         
Sbjct  797  EDPERSGWQLVIVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGLDLPNGVQ  856

Query  343  -EAESLSRNVV---ERMNTSGADGRDFLSGLPSLGSLEY  239
             + ++L  NV    + MN  G+  R+ ++G+P LGSL+Y
Sbjct  857  AQTQTLPGNVNGCDDYMNQKGS--RNTMNGIP-LGSLDY  892



>gb|KJB57190.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=904

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI++F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  770  TRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDREND  829

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM-------NTSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R+         S  D 
Sbjct  830  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLLNGSCDDYASQQDS  889

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  890  RNLSSGIASVGSLDY  904



>gb|AHY24213.1| auxin response factor, partial [Dimocarpus longan]
Length=877

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHSAGPVDPL-TPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  +HS+  V+ + T    FVKV+KSGS GRSLDI++F+SY ELR EL +M+G+EG L
Sbjct  725  DESGFLHSSENVEQVNTSNRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQL  784

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            ED QRSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +VQ +GK+   S+S   
Sbjct  785  EDSQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKEGLSSMSSVP  844

Query  316  VERMNTSGADGRDFLS---------GLPSLGSLEY  239
             +R++ +  D  D+LS         G+ S+GSL+Y
Sbjct  845  GQRLSNNNCD--DYLSRQELRSSSNGVASMGSLDY  877



>ref|XP_004150775.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
 gb|KGN65880.1| Auxin response factor 4 [Cucumis sativus]
Length=899

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            D S L+ S    G V+P  P   FVKV+KSG+  RSLDIT+FNSY ELR EL +M+G+EG
Sbjct  747  DESGLLQSHENVGQVNP--PNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEG  804

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSPE+VQ +GK+  E L+ 
Sbjct  805  ELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGKRGLELLNS  864

Query  322  NVVERMNTSGA-------DGRDFLSGLPSLGSLEY  239
              ++R++ S         D R+ +SG+ S+G L+Y
Sbjct  865  VPIQRLSNSTCDDYGSRQDSRNLISGIASVGPLDY  899



>ref|XP_010090447.1| Auxin response factor 6 [Morus notabilis]
 gb|EXB39505.1| Auxin response factor 6 [Morus notabilis]
Length=902

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 7/136 (5%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P   FVKV+KSGS GRSLDIT+F+SY+ELR EL +M+G+EG LEDP RSGWQLVFVDREN
Sbjct  767  PNRTFVKVHKSGSFGRSLDITKFSSYNELRGELARMFGLEGELEDPVRSGWQLVFVDREN  826

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNT-------SGAD  287
            D+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   ++R+         S  D
Sbjct  827  DVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVSIQRLANNSCDDYPSCED  886

Query  286  GRDFLSGLPSLGSLEY  239
             R+  SG+ S+GSL+Y
Sbjct  887  SRNLSSGITSVGSLDY  902



>ref|XP_004164684.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6-like, 
partial [Cucumis sativus]
Length=884

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            D S L+ S    G V+P  P   FVKV+KSG+  RSLDIT+FNSY ELR EL +M+G+EG
Sbjct  732  DESGLLQSHENVGQVNP--PNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEG  789

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSPE+VQ +GK+  E L+ 
Sbjct  790  ELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGKRGLELLNS  849

Query  322  NVVERMNTSGA-------DGRDFLSGLPSLGSLEY  239
              ++R++ S         D R+ +SG+ S+G L+Y
Sbjct  850  VPIQRLSNSTCDDYGSRQDSRNLISGIASVGPLDY  884



>gb|AIF77047.1| auxin response factor 8, partial [Hevea brasiliensis]
Length=91

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  679  MQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGL  500
            +QDSSEL+ SAG VDP TP+  FVKVYKSGSVGRSLDI+RF+SYHELR+EL QM+GIEG 
Sbjct  2    VQDSSELLPSAGQVDPPTPSRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGK  61

Query  499  LEDPQRSGWQLVFVDRENDILLLGDDPWEA  410
            LE+P+RSGWQLVFVDREN ILLLGDDPWEA
Sbjct  62   LENPRRSGWQLVFVDRENGILLLGDDPWEA  91



>ref|XP_002298839.1| auxin response factor 6 family protein [Populus trichocarpa]
 gb|EEE83644.1| auxin response factor 6 family protein [Populus trichocarpa]
Length=884

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 7/136 (5%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            PT  FVKVYKSGS GRSLDIT+F+SY+ELR EL +M+G+EG LEDP RSGWQLVF+DREN
Sbjct  749  PTRTFVKVYKSGSFGRSLDITKFSSYNELRSELSRMFGLEGQLEDPLRSGWQLVFIDREN  808

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-------D  287
            D+LLLGD PW  FVN+VWYIKILSP++VQ +GK+  E L+   ++R++           D
Sbjct  809  DVLLLGDGPWPEFVNSVWYIKILSPQEVQQMGKRGLELLNSFPIQRLSNGSCDDYANRQD  868

Query  286  GRDFLSGLPSLGSLEY  239
             +   +G+ S+GSL+Y
Sbjct  869  SKSSSTGITSVGSLDY  884



>ref|XP_008444734.1| PREDICTED: auxin response factor 6-like [Cucumis melo]
Length=902

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 12/155 (8%)
 Frame = -1

Query  673  DSSELMHS---AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEG  503
            D S L+ S    G V+P  P   FVKV+KSG+  RSLDIT+FNSY ELR EL +M+G+EG
Sbjct  750  DESGLLQSHENVGQVNP--PNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEG  807

Query  502  LLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSR  323
             LEDP RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSPE+VQ +GK+  E L+ 
Sbjct  808  ELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGKRGLELLNS  867

Query  322  NVVERMNTSGA-------DGRDFLSGLPSLGSLEY  239
              ++R++ S         D R+ +SG+ S+G L+Y
Sbjct  868  VPIQRLSNSTCDDYGSRQDSRNLISGIASVGPLDY  902



>gb|ACM66271.1| ARF8 [Solanum melongena]
Length=891

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 10/134 (7%)
 Frame = -1

Query  613  FVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILL  434
            FVKV KSGS GRSLDI++F+SYHELR EL +M+G+EGLLEDP+RSGWQLV VDREND+LL
Sbjct  759  FVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVIVDRENDVLL  818

Query  433  LGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM--NTSGAD-------GR  281
            LGDDPW+ FVNNVWYIKILSP +VQ +GK+  + L+    +R+  N +G D        R
Sbjct  819  LGDDPWQEFVNNVWYIKILSPYEVQQMGKEGLDLLNGVRTQRLPGNVNGCDDYMNQKGSR  878

Query  280  DFLSGLPSLGSLEY  239
            + ++G+P LGSL+Y
Sbjct  879  NTMNGIP-LGSLDY  891



>emb|CBA11997.1| putative auxin response factor 6, partial [Cabomba aquatica]
Length=856

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 104/144 (72%), Gaps = 9/144 (6%)
 Frame = -1

Query  649  AGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQ  470
             G VDP  P   FVKV+K GS GRSLDIT F+SYHELR EL  M+G+EG LEDP RSGWQ
Sbjct  715  VGLVDP--PDRTFVKVHKLGSYGRSLDITNFSSYHELRSELASMFGLEGQLEDPLRSGWQ  772

Query  469  LVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA  290
            LVFVDREND+LLLGDDPW+ FVNNVW IKILSP++VQ +G+Q+   L    ++R ++S  
Sbjct  773  LVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGRQDLALLHSISLQRQDSSTC  832

Query  289  D-------GRDFLSGLPSLGSLEY  239
            D        R+  SG+ S+ SL+Y
Sbjct  833  DDFANQQNSRNPSSGITSVESLDY  856



>ref|XP_009399037.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
 ref|XP_009399038.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 110/153 (72%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            + SE + S   V  + P +  FVKVYKSGS GRSLDIT+FNSY ELR ELG+++G+EGLL
Sbjct  774  EDSEFLQSPNSVGVMNPQNGTFVKVYKSGSFGRSLDITKFNSYPELRSELGRLFGLEGLL  833

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP RSGWQLVFVDREND+LL+GDDPW  FVNNV  IKILSP++VQ +GK+  + L+   
Sbjct  834  EDPLRSGWQLVFVDRENDVLLVGDDPWHEFVNNVSSIKILSPQEVQQMGKEGVDLLNAAT  893

Query  316  VERMNTSGAD-------GRDFLSGLPSLGSLEY  239
              R+ +  +D        R+  +G+ S+GSL+Y
Sbjct  894  NRRIPSHTSDEYISRQESRNLSNGMASVGSLDY  926



>gb|KCW89820.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
 gb|KCW89821.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
 gb|KCW89822.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
Length=554

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSG+ GRSLDI++F+SY ELR EL +M+G+EG L
Sbjct  431  DESGFLQSSENVDQVNPPTRTFVKVHKSGTFGRSLDISKFSSYDELRSELARMFGLEGQL  490

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---EAESLS  326
            EDPQRSGWQLVFVDRENDILLLGDDPW+ FVNNVWYIKILSP +V+ LGKQ    A S+ 
Sbjct  491  EDPQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVKQLGKQGINPANSVP  550

Query  325  RNVV  314
            R  +
Sbjct  551  RQAL  554



>ref|XP_010908740.1| PREDICTED: auxin response factor 17-like isoform X4 [Elaeis guineensis]
Length=723

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  +HS   VD +   S  FVKVYKSGS GR LDI RF+SYHELR ELG+++G+EG L
Sbjct  571  DKSGFLHSVENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRL  630

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP RSGWQLVFVDREND LL+GDDPW+ FVNNV  IKILSP++VQ +GKQ    L+   
Sbjct  631  EDPVRSGWQLVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGKQGVGLLNSAP  690

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
            ++R+ ++  DG        +  +G+ S+GSL Y
Sbjct  691  IKRLPSNSCDGYGSRQDSSNLSTGITSVGSLNY  723



>gb|AFW68989.1| hypothetical protein ZEAMMB73_088581 [Zea mays]
 gb|AIB04307.1| ARF transcription factor, partial [Zea mays]
Length=739

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 14/162 (9%)
 Frame = -1

Query  685  DYMQDSSELMHSAGPVDPLT--------PTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            D+  +SS  +  +G V P +        P + FVKVYKSG+ GRSLDITRF+SYHELR+E
Sbjct  576  DHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRE  635

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+++G+EG LEDP RSGWQLVFVDRE D+LL+GDDPW+ FV+ V  IKILSP++VQ +G
Sbjct  636  LGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMG  695

Query  349  KQEAESLSRNVVERMNTSGAD------GRDFLSGLPSLGSLE  242
            KQ  E LS     R+ +S  D       R   +G+ S+GS+E
Sbjct  696  KQGLELLSSAPARRLGSSCDDYVSRQESRSLSTGIASVGSVE  737



>ref|NP_001234663.1| auxin response factor 6 [Solanum lycopersicum]
 gb|ACU30063.2| auxin response factor 6 [Solanum lycopersicum]
Length=881

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 10/137 (7%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKS S GRSLDI++F+SY+ELR EL +M+G+EGLLEDP+RSGWQLVFVDREND
Sbjct  746  TETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDREND  805

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRD-----  278
            +LLLGDDPW  FVN+VWYIKILSP +VQ +GKQ  +  S    +R+ ++G    D     
Sbjct  806  VLLLGDDPWHEFVNSVWYIKILSPLEVQQMGKQGLDLPSAGKTQRITSNGNGCDDSMNRN  865

Query  277  ----FLSGLPSLGSLEY  239
                 ++G+P LGSLEY
Sbjct  866  HSCNIMNGIP-LGSLEY  881



>gb|ADK91822.1| auxin response factor 6 [Solanum lycopersicum]
Length=868

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 10/137 (7%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKS S GRSLDI++F+SY+ELR EL +M+G+EGLLEDP+RSGWQLVFVDREND
Sbjct  733  TETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDREND  792

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADGRD-----  278
            +LLLGDDPW  FVN+VWYIKILSP +VQ +GKQ  +  S    +R+ ++G    D     
Sbjct  793  VLLLGDDPWHEFVNSVWYIKILSPLEVQQMGKQGLDLPSAGKTQRITSNGNGCDDSMNRN  852

Query  277  ----FLSGLPSLGSLEY  239
                 ++G+P LGSLEY
Sbjct  853  HSCNIMNGIP-LGSLEY  868



>ref|NP_001280959.1| auxin response factor 6-like [Malus domestica]
 gb|ADL36576.1| ARF domain class transcription factor [Malus domestica]
Length=895

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 103/140 (74%), Gaps = 9/140 (6%)
 Frame = -1

Query  637  DPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFV  458
            DPL     FVKVYKSGS GRSLDIT+F+SY ELR EL +M+G+EG L+DP RSGWQLVFV
Sbjct  758  DPLN--RNFVKVYKSGSFGRSLDITKFSSYQELRNELARMFGLEGKLDDPVRSGWQLVFV  815

Query  457  DRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA----  290
            DREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L     +R++ +      
Sbjct  816  DRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLKSVPNQRLSNNSCDDYG  875

Query  289  ---DGRDFLSGLPSLGSLEY  239
               D R+  SG+ S+GSLEY
Sbjct  876  SRQDSRNLSSGITSVGSLEY  895



>ref|XP_008777704.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=916

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 104/133 (78%), Gaps = 7/133 (5%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKVYKSGS+GR LDIT+F+SYHELR ELG+++G+EG LEDP RSGWQLVFVDREND L
Sbjct  784  TFVKVYKSGSLGRLLDITKFSSYHELRSELGRLFGLEGQLEDPVRSGWQLVFVDRENDAL  843

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGADG-------RD  278
            L+GDDPW+ FVN V+ IKIL+P++VQ +GKQ  + L+   ++R+ ++  DG       R+
Sbjct  844  LVGDDPWQEFVNTVYCIKILAPQEVQQMGKQGVDLLNSAPIKRLPSNSCDGYGSRQDSRN  903

Query  277  FLSGLPSLGSLEY  239
              +G+ S+GSL+Y
Sbjct  904  LSAGITSVGSLDY  916



>ref|XP_007212802.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
 gb|EMJ14001.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
Length=887

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = -1

Query  613  FVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILL  434
            FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP RSGWQLVFVDREND+LL
Sbjct  757  FVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLL  816

Query  433  LGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-------DGRDF  275
            LGDDPW  FVN+VW IKILSP +VQ +GK+  + L     +R++ +         D R+ 
Sbjct  817  LGDDPWPEFVNSVWCIKILSPHEVQQMGKRGLDLLKSVPTQRLSNNSCDDYGSRQDSRN-  875

Query  274  LSGLPSLGSLEY  239
            LSG+ S+GSLEY
Sbjct  876  LSGITSVGSLEY  887



>ref|XP_008225531.1| PREDICTED: auxin response factor 6 [Prunus mume]
Length=889

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = -1

Query  613  FVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILL  434
            FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP RSGWQLVFVDREND+LL
Sbjct  759  FVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLL  818

Query  433  LGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA-------DGRDF  275
            LGDDPW  FVN+VW IKILSP +VQ +GK+  + L     +R++ +         D R+ 
Sbjct  819  LGDDPWPEFVNSVWCIKILSPHEVQQMGKRGLDLLKSVPTQRLSNNSCDDYGSRQDSRN-  877

Query  274  LSGLPSLGSLEY  239
            LSG+ S+GSLEY
Sbjct  878  LSGITSVGSLEY  889



>ref|XP_009376828.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
 ref|XP_009376836.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=931

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 9/154 (6%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLE  494
            D S  + S+  VD + PT  FVKV+K GS GRSLDI++F+SY +LR EL +M+G+EG LE
Sbjct  778  DESGFLQSSENVDQVNPTGTFVKVHKLGSFGRSLDISKFSSYDDLRSELARMFGLEGQLE  837

Query  493  DPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVV  314
            DPQRSGWQLVFVDREND+LLLGDDPW+ FVNNV+YIKILSP +VQ +GK+   S++    
Sbjct  838  DPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVYYIKILSPLEVQQMGKEGLNSVASVPN  897

Query  313  ERMNTSGADGRDFLS---------GLPSLGSLEY  239
             +++       D++S         G+ SLGSL+Y
Sbjct  898  NKLSNGSNTTVDYVSRQDLRNSRNGIASLGSLDY  931



>gb|KHG10285.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=843

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI+ F++Y+ELR EL  M+G+EG LEDP RSGWQLVFVDREND
Sbjct  709  TRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEGQLEDPLRSGWQLVFVDREND  768

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  769  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYVSRQDS  828

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  829  RNLSSGIASVGSLDY  843



>ref|XP_010233862.1| PREDICTED: auxin response factor 6-like isoform X3 [Brachypodium 
distachyon]
Length=913

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P + FVKVYKSG+VGR LDITRF+SYHELR ELG ++G+EG LEDP RSGWQLVFVDREN
Sbjct  779  PPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDREN  838

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN------TSGADG  284
            D+LL+GDDPW+ FVN+V  IKILSP++VQ +GKQ  E LS     R+        S  + 
Sbjct  839  DVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKQGIELLSSAPARRLGNGCDNYVSRQES  898

Query  283  RDFLSGLPSLGSLEY  239
            R+  +G+ ++GS+E+
Sbjct  899  RNLSTGIAAVGSVEF  913



>ref|XP_010233861.1| PREDICTED: auxin response factor 6-like isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P + FVKVYKSG+VGR LDITRF+SYHELR ELG ++G+EG LEDP RSGWQLVFVDREN
Sbjct  780  PPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDREN  839

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN------TSGADG  284
            D+LL+GDDPW+ FVN+V  IKILSP++VQ +GKQ  E LS     R+        S  + 
Sbjct  840  DVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKQGIELLSSAPARRLGNGCDNYVSRQES  899

Query  283  RDFLSGLPSLGSLEY  239
            R+  +G+ ++GS+E+
Sbjct  900  RNLSTGIAAVGSVEF  914



>ref|XP_003575362.1| PREDICTED: auxin response factor 6-like isoform X1 [Brachypodium 
distachyon]
Length=915

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = -1

Query  625  PTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREN  446
            P + FVKVYKSG+VGR LDITRF+SYHELR ELG ++G+EG LEDP RSGWQLVFVDREN
Sbjct  781  PPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDREN  840

Query  445  DILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN------TSGADG  284
            D+LL+GDDPW+ FVN+V  IKILSP++VQ +GKQ  E LS     R+        S  + 
Sbjct  841  DVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKQGIELLSSAPARRLGNGCDNYVSRQES  900

Query  283  RDFLSGLPSLGSLEY  239
            R+  +G+ ++GS+E+
Sbjct  901  RNLSTGIAAVGSVEF  915



>ref|XP_009105160.1| PREDICTED: auxin response factor 8-like [Brassica rapa]
 ref|XP_009105162.1| PREDICTED: auxin response factor 8-like [Brassica rapa]
 gb|AFD01305.1| auxin response factor 8-1 [Brassica rapa subsp. pekinensis]
Length=780

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 9/137 (7%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            L  SGFQN+L    Q+++E+    G    +  T+ FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  651  LADSGFQNTL----QETTEVAAHGG----VEHTNNFVKVYKSGSVGRSLDISRFSSYNEL  702

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELG+M+ I+GLLED  RSGWQLVFVD+E+DILLLGDDPWE+FVN+VWYIKILSP+DV 
Sbjct  703  REELGRMFDIKGLLEDAFRSGWQLVFVDKEDDILLLGDDPWESFVNSVWYIKILSPDDVH  762

Query  358  TLGKQ-EAESLSRNVVE  311
             +G+  E  S  +N+  
Sbjct  763  KMGEHGEGSSFPQNLTH  779



>emb|CDY07460.1| BnaA07g25390D [Brassica napus]
Length=781

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 9/137 (7%)
 Frame = -1

Query  718  LGASGFQNSLYDYMQDSSELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHEL  539
            L  SGFQN+L    Q+++E+    G    +  T+ FVKVYKSGSVGRSLDI+RF+SY+EL
Sbjct  652  LADSGFQNTL----QETTEVAAHGG----VEHTNNFVKVYKSGSVGRSLDISRFSSYNEL  703

Query  538  RQELGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQ  359
            R+ELG+M+ I+GLLED  RSGWQLVFVD+E+DILLLGDDPWE+FVN+VWYIKILSP+DV 
Sbjct  704  REELGRMFDIKGLLEDAFRSGWQLVFVDKEDDILLLGDDPWESFVNSVWYIKILSPDDVH  763

Query  358  TLGKQ-EAESLSRNVVE  311
             +G+  E  S  +N+  
Sbjct  764  KMGEHGEGSSFPQNLTH  780



>ref|XP_008644237.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
 ref|XP_008644238.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
Length=913

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 14/162 (9%)
 Frame = -1

Query  685  DYMQDSSELMHSAGPVDPLT--------PTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            D+  +SS  +  +G V P +        P + FVKVYKSG+ GRSLDITRF+SYHELR+E
Sbjct  750  DHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRE  809

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+++G+EG LEDP RSGWQLVFVDRE D+LL+GDDPW+ FV+ V  IKILSP++VQ +G
Sbjct  810  LGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMG  869

Query  349  KQEAESLSRNVVERMNTSGAD------GRDFLSGLPSLGSLE  242
            KQ  E LS     R+ +S  D       R   +G+ S+GS+E
Sbjct  870  KQGLELLSSAPARRLGSSCDDYVSRQESRSLSTGIASVGSVE  911



>ref|XP_009402570.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402571.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=902

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = -1

Query  661  LMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQ  485
            L+ + G +D L  +S  FVKVYKSGS GRSLDIT+F+SYHELR ELG+++G+EG LEDP 
Sbjct  754  LLQAPGNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLEDPL  813

Query  484  RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM  305
            RSGWQLVFVDRENDILL+GDDPW+ FVNNVW IKIL  ++VQ +GK  A+ L+    +R+
Sbjct  814  RSGWQLVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSADFLNTAHSKRL  873

Query  304  NTSGA-------DGRDFLSGLPSLGSLEY  239
             ++         D R   +   S+G+LEY
Sbjct  874  PSNSCDEYITRQDSRSLSTVTASVGTLEY  902



>ref|XP_008371797.1| PREDICTED: auxin response factor 6-like [Malus domestica]
Length=895

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  637  DPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFV  458
            DPL     FVKVYKSGS GRSLDIT+F+SY ELR EL  M+G+EG L+DP RSGWQLVFV
Sbjct  758  DPLN--RNFVKVYKSGSFGRSLDITKFSSYQELRNELAHMFGLEGELDDPVRSGWQLVFV  815

Query  457  DRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA----  290
            DREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L     +R++ +      
Sbjct  816  DRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLKSVPNQRLSNNSCDDYG  875

Query  289  ---DGRDFLSGLPSLGSLEY  239
               D R+  SG+ S+GSLEY
Sbjct  876  SRQDSRNLSSGITSVGSLEY  895



>ref|XP_009402572.1| PREDICTED: auxin response factor 6-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=900

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = -1

Query  661  LMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQ  485
            L+ + G +D L  +S  FVKVYKSGS GRSLDIT+F+SYHELR ELG+++G+EG LEDP 
Sbjct  752  LLQAPGNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLEDPL  811

Query  484  RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM  305
            RSGWQLVFVDRENDILL+GDDPW+ FVNNVW IKIL  ++VQ +GK  A+ L+    +R+
Sbjct  812  RSGWQLVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSADFLNTAHSKRL  871

Query  304  NTSGA-------DGRDFLSGLPSLGSLEY  239
             ++         D R   +   S+G+LEY
Sbjct  872  PSNSCDEYITRQDSRSLSTVTASVGTLEY  900



>gb|KJB69886.1| hypothetical protein B456_011G048200 [Gossypium raimondii]
Length=907

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            T  FVKVYKSGS GRSLDI+ F++Y+ELR EL  M+G+EG LEDP RSGWQLVFVDREND
Sbjct  773  TRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEGQLEDPLRSGWQLVFVDREND  832

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN-------TSGADG  284
            +LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L+   V+R++        S  D 
Sbjct  833  VLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLNSVPVQRLSNGSCDDYVSRQDS  892

Query  283  RDFLSGLPSLGSLEY  239
            R+  SG+ S+GSL+Y
Sbjct  893  RNLSSGIASVGSLDY  907



>ref|XP_009360948.1| PREDICTED: auxin response factor 6 [Pyrus x bretschneideri]
Length=893

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  637  DPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFV  458
            DPL     FVKV+KSGS GRSLDIT+FNSY ELR EL +M+G+EG L+DP RSGWQLVFV
Sbjct  756  DPLK--RNFVKVHKSGSFGRSLDITKFNSYQELRNELARMFGLEGELDDPVRSGWQLVFV  813

Query  457  DRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA----  290
            DREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L     +R+  +      
Sbjct  814  DRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLKSVPNQRLPNNSCDDYG  873

Query  289  ---DGRDFLSGLPSLGSLEY  239
               D R+  SG+ S+GSLEY
Sbjct  874  SRQDSRNLSSGITSVGSLEY  893



>ref|XP_009377485.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=893

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 9/140 (6%)
 Frame = -1

Query  637  DPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFV  458
            DPL     FVKV+KSGS GRSLDIT+FNSY ELR EL +M+G+EG L+DP RSGWQLVFV
Sbjct  756  DPLK--RNFVKVHKSGSFGRSLDITKFNSYQELRNELARMFGLEGELDDPVRSGWQLVFV  813

Query  457  DRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA----  290
            DREND+LLLGDDPW  FVN+VW IKILSP++VQ +GK+  E L     +R+  +      
Sbjct  814  DRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGKRGLELLKSVPNQRLPNNSCDDYG  873

Query  289  ---DGRDFLSGLPSLGSLEY  239
               D R+  SG+ S+GSLEY
Sbjct  874  SRQDSRNLSSGITSVGSLEY  893



>ref|XP_002438851.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
 gb|EER90218.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
Length=919

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 112/163 (69%), Gaps = 14/163 (9%)
 Frame = -1

Query  685  DYMQDSSELMHSAGPVDPLT--------PTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            D+  +S   +  +G V P +        P + FVKVYKSG+ GRSLDITRF+SYHELR+E
Sbjct  757  DHTLNSPGCLDDSGYVPPCSDNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRE  816

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+++G+EG LEDP RSGWQLVFVDRE D+LL+GDDPW+ FV+ V  IKILSP++VQ +G
Sbjct  817  LGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMG  876

Query  349  KQEAESLSRNVVERMNTSGAD------GRDFLSGLPSLGSLEY  239
            KQ  E LS     R+ +S  D       R   +G+ S+GS+E+
Sbjct  877  KQGLELLSSGPARRLGSSCDDYVSRQESRSLSTGIASVGSVEF  919



>ref|XP_010908738.1| PREDICTED: auxin response factor 17-like isoform X2 [Elaeis guineensis]
Length=884

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  +HS   VD +   S  FVKVYKSGS GR LDI RF+SYHELR ELG+++G+EG L
Sbjct  732  DKSGFLHSVENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRL  791

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP RSGWQLVFVDREND LL+GDDPW+ FVNNV  IKILSP++VQ +GKQ    L+   
Sbjct  792  EDPVRSGWQLVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGKQGVGLLNSAP  851

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
            ++R+ ++  DG        +  +G+ S+GSL Y
Sbjct  852  IKRLPSNSCDGYGSRQDSSNLSTGITSVGSLNY  884



>gb|ADG43156.1| auxin response factor 22 [Zea mays]
Length=925

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 111/164 (68%), Gaps = 15/164 (9%)
 Frame = -1

Query  685  DYMQDSSELMHSAGPVDPLT--------PTSAFVKVYKSGSVGRSLDITRFNSYHELRQE  530
            D+  +SS  +  +G V P +        P + FVKVYKSG+ GRSLDITRF+SYHELR+E
Sbjct  762  DHTLNSSGCLDDSGYVPPCSDNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRE  821

Query  529  LGQMYGIEGLLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLG  350
            LG+++G+EG LEDP RSGWQLVFVDRE D+LL+GDDPW+ F + V  IKILSP++VQ +G
Sbjct  822  LGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFASTVSCIKILSPQEVQQMG  881

Query  349  KQEAESLSRNVVERMNTSGADG-------RDFLSGLPSLGSLEY  239
            KQ  E LS     R   S  DG       R   +G+ S+GS+E+
Sbjct  882  KQGLELLSSAPAARRLGSSCDGYVSRQESRSLSTGIASVGSVEF  925



>ref|XP_010908734.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908736.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908737.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=911

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 108/153 (71%), Gaps = 8/153 (5%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTPTS-AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  +HS   VD +   S  FVKVYKSGS GR LDI RF+SYHELR ELG+++G+EG L
Sbjct  759  DKSGFLHSVENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRL  818

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNV  317
            EDP RSGWQLVFVDREND LL+GDDPW+ FVNNV  IKILSP++VQ +GKQ    L+   
Sbjct  819  EDPVRSGWQLVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGKQGVGLLNSAP  878

Query  316  VERMNTSGADG-------RDFLSGLPSLGSLEY  239
            ++R+ ++  DG        +  +G+ S+GSL Y
Sbjct  879  IKRLPSNSCDGYGSRQDSSNLSTGITSVGSLNY  911



>ref|XP_006594518.1| PREDICTED: auxin response factor 6-like isoform X3 [Glycine max]
Length=815

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 9/149 (6%)
 Frame = -1

Query  664  ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQ  485
            + +  AG  +PL  T  FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP 
Sbjct  669  QCLEEAGQGNPLNKT--FVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPV  726

Query  484  RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM  305
            RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSP++VQ +G    E L+   ++R+
Sbjct  727  RSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGNNGLELLNSFPIQRL  786

Query  304  N-------TSGADGRDFLSGLPSLGSLEY  239
            +        S  D R+  +G+ ++GSL+Y
Sbjct  787  SNGICDDYVSRQDPRNLGTGITTVGSLDY  815



>ref|XP_007159383.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
 gb|ESW31377.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
Length=908

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 106/145 (73%), Gaps = 9/145 (6%)
 Frame = -1

Query  652  SAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGW  473
            +AG  +PL  T  FVKVYKSGS GRSLDIT+F+SYHELR EL QM+G+EG LEDP RSGW
Sbjct  766  NAGQGNPLNKT--FVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGELEDPVRSGW  823

Query  472  QLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMN---  302
            QLVFVDREND+LLLGD PW  FVN+VW IKILSP++VQ +G    E L+   ++R++   
Sbjct  824  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGNPGLELLNSVPIQRLSNGI  883

Query  301  ----TSGADGRDFLSGLPSLGSLEY  239
                 S  D R+   G+ ++GSL+Y
Sbjct  884  CDDYVSRQDPRNISPGITAVGSLDY  908



>gb|EYU19157.1| hypothetical protein MIMGU_mgv1a001449mg [Erythranthe guttata]
Length=818

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 9/134 (7%)
 Frame = -1

Query  616  AFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDRENDIL  437
             FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LE P RSGWQLVFVDREND+L
Sbjct  686  TFVKVYKSGSFGRSLDITKFSSYHELRSELSKMFGLEGQLEGPLRSGWQLVFVDRENDVL  745

Query  436  LLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERMNTSGA--------DGR  281
            LLGDDPW+ FVN+VW IKILSP+++Q +GK+  E L+ +V  R  ++G+        + R
Sbjct  746  LLGDDPWQEFVNSVWCIKILSPQEIQDMGKRGLELLN-SVHNRQRSNGSCDSYGGQQESR  804

Query  280  DFLSGLPSLGSLEY  239
            +  +G+PS+G+L +
Sbjct  805  NISAGIPSVGTLHF  818



>gb|ACB30835.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30836.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30837.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30838.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30839.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30840.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30841.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30842.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30843.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30844.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30845.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30846.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30847.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30848.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30849.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30850.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30852.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30853.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30854.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30855.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30856.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30857.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30858.1| ARF6, partial [Arabidopsis thaliana]
Length=113

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 4/110 (4%)
 Frame = -1

Query  622  TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQRSGWQLVFVDREND  443
            ++ FVKVYKSGS GRSLDI++F+SYHELR EL +M+G+EG LEDP RSGWQLVFVDREND
Sbjct  3    SNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDREND  62

Query  442  ILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESL----SRNVVERM  305
            +LLLGDDPW  FV++VW IKILSP++VQ +GK+  E L    S N V+++
Sbjct  63   VLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKL  112



>ref|XP_010054260.1| PREDICTED: auxin response factor 6-like [Eucalyptus grandis]
Length=870

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = -1

Query  673  DSSELMHSAGPVDPLTP-TSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLL  497
            D S  + S+  VD + P T  FVKV+KSG+ GRSLDI++F+SY ELR EL +M+G+EG L
Sbjct  747  DESGFLQSSENVDQVNPPTRTFVKVHKSGTFGRSLDISKFSSYDELRSELARMFGLEGQL  806

Query  496  EDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQ---EAESLS  326
            EDPQRSGWQLVFVDRENDILLLGDDPW+ FVNNVWYIKILSP +V+ LGKQ    A S+ 
Sbjct  807  EDPQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVKQLGKQGINPANSVP  866

Query  325  RNVV  314
            R  +
Sbjct  867  RQAL  870



>ref|XP_006594517.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=896

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 9/149 (6%)
 Frame = -1

Query  664  ELMHSAGPVDPLTPTSAFVKVYKSGSVGRSLDITRFNSYHELRQELGQMYGIEGLLEDPQ  485
            + +  AG  +PL  T  FVKVYKSGS GRSLDIT+F+SYHELR EL +M+G+EG LEDP 
Sbjct  750  QCLEEAGQGNPLNKT--FVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPV  807

Query  484  RSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQTLGKQEAESLSRNVVERM  305
            RSGWQLVFVDREND+LLLGD PW  FVN+VW IKILSP++VQ +G    E L+   ++R+
Sbjct  808  RSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGNNGLELLNSFPIQRL  867

Query  304  N-------TSGADGRDFLSGLPSLGSLEY  239
            +        S  D R+  +G+ ++GSL+Y
Sbjct  868  SNGICDDYVSRQDPRNLGTGITTVGSLDY  896



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520