BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039P04

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF64227.1|AF248647_1  glucose acyltransferase                       230   8e-69   Solanum pennellii
ref|XP_006353976.1|  PREDICTED: serine carboxypeptidase-like 18-like    229   2e-68   Solanum tuberosum [potatoes]
ref|XP_009795831.1|  PREDICTED: serine carboxypeptidase-like 18 i...    227   3e-68   Nicotiana sylvestris
ref|XP_009614133.1|  PREDICTED: serine carboxypeptidase-like 18 i...    228   4e-68   Nicotiana tomentosiformis
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    228   9e-68   Nicotiana tomentosiformis
gb|AAD01263.1|  glucose acyltransferase                                 228   9e-68   Solanum berthaultii
ref|XP_009795830.1|  PREDICTED: serine carboxypeptidase-like 18 i...    227   1e-67   Nicotiana sylvestris
gb|AAD01265.1|  glucose acyltransferase                                 226   2e-67   Solanum berthaultii
gb|AAD01264.1|  glucose acyltransferase                                 226   3e-67   Solanum berthaultii
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    226   3e-67   Solanum tuberosum [potatoes]
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         226   4e-67   Solanum lycopersicum
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    225   7e-67   Solanum tuberosum [potatoes]
ref|XP_006353974.1|  PREDICTED: serine carboxypeptidase-like 18-like    220   9e-65   Solanum tuberosum [potatoes]
ref|XP_004248778.1|  PREDICTED: serine carboxypeptidase-like 18         219   2e-64   Solanum lycopersicum
ref|XP_011070164.1|  PREDICTED: putative serine carboxypeptidase-...    210   3e-63   
ref|XP_011069858.1|  PREDICTED: serine carboxypeptidase-like 18         213   6e-62   Sesamum indicum [beniseed]
ref|XP_011069855.1|  PREDICTED: serine carboxypeptidase-like 18 i...    212   1e-61   Sesamum indicum [beniseed]
ref|XP_008228681.1|  PREDICTED: serine carboxypeptidase-like 18         201   5e-61   
ref|XP_002522135.1|  serine carboxypeptidase, putative                  207   6e-60   
ref|XP_011070163.1|  PREDICTED: serine carboxypeptidase-like 18         204   2e-58   Sesamum indicum [beniseed]
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    203   2e-58   Prunus mume [ume]
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             203   2e-58   
gb|KCW55080.1|  hypothetical protein EUGRSUZ_I010431                    196   5e-58   Eucalyptus grandis [rose gum]
ref|XP_011069856.1|  PREDICTED: serine carboxypeptidase-like 18 i...    201   1e-57   Sesamum indicum [beniseed]
ref|XP_006422773.1|  hypothetical protein CICLE_v10028648mg             197   8e-57   
ref|XP_010030620.1|  PREDICTED: serine carboxypeptidase-like 1          197   2e-55   
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         195   3e-55   Vitis vinifera
ref|XP_006486897.1|  PREDICTED: serine carboxypeptidase-like 17-like    194   1e-54   Citrus sinensis [apfelsine]
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    193   1e-54   Sesamum indicum [beniseed]
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             192   2e-54   
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             192   2e-54   Citrus clementina [clementine]
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    193   2e-54   Citrus sinensis [apfelsine]
ref|XP_008236457.1|  PREDICTED: putative serine carboxypeptidase-...    183   2e-54   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         192   3e-54   Prunus mume [ume]
ref|XP_006422778.1|  hypothetical protein CICLE_v10028360mg             187   3e-54   
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    192   4e-54   Prunus mume [ume]
gb|KDO49556.1|  hypothetical protein CISIN_1g023030mg                   187   5e-54   Citrus sinensis [apfelsine]
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             191   7e-54   Citrus clementina [clementine]
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    191   8e-54   
gb|KCW55076.1|  hypothetical protein EUGRSUZ_I01041                     188   1e-53   Eucalyptus grandis [rose gum]
ref|XP_006422775.1|  hypothetical protein CICLE_v10028360mg             187   2e-53   
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             190   2e-53   
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    190   2e-53   Populus euphratica
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    190   3e-53   Populus euphratica
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             190   3e-53   
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          190   3e-53   
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    189   6e-53   Citrus sinensis [apfelsine]
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    189   6e-53   Prunus mume [ume]
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    189   7e-53   Prunus mume [ume]
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         189   7e-53   Eucalyptus grandis [rose gum]
ref|XP_008236281.1|  PREDICTED: serine carboxypeptidase-like 17 i...    189   7e-53   Prunus mume [ume]
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         188   9e-53   Sesamum indicum [beniseed]
ref|XP_011457834.1|  PREDICTED: serine carboxypeptidase-like 18         188   9e-53   Fragaria vesca subsp. vesca
gb|KDP44525.1|  hypothetical protein JCGZ_16358                         181   1e-52   Jatropha curcas
ref|XP_008236288.1|  PREDICTED: serine carboxypeptidase-like 18 i...    189   1e-52   
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         188   1e-52   Prunus mume [ume]
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             187   2e-52   
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         187   2e-52   Fragaria vesca subsp. vesca
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             187   2e-52   Citrus clementina [clementine]
ref|XP_008236285.1|  PREDICTED: serine carboxypeptidase-like 2 is...    187   3e-52   Prunus mume [ume]
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         186   4e-52   Vitis vinifera
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          187   5e-52   Sesamum indicum [beniseed]
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    185   5e-52   Sesamum indicum [beniseed]
ref|XP_009343182.1|  PREDICTED: serine carboxypeptidase-like 18 i...    185   6e-52   
emb|CBI22420.3|  unnamed protein product                                187   6e-52   Vitis vinifera
ref|XP_006369720.1|  hypothetical protein POPTR_0001s29840g             184   8e-52   
emb|CAN83341.1|  hypothetical protein VITISV_021484                     186   8e-52   Vitis vinifera
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    185   2e-51   
gb|KCW55069.1|  hypothetical protein EUGRSUZ_I010391                    181   2e-51   Eucalyptus grandis [rose gum]
ref|XP_002300280.2|  hypothetical protein POPTR_0001s29810g             184   2e-51   
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    185   2e-51   Populus euphratica
ref|XP_007201024.1|  hypothetical protein PRUPE_ppa006101mg             184   2e-51   
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         184   4e-51   Eucalyptus grandis [rose gum]
emb|CBI22421.3|  unnamed protein product                                186   4e-51   Vitis vinifera
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          184   5e-51   Pyrus x bretschneideri [bai li]
gb|KCW55068.1|  hypothetical protein EUGRSUZ_I010391                    181   6e-51   Eucalyptus grandis [rose gum]
ref|XP_006368060.1|  PREDICTED: serine carboxypeptidase 1-like          173   7e-51   Solanum tuberosum [potatoes]
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         184   7e-51   Vitis vinifera
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         183   8e-51   Brachypodium distachyon [annual false brome]
emb|CBI22424.3|  unnamed protein product                                184   9e-51   Vitis vinifera
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    183   9e-51   
ref|XP_007199857.1|  hypothetical protein PRUPE_ppa006297mg             182   1e-50   
ref|XP_008236347.1|  PREDICTED: serine carboxypeptidase-like 13         184   1e-50   
emb|CAN74923.1|  hypothetical protein VITISV_038590                     183   1e-50   Vitis vinifera
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         182   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         182   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         182   3e-50   Eucalyptus grandis [rose gum]
ref|XP_008238303.1|  PREDICTED: putative serine carboxypeptidase-...    175   3e-50   
ref|XP_007201023.1|  hypothetical protein PRUPE_ppa005420mg             181   4e-50   Prunus persica
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                181   6e-50   Erythranthe guttata [common monkey flower]
ref|XP_011457832.1|  PREDICTED: serine carboxypeptidase-like 17         180   1e-49   Fragaria vesca subsp. vesca
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                179   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_010046975.1|  PREDICTED: serine carboxypeptidase-like 17         180   3e-49   Eucalyptus grandis [rose gum]
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    178   3e-49   
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    178   5e-49   Eucalyptus grandis [rose gum]
ref|XP_010682455.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   6e-49   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAO04189.1|  hypothetical protein                                   173   9e-49   Delphinium grandiflorum
gb|KDP35358.1|  hypothetical protein JCGZ_10342                         178   1e-48   Jatropha curcas
ref|XP_011003871.1|  PREDICTED: serine carboxypeptidase-like 18 i...    177   1e-48   Populus euphratica
ref|XP_011045684.1|  PREDICTED: serine carboxypeptidase-like 18 i...    177   1e-48   Populus euphratica
ref|XP_010065814.1|  PREDICTED: serine carboxypeptidase-like 18         177   2e-48   Eucalyptus grandis [rose gum]
ref|XP_008236276.1|  PREDICTED: serine carboxypeptidase-like 18 i...    176   2e-48   Prunus mume [ume]
ref|XP_011045683.1|  PREDICTED: serine carboxypeptidase-like 18 i...    177   2e-48   Populus euphratica
ref|XP_011003870.1|  PREDICTED: serine carboxypeptidase-like 18 i...    177   2e-48   Populus euphratica
ref|XP_010656847.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   2e-48   
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   4e-48   
ref|XP_002300184.2|  hypothetical protein POPTR_0001s31980g             175   5e-48   
ref|XP_010040884.1|  PREDICTED: serine carboxypeptidase-like 18         175   6e-48   
gb|KDP40909.1|  hypothetical protein JCGZ_24908                         176   6e-48   Jatropha curcas
ref|XP_010682454.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369794.1|  hypothetical protein POPTR_0001s31980g             176   7e-48   Populus trichocarpa [western balsam poplar]
ref|XP_003633198.1|  PREDICTED: serine carboxypeptidase-like 13 i...    175   9e-48   Vitis vinifera
ref|XP_008236275.1|  PREDICTED: serine carboxypeptidase-like 17 i...    175   9e-48   Prunus mume [ume]
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    175   1e-47   Vitis vinifera
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          174   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          175   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010656846.1|  PREDICTED: serine carboxypeptidase-like 13 i...    175   1e-47   Vitis vinifera
emb|CDP08179.1|  unnamed protein product                                175   2e-47   Coffea canephora [robusta coffee]
emb|CDP08199.1|  unnamed protein product                                175   2e-47   Coffea canephora [robusta coffee]
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    174   2e-47   Delphinium grandiflorum
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    173   4e-47   
ref|XP_008349845.1|  PREDICTED: serine carboxypeptidase-like 18         172   4e-47   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    173   4e-47   Elaeis guineensis
gb|KCW63605.1|  hypothetical protein EUGRSUZ_G01232                     172   5e-47   Eucalyptus grandis [rose gum]
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    173   6e-47   Eucalyptus grandis [rose gum]
emb|CBI17848.3|  unnamed protein product                                174   6e-47   Vitis vinifera
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    173   6e-47   
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          172   6e-47   
ref|XP_010094886.1|  Serine carboxypeptidase-like 18                    172   7e-47   
ref|XP_010065819.1|  PREDICTED: serine carboxypeptidase-like 18         173   7e-47   Eucalyptus grandis [rose gum]
ref|XP_002522137.1|  serine carboxypeptidase, putative                  173   7e-47   
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          172   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    172   9e-47   Eucalyptus grandis [rose gum]
ref|XP_010936156.1|  PREDICTED: serine carboxypeptidase-like 18         171   1e-46   
ref|XP_002266615.3|  PREDICTED: serine carboxypeptidase-like 17         172   1e-46   Vitis vinifera
emb|CAN78674.1|  hypothetical protein VITISV_009248                     172   1e-46   Vitis vinifera
gb|KDP44533.1|  hypothetical protein JCGZ_16366                         172   1e-46   Jatropha curcas
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          172   1e-46   Eucalyptus grandis [rose gum]
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     172   1e-46   Eucalyptus grandis [rose gum]
ref|XP_010694004.1|  PREDICTED: serine carboxypeptidase-like 7 is...    171   1e-46   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAO04182.1|  hypothetical protein                                   172   1e-46   Delphinium grandiflorum
ref|XP_010936146.1|  PREDICTED: serine carboxypeptidase-like 18 i...    170   2e-46   
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         172   2e-46   Jatropha curcas
ref|XP_002266867.3|  PREDICTED: serine carboxypeptidase-like 17         171   2e-46   Vitis vinifera
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         172   2e-46   Vitis vinifera
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    176   2e-46   
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         172   2e-46   
ref|XP_010065898.1|  PREDICTED: serine carboxypeptidase-like 18         171   3e-46   
ref|XP_010694000.1|  PREDICTED: serine carboxypeptidase-like 7          171   3e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010028337.1|  PREDICTED: serine carboxypeptidase-like 18         171   3e-46   Eucalyptus grandis [rose gum]
emb|CBI17847.3|  unnamed protein product                                172   4e-46   Vitis vinifera
gb|KDP44532.1|  hypothetical protein JCGZ_16365                         170   6e-46   Jatropha curcas
ref|XP_010065817.1|  PREDICTED: serine carboxypeptidase-like 18         170   6e-46   Eucalyptus grandis [rose gum]
gb|KCW44823.1|  hypothetical protein EUGRSUZ_L016101                    160   7e-46   Eucalyptus grandis [rose gum]
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    174   7e-46   
ref|XP_010237149.1|  PREDICTED: serine carboxypeptidase-like 18         166   7e-46   
ref|XP_010936145.1|  PREDICTED: serine carboxypeptidase-like 18 i...    168   8e-46   
ref|XP_010694001.1|  PREDICTED: serine carboxypeptidase-like 10 i...    169   1e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     169   1e-45   Eucalyptus grandis [rose gum]
emb|CAN82419.1|  hypothetical protein VITISV_044004                     167   2e-45   Vitis vinifera
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    169   2e-45   Setaria italica
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         169   2e-45   
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         169   2e-45   Elaeis guineensis
gb|KJB73511.1|  hypothetical protein B456_011G236800                    169   2e-45   Gossypium raimondii
gb|KJB73512.1|  hypothetical protein B456_011G236800                    169   2e-45   Gossypium raimondii
gb|EMS46782.1|  Serine carboxypeptidase-like 18                         166   2e-45   Triticum urartu
ref|XP_010939017.1|  PREDICTED: serine carboxypeptidase-like 12 i...    169   3e-45   
ref|XP_010936148.1|  PREDICTED: serine carboxypeptidase-like 18 i...    166   3e-45   
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18         168   4e-45   Fragaria vesca subsp. vesca
gb|KJB73510.1|  hypothetical protein B456_011G236800                    168   4e-45   Gossypium raimondii
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    169   4e-45   Elaeis guineensis
ref|XP_004289772.1|  PREDICTED: serine carboxypeptidase-like 18         168   4e-45   Fragaria vesca subsp. vesca
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         167   7e-45   Jatropha curcas
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         167   8e-45   Jatropha curcas
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          167   1e-44   Vitis vinifera
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             166   1e-44   
ref|XP_008778119.1|  PREDICTED: serine carboxypeptidase-like 18         162   1e-44   
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          167   1e-44   
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         167   1e-44   
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    167   1e-44   
ref|XP_002522133.1|  serine carboxypeptidase, putative                  167   1e-44   Ricinus communis
emb|CBI19380.3|  unnamed protein product                                167   1e-44   Vitis vinifera
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             166   2e-44   Citrus clementina [clementine]
ref|XP_002510076.1|  serine carboxypeptidase, putative                  166   2e-44   
gb|EMT02053.1|  Serine carboxypeptidase-like 18                         166   3e-44   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    166   3e-44   
emb|CAN82418.1|  hypothetical protein VITISV_044003                     165   4e-44   Vitis vinifera
ref|XP_010694009.1|  PREDICTED: serine carboxypeptidase-like 7          165   4e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         166   4e-44   Brachypodium distachyon [annual false brome]
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                166   4e-44   Zea mays [maize]
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   165   5e-44   Citrus sinensis [apfelsine]
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         166   6e-44   
ref|XP_006662125.1|  PREDICTED: serine carboxypeptidase-like 18-like    166   6e-44   
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         164   8e-44   Gossypium arboreum [tree cotton]
ref|XP_010065863.1|  PREDICTED: serine carboxypeptidase-like 18         164   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          164   1e-43   Eucalyptus grandis [rose gum]
gb|KJB58677.1|  hypothetical protein B456_009G221000                    163   2e-43   Gossypium raimondii
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    163   2e-43   
dbj|BAF56655.1|  serine carboxypeptitase-like protein 1                 163   2e-43   Diospyros kaki [Japanese persimmon]
gb|AAL73563.1|AC079632_7  Putative serine carboxypeptidase              163   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KHG16860.1|  Serine carboxypeptidase-like 19                         160   2e-43   Gossypium arboreum [tree cotton]
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    163   2e-43   Nelumbo nucifera [Indian lotus]
gb|EEE60599.1|  hypothetical protein OsJ_13996                          157   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064014.1|  Os10g0101100                                       163   2e-43   
gb|AIW39897.1|  serine carboxypeptidase-like protein                    163   2e-43   Camellia sinensis [black tea]
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         163   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    163   3e-43   
ref|XP_002272116.1|  PREDICTED: serine carboxypeptidase-like 16         163   3e-43   Vitis vinifera
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          162   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN67390.1|  hypothetical protein VITISV_034715                     162   5e-43   Vitis vinifera
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     161   5e-43   Eucalyptus grandis [rose gum]
ref|XP_010048652.1|  PREDICTED: serine carboxypeptidase-like 18         162   6e-43   Eucalyptus grandis [rose gum]
ref|XP_002510077.1|  serine carboxypeptidase, putative                  162   7e-43   Ricinus communis
ref|XP_004289770.1|  PREDICTED: serine carboxypeptidase-like 18         162   8e-43   Fragaria vesca subsp. vesca
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         162   9e-43   Eucalyptus grandis [rose gum]
emb|CBI22419.3|  unnamed protein product                                161   1e-42   Vitis vinifera
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          162   1e-42   Vitis vinifera
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    161   2e-42   Nicotiana tomentosiformis
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             161   2e-42   Citrus clementina [clementine]
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    160   2e-42   Gentiana triflora
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   160   3e-42   Citrus sinensis [apfelsine]
gb|KCW63602.1|  hypothetical protein EUGRSUZ_G01229                     159   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    160   3e-42   Citrus sinensis [apfelsine]
ref|XP_002268517.1|  PREDICTED: serine carboxypeptidase-like 17         160   4e-42   Vitis vinifera
ref|XP_004299780.2|  PREDICTED: serine carboxypeptidase-like 13         160   5e-42   Fragaria vesca subsp. vesca
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          160   6e-42   
ref|XP_002446557.1|  hypothetical protein SORBIDRAFT_06g018070          159   8e-42   Sorghum bicolor [broomcorn]
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    159   8e-42   Zea mays [maize]
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         158   1e-41   Nicotiana sylvestris
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    158   1e-41   
ref|NP_001067860.1|  Os11g0460800                                       159   1e-41   
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         159   2e-41   Eucalyptus grandis [rose gum]
gb|KDP44534.1|  hypothetical protein JCGZ_16367                         158   2e-41   Jatropha curcas
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           158   2e-41   
gb|ACN30985.1|  unknown                                                 158   2e-41   Zea mays [maize]
ref|XP_010694007.1|  PREDICTED: serine carboxypeptidase-like 7 is...    157   2e-41   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    158   3e-41   Gentiana triflora
ref|XP_010691546.1|  PREDICTED: serine carboxypeptidase-like 18         158   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003602921.1|  Serine carboxypeptidase-like protein               153   3e-41   
ref|XP_010694006.1|  PREDICTED: serine carboxypeptidase-like 7 is...    157   3e-41   
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          158   3e-41   Zea mays [maize]
ref|XP_008236284.1|  PREDICTED: putative serine carboxypeptidase-...    150   4e-41   
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    157   4e-41   Gentiana triflora
ref|XP_004289771.1|  PREDICTED: serine carboxypeptidase-like 17         157   4e-41   Fragaria vesca subsp. vesca
ref|XP_010235061.1|  PREDICTED: serine carboxypeptidase-like 10         157   4e-41   Brachypodium distachyon [annual false brome]
ref|NP_001052165.1|  Os04g0176400                                       157   4e-41   
ref|XP_010694003.1|  PREDICTED: serine carboxypeptidase-like 7 is...    157   4e-41   
ref|XP_011457835.1|  PREDICTED: serine carboxypeptidase-like 7          157   4e-41   Fragaria vesca subsp. vesca
gb|EAY93240.1|  hypothetical protein OsI_15047                          157   4e-41   Oryza sativa Indica Group [Indian rice]
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   156   5e-41   Citrus sinensis [apfelsine]
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    156   5e-41   Nicotiana sylvestris
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    157   6e-41   Nicotiana sylvestris
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    156   7e-41   Nicotiana tomentosiformis
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         156   8e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    156   8e-41   Nicotiana sylvestris
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    159   8e-41   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    156   9e-41   Citrus sinensis [apfelsine]
dbj|BAH89272.1|  putative serine carboxypeptidase-like acyltransf...    156   1e-40   Diospyros kaki [Japanese persimmon]
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   156   1e-40   Citrus sinensis [apfelsine]
gb|EEC68118.1|  hypothetical protein OsI_36022                          156   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         156   1e-40   
tpg|DAA60427.1|  TPA: hypothetical protein ZEAMMB73_620256              152   1e-40   
emb|CDP21038.1|  unnamed protein product                                156   1e-40   Coffea canephora [robusta coffee]
dbj|BAJ85413.1|  predicted protein                                      155   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          156   2e-40   
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         155   2e-40   
ref|XP_006581277.1|  PREDICTED: serine carboxypeptidase-like 19-l...    155   2e-40   
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         155   2e-40   Glycine soja [wild soybean]
gb|AES63483.2|  serine carboxypeptidase-like protein                    155   2e-40   Medicago truncatula
dbj|BAJ87293.1|  predicted protein                                      147   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975754.1|  PREDICTED: serine carboxypeptidase-like 7-like     155   2e-40   Setaria italica
ref|XP_003593232.1|  Serine carboxypeptidase-like protein               155   2e-40   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    159   2e-40   
ref|XP_004956082.1|  PREDICTED: serine carboxypeptidase-like 19-like    155   2e-40   Setaria italica
ref|XP_010689038.1|  PREDICTED: uncharacterized mitochondrial pro...    153   2e-40   
gb|ACG36102.1|  serine carboxypeptidase 1 precursor                     154   3e-40   Zea mays [maize]
gb|EAZ18289.1|  hypothetical protein OsJ_33827                          154   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008661499.1|  PREDICTED: uncharacterized protein LOC100216...    154   3e-40   
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    155   3e-40   
gb|KJB48748.1|  hypothetical protein B456_008G084200                    155   3e-40   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    159   3e-40   
ref|XP_010686325.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   3e-40   
dbj|BAK02394.1|  predicted protein                                      154   3e-40   
ref|XP_008661498.1|  PREDICTED: uncharacterized protein LOC100216...    155   3e-40   
gb|KCW63486.1|  hypothetical protein EUGRSUZ_G01118                     154   4e-40   
dbj|BAJ99095.1|  predicted protein                                      154   4e-40   
ref|NP_001149348.1|  serine carboxypeptidase 1 precursor                155   4e-40   
ref|XP_010068327.1|  PREDICTED: serine carboxypeptidase-like 18         155   4e-40   
ref|XP_003604935.1|  Serine carboxypeptidase                            149   4e-40   
ref|XP_004299782.1|  PREDICTED: serine carboxypeptidase-like 13         154   4e-40   
ref|NP_001137115.1|  serine carboxypeptidase 1 precursor                155   4e-40   
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         154   4e-40   
emb|CBI24085.3|  unnamed protein product                                154   5e-40   
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         154   5e-40   
gb|EMS68839.1|  Serine carboxypeptidase-like 9                          150   5e-40   
ref|XP_003572138.1|  PREDICTED: serine carboxypeptidase-like 10         154   5e-40   
ref|XP_002265154.3|  PREDICTED: serine carboxypeptidase-like 13         154   5e-40   
ref|XP_010686322.1|  PREDICTED: serine carboxypeptidase-like 7 is...    154   6e-40   
ref|XP_004513964.1|  PREDICTED: serine carboxypeptidase-like 18-l...    154   7e-40   
ref|XP_002522136.1|  serine carboxypeptidase, putative                  153   7e-40   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             154   8e-40   
ref|XP_006663395.1|  PREDICTED: serine carboxypeptidase-like 18-like    154   8e-40   
ref|XP_010231763.1|  PREDICTED: serine carboxypeptidase-like 13 i...    154   8e-40   
ref|XP_010108030.1|  Serine carboxypeptidase-like 3                     149   9e-40   
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         154   9e-40   
ref|XP_011073862.1|  PREDICTED: putative serine carboxypeptidase-...    146   1e-39   
gb|EMS55667.1|  Serine carboxypeptidase-like 10                         145   1e-39   
ref|XP_010231762.1|  PREDICTED: serine carboxypeptidase-like 19 i...    153   1e-39   
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    154   1e-39   
tpg|DAA37592.1|  TPA: hypothetical protein ZEAMMB73_449749              153   1e-39   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             154   1e-39   
gb|AFW69058.1|  hypothetical protein ZEAMMB73_415108                    152   1e-39   
ref|XP_010692123.1|  PREDICTED: serine carboxypeptidase-like 13         153   1e-39   
ref|XP_003577668.1|  PREDICTED: serine carboxypeptidase-like 19         153   1e-39   
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             153   1e-39   
ref|XP_003604928.1|  Serine carboxypeptidase                            153   1e-39   
ref|XP_008352130.1|  PREDICTED: serine carboxypeptidase-like 18         149   2e-39   
gb|ACN25790.1|  unknown                                                 152   2e-39   
gb|ABA95037.1|  Serine carboxypeptidase family protein                  152   2e-39   
gb|KCW63483.1|  hypothetical protein EUGRSUZ_G01115                     152   2e-39   
ref|XP_007018463.1|  Serine carboxypeptidase-like 7, putative           151   2e-39   
ref|XP_010065815.1|  PREDICTED: serine carboxypeptidase-like 18 i...    151   2e-39   
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          153   2e-39   
gb|EMT09764.1|  hypothetical protein F775_42793                         148   2e-39   
ref|XP_003577669.1|  PREDICTED: serine carboxypeptidase-like 19 i...    152   2e-39   
ref|XP_010065816.1|  PREDICTED: serine carboxypeptidase-like 18 i...    152   4e-39   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         155   4e-39   
ref|XP_010065818.1|  PREDICTED: serine carboxypeptidase-like 18         152   4e-39   
ref|XP_002459781.1|  hypothetical protein SORBIDRAFT_02g010510          152   4e-39   
gb|ACF84666.1|  unknown                                                 152   4e-39   
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    152   4e-39   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   4e-39   
gb|EMT03311.1|  Serine carboxypeptidase-like 19                         151   4e-39   
ref|NP_001149249.1|  serine carboxypeptidase 1 precursor                152   4e-39   
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    152   5e-39   
tpg|DAA39924.1|  TPA: hypothetical protein ZEAMMB73_827985              143   5e-39   
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   5e-39   
ref|XP_003604931.1|  Serine carboxypeptidase                            151   5e-39   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    151   6e-39   
ref|XP_006662864.1|  PREDICTED: serine carboxypeptidase-like 18-like    151   6e-39   
ref|XP_010238599.1|  PREDICTED: serine carboxypeptidase-like 3          151   7e-39   
gb|EEC68084.1|  hypothetical protein OsI_35952                          151   7e-39   
ref|XP_003573759.1|  PREDICTED: serine carboxypeptidase-like 18         151   7e-39   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               151   7e-39   
gb|KJB48749.1|  hypothetical protein B456_008G084200                    150   8e-39   
ref|XP_006651780.1|  PREDICTED: serine carboxypeptidase-like 18-like    150   9e-39   
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         150   1e-38   
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    150   1e-38   
ref|XP_010320344.1|  PREDICTED: serine carboxypeptidase-like 10 i...    149   1e-38   
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       150   1e-38   
gb|AAK95312.1|AF410326_1  T20K9.19/T20K9.19                             146   1e-38   
ref|XP_006662865.1|  PREDICTED: serine carboxypeptidase-like 19-like    150   1e-38   
ref|XP_004299781.1|  PREDICTED: serine carboxypeptidase-like 13         150   1e-38   
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          150   1e-38   
ref|XP_010320343.1|  PREDICTED: serine carboxypeptidase-like 10 i...    149   1e-38   
ref|XP_003573745.1|  PREDICTED: serine carboxypeptidase-like 17 i...    150   2e-38   
gb|KEH29043.1|  1-O-acylglucose:anthocyanin acyltransferase             149   2e-38   
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    150   2e-38   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    150   2e-38   
ref|XP_006663397.1|  PREDICTED: serine carboxypeptidase-like 18-like    150   2e-38   
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    149   2e-38   
emb|CDY01415.1|  BnaA07g11880D                                          142   3e-38   
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             149   4e-38   
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         149   4e-38   
emb|CDM81579.1|  unnamed protein product                                152   5e-38   
gb|KCW55073.1|  hypothetical protein EUGRSUZ_I01040                     149   6e-38   
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         149   6e-38   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    148   6e-38   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             148   6e-38   
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    152   6e-38   
ref|XP_004956083.1|  PREDICTED: serine carboxypeptidase-like 19-like    149   6e-38   
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         148   6e-38   
ref|XP_004289769.1|  PREDICTED: serine carboxypeptidase-like 18         148   8e-38   
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         148   1e-37   
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    147   1e-37   
ref|XP_002459780.1|  hypothetical protein SORBIDRAFT_02g010500          146   2e-37   
gb|AFK37593.1|  unknown                                                 142   2e-37   
gb|EPS73196.1|  hypothetical protein M569_01551                         147   2e-37   
gb|AFK49380.1|  unknown                                                 147   2e-37   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    147   2e-37   
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             147   2e-37   
ref|XP_002525293.1|  serine carboxypeptidase, putative                  147   3e-37   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    147   3e-37   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       146   3e-37   
gb|KEH36682.1|  1-O-acylglucose:anthocyanin acyltransferase             145   3e-37   
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    146   4e-37   
emb|CDP01267.1|  unnamed protein product                                146   4e-37   
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    145   4e-37   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    146   4e-37   
dbj|BAJ93955.1|  predicted protein                                      146   4e-37   
gb|KGN55284.1|  hypothetical protein Csa_4G644120                       146   4e-37   
gb|EMS47612.1|  Serine carboxypeptidase-like 19                         146   4e-37   
ref|XP_003569208.1|  PREDICTED: serine carboxypeptidase-like 18         146   4e-37   
ref|XP_003576949.1|  PREDICTED: serine carboxypeptidase-like 18 i...    146   5e-37   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    146   5e-37   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    146   5e-37   
ref|XP_010238598.1|  PREDICTED: serine carboxypeptidase-like 3 is...    146   5e-37   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         146   6e-37   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               146   6e-37   
ref|XP_010028338.1|  PREDICTED: serine carboxypeptidase-like 13         145   6e-37   
gb|KDP42099.1|  hypothetical protein JCGZ_01887                         145   6e-37   
dbj|BAF99699.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    145   6e-37   
ref|XP_010686324.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   7e-37   
ref|XP_007200900.1|  hypothetical protein PRUPE_ppb017681mg             145   7e-37   
dbj|BAJ97596.1|  predicted protein                                      145   8e-37   
ref|XP_010936147.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   8e-37   
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     145   8e-37   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    145   8e-37   
ref|XP_004141409.1|  PREDICTED: serine carboxypeptidase-like 1-like     145   8e-37   
gb|ABR16352.1|  unknown                                                 145   1e-36   
gb|EMS49742.1|  Serine carboxypeptidase-like 19                         142   1e-36   
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   1e-36   
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         144   1e-36   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    145   1e-36   
gb|EEE52034.1|  hypothetical protein OsJ_33758                          139   1e-36   
gb|AAM14928.1|  putative serine carboxypeptidase I                      139   2e-36   
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         144   2e-36   
dbj|BAB03129.1|  serine carboxypeptidase                                144   2e-36   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             144   2e-36   
ref|NP_565545.1|  putative serine carboxypeptidase-like 52              138   2e-36   
gb|ACF86146.1|  unknown                                                 141   2e-36   
ref|XP_002525854.1|  serine carboxypeptidase, putative                  143   2e-36   
emb|CDM84698.1|  unnamed protein product                                144   2e-36   
ref|XP_003604929.1|  Serine carboxypeptidase                            147   2e-36   
dbj|BAJ94430.1|  predicted protein                                      144   2e-36   
ref|NP_187828.1|  serine carboxypeptidase-like 17                       143   3e-36   
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             144   3e-36   
ref|XP_003604927.1|  Serine carboxypeptidase                            145   3e-36   
ref|XP_003604933.1|  Serine carboxypeptidase                            144   3e-36   
gb|EMS58156.1|  Serine carboxypeptidase-like 18                         144   3e-36   
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    144   3e-36   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               144   3e-36   
gb|EMT14291.1|  Serine carboxypeptidase-like 19                         140   3e-36   
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    144   3e-36   
ref|XP_010320338.1|  PREDICTED: serine carboxypeptidase-like 17 i...    143   4e-36   
ref|NP_001067796.1|  Os11g0432900                                       143   4e-36   
ref|XP_008452665.1|  PREDICTED: serine carboxypeptidase-like 7 is...    143   5e-36   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         143   5e-36   
ref|XP_008452666.1|  PREDICTED: serine carboxypeptidase-like 7 is...    143   5e-36   
ref|XP_006663407.1|  PREDICTED: serine carboxypeptidase-like 9-like     137   5e-36   
ref|XP_010320339.1|  PREDICTED: serine carboxypeptidase-like 10 i...    142   6e-36   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    143   6e-36   
gb|EMS55666.1|  Serine carboxypeptidase-like 19                         143   6e-36   
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    143   7e-36   
ref|XP_002878647.1|  hypothetical protein ARALYDRAFT_900755             137   7e-36   
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          143   7e-36   
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    142   9e-36   
gb|ACF84441.1|  unknown                                                 141   9e-36   
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    142   1e-35   
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         142   1e-35   
emb|CDP01266.1|  unnamed protein product                                142   1e-35   
ref|XP_009139973.1|  PREDICTED: serine carboxypeptidase-like 13 i...    141   1e-35   
gb|EEC68079.1|  hypothetical protein OsI_35943                          140   2e-35   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    141   2e-35   
ref|XP_004165534.1|  PREDICTED: serine carboxypeptidase-like 7-like     141   2e-35   
ref|XP_007146212.1|  hypothetical protein PHAVU_006G021700g             141   2e-35   
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         141   2e-35   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         143   2e-35   
ref|XP_006595237.1|  PREDICTED: serine carboxypeptidase-like 2-like     140   2e-35   
emb|CDY11114.1|  BnaC06g23660D                                          141   2e-35   
gb|KGN55283.1|  hypothetical protein Csa_4G643620                       141   2e-35   
ref|XP_004151544.1|  PREDICTED: serine carboxypeptidase-like 7-like     141   2e-35   
emb|CDP06916.1|  unnamed protein product                                136   3e-35   
dbj|BAJ96525.1|  predicted protein                                      141   3e-35   
ref|NP_001130406.1|  uncharacterized protein LOC100191502 precursor     141   3e-35   
gb|ACF79685.1|  unknown                                                 141   3e-35   
ref|XP_002522112.1|  serine carboxypeptidase, putative                  140   4e-35   
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             140   4e-35   
dbj|BAJ88901.1|  predicted protein                                      140   4e-35   
ref|XP_008452668.1|  PREDICTED: serine carboxypeptidase-like 7          140   5e-35   
gb|ACN27602.1|  unknown                                                 141   5e-35   
gb|EMS61531.1|  Serine carboxypeptidase-like 19                         140   5e-35   
ref|XP_009126133.1|  PREDICTED: serine carboxypeptidase-like 3 is...    139   6e-35   
ref|XP_009126131.1|  PREDICTED: serine carboxypeptidase-like 3 is...    139   6e-35   
ref|XP_009133996.1|  PREDICTED: serine carboxypeptidase-like 10 i...    138   6e-35   
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             140   7e-35   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    140   7e-35   
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    140   7e-35   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   8e-35   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          140   8e-35   
gb|AAL73565.1|AC079632_9  Putative acyltransferase                      139   8e-35   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             139   9e-35   
dbj|BAJ86585.1|  predicted protein                                      140   9e-35   
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    140   9e-35   
gb|EMT22788.1|  Serine carboxypeptidase-like protein 9                  139   1e-34   
ref|XP_009105991.1|  PREDICTED: serine carboxypeptidase-like 2 is...    139   1e-34   
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         139   1e-34   
ref|XP_010533332.1|  PREDICTED: serine carboxypeptidase-like 18         136   1e-34   
ref|NP_001064015.1|  Os10g0101200                                       139   1e-34   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          139   2e-34   
gb|EEE50445.1|  hypothetical protein OsJ_30452                          139   2e-34   
ref|XP_003576124.1|  PREDICTED: LOW QUALITY PROTEIN: putative ser...    132   2e-34   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    139   2e-34   
ref|XP_002464850.1|  hypothetical protein SORBIDRAFT_01g027540          139   2e-34   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    139   2e-34   
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          139   2e-34   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          138   2e-34   
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             138   2e-34   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    138   2e-34   



>gb|AAF64227.1|AF248647_1 glucose acyltransferase [Solanum pennellii]
Length=464

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN ++    + ER+E+YV++V + +
Sbjct  306  WCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNESMHYRGK-ERTESYVYDVPSVI  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+  T+KSCR LIYSGDHDM+VPH+STE+WIE+LK+ + DDW PWFV+DQVAGY +KY
Sbjct  365  DDHQHLTSKSCRALIYSGDHDMVVPHLSTEEWIETLKLPIADDWEPWFVDDQVAGYKVKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YE+TYATVKGAGHTAPEYKP +CLPM+ RW S  PL
Sbjct  425  LQNDYEMTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL  464



>ref|XP_006353976.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN ++    + ER+E+YV++V + +
Sbjct  306  WCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNESMHYRGK-ERTESYVYDVPSAI  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+ + DDW PWFV+ QVAGY +KY
Sbjct  365  DDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPWFVDAQVAGYKVKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVKGAGHTAPEYKP +CLPM+ RW S  PL
Sbjct  425  LQNDYELTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL  464



>ref|XP_009795831.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
sylvestris]
Length=396

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN ++    + ER+E+YV++V++ +
Sbjct  238  WCREKNYIYSYIWANDKAVRKALNVREGTALEWVRCNDSMHYRGK-ERTESYVYDVQSVI  296

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+ + DDW PWFV+ QVAGY +KY
Sbjct  297  DDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKLPIADDWEPWFVDGQVAGYKVKY  356

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            SQ +YELTYATVKG GHTAPEYKP +CL M+ RW S YPL
Sbjct  357  SQNDYELTYATVKGGGHTAPEYKPEQCLAMVDRWFSGYPL  396



>ref|XP_009614133.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN ++    + ER+E+YV++VK+ +
Sbjct  293  WCREKNYIYSYVWANDKAVKKALNVREGTTLEWVRCNDSMHYRGK-ERTESYVYDVKSVI  351

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+ + DDW PWFV+ QVAGY +KY
Sbjct  352  DDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKLPITDDWEPWFVDGQVAGYKVKY  411

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            SQ +YE+TYATVKG GHTAPEYKP +CL M+ RW S YPL
Sbjct  412  SQNDYEMTYATVKGGGHTAPEYKPEQCLAMVDRWFSGYPL  451



>ref|XP_009614132.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN ++    + ER+E+YV++VK+ +
Sbjct  310  WCREKNYIYSYVWANDKAVKKALNVREGTTLEWVRCNDSMHYRGK-ERTESYVYDVKSVI  368

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+ + DDW PWFV+ QVAGY +KY
Sbjct  369  DDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKLPITDDWEPWFVDGQVAGYKVKY  428

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            SQ +YE+TYATVKG GHTAPEYKP +CL M+ RW S YPL
Sbjct  429  SQNDYEMTYATVKGGGHTAPEYKPEQCLAMVDRWFSGYPL  468



>gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii]
Length=464

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN ++    + ER+E+YV++V + V
Sbjct  306  WCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNESMHYRGK-ERTESYVYDVPSAV  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
              HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+ + DDW PWFV+ QVAGY +KY
Sbjct  365  GDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPWFVDAQVAGYKVKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVKGAGHTAPEYKP +CLPM+ RW S  PL
Sbjct  425  LQNDYELTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL  464



>ref|XP_009795830.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN ++    + ER+E+YV++V++ +
Sbjct  309  WCREKNYIYSYIWANDKAVRKALNVREGTALEWVRCNDSMHYRGK-ERTESYVYDVQSVI  367

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+ + DDW PWFV+ QVAGY +KY
Sbjct  368  DDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKLPIADDWEPWFVDGQVAGYKVKY  427

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            SQ +YELTYATVKG GHTAPEYKP +CL M+ RW S YPL
Sbjct  428  SQNDYELTYATVKGGGHTAPEYKPEQCLAMVDRWFSGYPL  467



>gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii]
Length=461

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN ++    + ER+E+YV++V + V
Sbjct  303  WCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNESMHYRGK-ERTESYVYDVPSAV  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
              HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+ + DDW PWFV+ QVAGY +KY
Sbjct  362  GDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPWFVDAQVAGYKVKY  421

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVKGAGHTAP+YKP +CLPM+ RW S  PL
Sbjct  422  LQNDYELTYATVKGAGHTAPQYKPEQCLPMVDRWFSGDPL  461



>gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii]
Length=456

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL--SGPPEAERSETYVFNVKN  562
            WCR++NY+++  WAN+K VQKAL VREGT+ EW+RCN+++  S     +RS +YV+ +++
Sbjct  295  WCRENNYIYSKIWANDKAVQKALNVREGTILEWVRCNNSMKYSARESMKRSGSYVYEIQS  354

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            ++D HR  T+KSCR LIYSGDHDMI+ HVSTE+WI++LK+ + DDW PWFVEDQVAGY +
Sbjct  355  SIDDHRHLTSKSCRALIYSGDHDMIISHVSTEEWIDTLKLPIVDDWEPWFVEDQVAGYKV  414

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            KY Q +YELTYATVKGAGHTAPEYKPR+C+ M+  W S  PL
Sbjct  415  KYLQNDYELTYATVKGAGHTAPEYKPRQCMSMVDXWFSGDPL  456



>ref|XP_006353975.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=460

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN ++    + ER+E+Y ++V + +
Sbjct  302  WCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNESMRYRGK-ERTESYAYDVPSAI  360

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR  TNKSCR LIYSGDHDMIVPH++TE+WIE+LK+ + DDW PW V+ QVAGY MKY
Sbjct  361  DYHRHLTNKSCRALIYSGDHDMIVPHLTTEEWIETLKLPIVDDWEPWIVDAQVAGYKMKY  420

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVKGAGHTA EYKP +CL M+ RW S  PL
Sbjct  421  LQNDYELTYATVKGAGHTAAEYKPEQCLSMVDRWFSGDPL  460



>ref|XP_004248779.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=464

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN ++    + ER+E+YV++V + +
Sbjct  306  WCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNESMHYRGK-ERTESYVYDVPSVI  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+  T+KSCR LIYSGDHDM+VPH+ST++WIE+LK+ + DDW PWFV+ QVAGY +KY
Sbjct  365  DDHQHLTSKSCRALIYSGDHDMVVPHLSTKEWIETLKLPIADDWEPWFVDGQVAGYKVKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YE+TYATVKGAGHTAPEYKP +CLPM+ RW S  PL
Sbjct  425  LQNDYEMTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL  464



>ref|XP_006350185.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=461

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS-GPPEA-ERSETYVFNVKN  562
            WCR++NY+++  WAN+K VQKAL +REGT+ EW++CN ++  G  E  +RSE+YV++++ 
Sbjct  300  WCRENNYIYSKIWANDKAVQKALNIREGTILEWVKCNQSMRYGLHEGMKRSESYVYDIQT  359

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            ++D HR  ++KSCR L+YSGDHDM +PH++TE+WI++LK+ + DDW PWFVEDQVAGY +
Sbjct  360  SIDDHRHLSSKSCRALVYSGDHDMTIPHLNTEEWIDTLKLPILDDWEPWFVEDQVAGYKV  419

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            KY Q +YELTYATVKGAGHTAPEYKPR+CL M+ RW S  PL
Sbjct  420  KYLQNDYELTYATVKGAGHTAPEYKPRQCLSMVDRWFSDDPL  461



>ref|XP_006353974.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WAN+K VQKAL VREGT+ EW+RCN ++    + ER+E+YV++V + V
Sbjct  306  WCREKNYIYSYVWANDKAVQKALNVREGTILEWVRCNESMHYRGK-ERTESYVYDVPSAV  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H   T+KSCR LIYSGDHDMIVPH++TE+WIE+LK+ + DDW PW V+ QVAGY MKY
Sbjct  365  DDHCHLTSKSCRALIYSGDHDMIVPHLTTEEWIETLKLPIVDDWEPWIVDAQVAGYKMKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVKGAGHTA EYKP +CL M+ RW S  PL
Sbjct  425  LQNDYELTYATVKGAGHTAAEYKPEQCLSMVDRWFSGDPL  464



>ref|XP_004248778.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=465

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+++Y WANNK VQKAL VREGT+ EW+RCN ++    + ER+E+YV++V + V
Sbjct  307  WCREKNYIYSYVWANNKAVQKALNVREGTILEWVRCNESMHYRGK-ERTESYVYDVPSAV  365

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR  T+KSC+ LIYSGDHDMIVPH++TE+WI++LK+ + DDW PW V+ QVAGY MKY
Sbjct  366  DDHRHLTSKSCQALIYSGDHDMIVPHLTTEEWIDTLKLPIVDDWEPWLVDVQVAGYKMKY  425

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             Q +YELTYATVK AGHTA EYKP +CL M+ RW S  PL
Sbjct  426  LQNDYELTYATVKDAGHTAAEYKPEQCLSMVDRWFSGDPL  465



>ref|XP_011070164.1| PREDICTED: putative serine carboxypeptidase-like 52 [Sesamum 
indicum]
Length=276

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL-SGPPEAERSETYVFNVKN  562
            +WCR+DN   A++WAN+K  QKAL VREGT+ +W+RCN ++ +  P       Y+ NVK 
Sbjct  115  EWCREDNVRLAHTWANDKSAQKALNVREGTIKQWVRCNQSIVNSTPGPSGIIPYINNVKR  174

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            TV YH+ FT+KS RVLI+SGDHDM+ PH+STEKWIESLKV ++ DWRPWF E+Q+ GYTM
Sbjct  175  TVGYHQKFTHKSARVLIFSGDHDMMAPHISTEKWIESLKVPIKSDWRPWFHENQIGGYTM  234

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            +Y+Q +YELTYAT+KG GHT PE++P+E   M  RW+
Sbjct  235  QYAQGDYELTYATIKGGGHTNPEFRPKESFVMFDRWI  271



>ref|XP_011069858.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=481

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGP-PEAERSETYVFNVKN  562
            +WCR+DN   A++WAN+K  QKAL +REGT+ +W+RCN +++   P       Y+ NVK 
Sbjct  320  EWCREDNVRLAHTWANDKYAQKALNIREGTIKQWVRCNQSIANSTPGPSGIIPYINNVKR  379

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            TV YH+ FT+KS RVLI+SGDHDM+ PH+STEKWIESLKV ++ DWRPWFV +Q+ GYTM
Sbjct  380  TVGYHQKFTHKSARVLIFSGDHDMMAPHISTEKWIESLKVPIKSDWRPWFVGNQIGGYTM  439

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            +Y+Q +YELTYAT+KG GHT PEY+P+E   M  RW+
Sbjct  440  QYAQGDYELTYATIKGGGHTNPEYRPKESFVMFDRWI  476



>ref|XP_011069855.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Sesamum 
indicum]
Length=481

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL-SGPPEAERSETYVFNVKN  562
            +WCR+DN   AY WAN+K  QKAL VR+GT+ +W+RCN ++ +  P       Y+ NVK 
Sbjct  320  EWCREDNARLAYIWANDKSAQKALNVRKGTIKQWVRCNQSIVNSTPGPSGIIPYINNVKR  379

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            TV YH+ FT+KS RVLI+SGDHDM  PH+STEKWIESLKV ++ DWRPWFVE+Q+ GYTM
Sbjct  380  TVGYHQKFTHKSARVLIFSGDHDMQAPHISTEKWIESLKVPIKSDWRPWFVENQIGGYTM  439

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            +Y+Q +YELTYAT+KG GHT PEY+P+E   M  RW+
Sbjct  440  QYAQGDYELTYATIKGGGHTNPEYRPKESFVMFNRWI  476



>ref|XP_008228681.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
 ref|XP_008228682.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
Length=181

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 8/158 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF+Y WAN+K VQ AL VREGT+  W RCN + S         +Y  +V+ ++
Sbjct  30   WCRAYNYLFSYIWANDKTVQNALHVREGTIKGWERCNQSFS--------SSYAHDVRTSL  81

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R L+YSGDHDM+VP+V TE+WI SL + ++  WRPWFV  QVAGYT  Y
Sbjct  82   DYHRNLTKKNLRALVYSGDHDMLVPYVGTEEWITSLNLSIDYTWRPWFVNGQVAGYTKAY  141

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            ++K Y LTYATVKGAGH A EY PREC PMI RWLS Y
Sbjct  142  TRKAYSLTYATVKGAGHAATEYNPRECFPMIDRWLSYY  179



>ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 123/163 (75%), Gaps = 12/163 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            +WCR+ NYL++Y+WAN+K VQ+AL +REGT+ EW RCN++LS          Y + V +T
Sbjct  326  RWCREYNYLYSYTWANDKNVQEALRIREGTIKEWARCNYSLS----------YSYGVIST  375

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            +DYH++FT    + LIYSGDHDM +PHV TE+WIESL + +  DW+PW V+ QVAGYT++
Sbjct  376  IDYHKNFTKTGLQALIYSGDHDMAIPHVGTEEWIESLNLTIASDWQPWLVDGQVAGYTVE  435

Query  378  YSQKE--YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS  E  Y LT+ATVKG GHTAPEYKP++CL M+ RW +IYPL
Sbjct  436  YSYDEYAYRLTFATVKGGGHTAPEYKPKQCLAMVDRWFAIYPL  478



>ref|XP_011070163.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=485

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS-GPPEAERSETYVFNVKN  562
            +WCR+DN   ++SWAN+K VQKAL VREGT  +W+RCN TL    P       Y+ +V +
Sbjct  326  EWCREDNAFLSHSWANDKAVQKALNVREGT--QWVRCNQTLRHSKPGPSGKIPYIKDVPS  383

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            T+ YH+ FT  + RVLI+SGDHD++ PH STEKWIESLKV ++ DWRPWFV+DQ+ GYTM
Sbjct  384  TIGYHKKFTQTNARVLIFSGDHDLVAPHTSTEKWIESLKVPIKSDWRPWFVDDQIGGYTM  443

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            +Y+Q  YELTYAT+KG+GHT PE++P+E   +  RW+
Sbjct  444  QYAQGNYELTYATIKGSGHTNPEFRPKESFALFDRWI  480



>ref|XP_008236292.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Prunus 
mume]
Length=480

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF+Y WAN+K VQ AL ++EG++ EWLRCNHTL         ++Y+ +V +++
Sbjct  329  WCRSYNYLFSYIWANDKTVQDALHIQEGSIKEWLRCNHTLQ--------DSYISDVSSSL  380

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVLIYSGDHDM+VP+V+T  WIESL + V+  W+PWFV+ QVAGY ++Y
Sbjct  381  VYHENLIKQGYRVLIYSGDHDMLVPYVATMAWIESLNLTVDSRWKPWFVDGQVAGYRVQY  440

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S K+Y+LTY T+KGAGHTAPEYKP EC  MI RW + YPL
Sbjct  441  SDKKYQLTYTTIKGAGHTAPEYKPEECHAMISRWFAYYPL  480



>ref|XP_007201001.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02200.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=470

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF+Y WAN+K VQ AL ++EG++ EWLRCNHTL         ++Y+F+V +++
Sbjct  319  WCRSYNYLFSYIWANDKTVQDALHIQEGSIKEWLRCNHTLK--------DSYIFDVSSSL  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVLIYSGDHDM++P+V+T  WIESL + V+  W+PWFV+ QVAGY ++Y
Sbjct  371  VYHENLIKQGYRVLIYSGDHDMVIPYVATMAWIESLNLTVDSRWKPWFVDGQVAGYRVQY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S K+Y+LTY T+KGAGHTA EYKP EC  MI RW + YPL
Sbjct  431  SDKKYQLTYTTIKGAGHTATEYKPEECHAMISRWFAYYPL  470



>gb|KCW55080.1| hypothetical protein EUGRSUZ_I010431, partial [Eucalyptus grandis]
Length=262

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 112/160 (70%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ +YL+ Y WAN+K VQKAL +REGT TEW+RCN           S +Y  +V  + 
Sbjct  113  WCRNYDYLYCYVWANDKTVQKALHIREGTKTEWIRCN----------ESSSYAHDVIKST  162

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T K  R LIYSGDHDM+VP++ T  WIE+L + +  DW  WFV+ QVAGYT +Y
Sbjct  163  DYHQNLTEKKLRALIYSGDHDMVVPYIGTMAWIETLNLSLSTDWEAWFVDGQVAGYTQQY  222

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                YELTYATVKGAGHTAPEYKP+E L MI RW + YPL
Sbjct  223  EHDNYELTYATVKGAGHTAPEYKPKETLAMIYRWFAHYPL  262



>ref|XP_011069856.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=477

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 5/157 (3%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL-SGPPEAERSETYVFNVKN  562
            +WCR+DN   AY WAN+K  QKAL VR+    +W+RCN ++ +  P       Y+ NVK 
Sbjct  320  EWCREDNARLAYIWANDKSAQKALNVRK----QWVRCNQSIVNSTPGPSGIIPYINNVKR  375

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            TV YH+ FT+KS RVLI+SGDHDM  PH+STEKWIESLKV ++ DWRPWFVE+Q+ GYTM
Sbjct  376  TVGYHQKFTHKSARVLIFSGDHDMQAPHISTEKWIESLKVPIKSDWRPWFVENQIGGYTM  435

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            +Y+Q +YELTYAT+KG GHT PEY+P+E   M  RW+
Sbjct  436  QYAQGDYELTYATIKGGGHTNPEYRPKESFVMFNRWI  472



>ref|XP_006422773.1| hypothetical protein CICLE_v10028648mg [Citrus clementina]
 gb|ESR36013.1| hypothetical protein CICLE_v10028648mg [Citrus clementina]
Length=383

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR DNY ++Y+WANNK VQKAL VREGT+  W RCN +LS          Y ++V + 
Sbjct  232  HWCRKDNYFYSYNWANNKAVQKALRVREGTVEYWTRCNKSLS----------YTYDVSSG  281

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR  T K  +VL+YSGD DM+VP+++TE WI+SL + +E  W+PW VE QVAGY  +
Sbjct  282  VDYHRKLTKKGYQVLVYSGDVDMVVPYMATEAWIKSLNLTIETGWQPWLVESQVAGYWYR  341

Query  378  YSQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y  K  Y LT+ATVKGAGHT PEYKP+ECL MI RW + YPL
Sbjct  342  YKGKNNYHLTFATVKGAGHTGPEYKPKECLAMIDRWFASYPL  383



>ref|XP_010030620.1| PREDICTED: serine carboxypeptidase-like 1 [Eucalyptus grandis]
Length=558

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 112/160 (70%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ +YL+ Y WAN+K VQKAL +REGT TEW+RCN           S +Y  +V  + 
Sbjct  409  WCRNYDYLYCYVWANDKTVQKALHIREGTKTEWIRCN----------ESSSYAHDVIKST  458

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T K  R LIYSGDHDM+VP++ T  WIE+L + +  DW  WFV+ QVAGYT +Y
Sbjct  459  DYHQNLTEKKLRALIYSGDHDMVVPYIGTMAWIETLNLSLSTDWEAWFVDGQVAGYTQQY  518

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                YELTYATVKGAGHTAPEYKP+E L MI RW + YPL
Sbjct  519  EHDNYELTYATVKGAGHTAPEYKPKETLAMIYRWFAHYPL  558



>ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=468

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 118/160 (74%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+F+Y WAN+K VQKAL VREGT+ +W+RCN +LS          Y  NV ++V
Sbjct  319  WCRSYNYVFSYLWANDKTVQKALHVREGTVKDWVRCNESLS----------YTSNVFSSV  368

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R LIYSGDHDM++P+V T+ WI SL + + +DW+PWFV+ QVAG+ ++Y
Sbjct  369  DYHRNLTKKAYRALIYSGDHDMLIPYVGTQAWIASLNLNISEDWQPWFVDGQVAGFRVEY  428

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               +Y +T+ATVKGAGHTAPEY+P+E   M+ RWL+ Y L
Sbjct  429  LHNKYLMTFATVKGAGHTAPEYRPKEGFAMVYRWLAHYFL  468



>ref|XP_006486897.1| PREDICTED: serine carboxypeptidase-like 17-like [Citrus sinensis]
Length=468

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            +WCR DNY ++Y+WANNK VQKAL VREGT+  W RCN +LS          Y ++V + 
Sbjct  317  RWCRKDNYFYSYNWANNKAVQKALRVREGTVEYWTRCNKSLS----------YTYDVSSG  366

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR  T K  +VL+YSGD DM+VP+++TE WI+SL + +E  W+PW VE QVAGY  +
Sbjct  367  VDYHRKLTKKGYQVLVYSGDVDMVVPYMATEAWIKSLNLTIETGWQPWLVESQVAGYWYR  426

Query  378  YSQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y  K  Y LT+ATVKGAGHT  EYKP+ECL MI RW + YPL
Sbjct  427  YKGKNNYHLTFATVKGAGHTGLEYKPKECLAMIYRWFASYPL  468



>ref|XP_011100015.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 119/160 (74%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+ +Y WANN+ VQ+AL +R+GT+++W RCN +LS          Y  +V +  
Sbjct  318  WCRNYNYVSSYVWANNETVQEALQIRQGTISDWKRCNRSLS----------YEQDVLSVS  367

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             +H+  ++K  + L YSGDHDMIVP++ST KWI  L + +++DWRPW V+ QVAGYTMKY
Sbjct  368  KHHQLLSDKGFQALAYSGDHDMIVPYMSTLKWIRDLNLTLDEDWRPWTVDGQVAGYTMKY  427

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               + ELT+ATVKGAGHTAPEYKP++CL MI+RWLS+YPL
Sbjct  428  KNNQAELTFATVKGAGHTAPEYKPKQCLAMIKRWLSLYPL  467



>ref|XP_007201135.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
 gb|EMJ02334.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
Length=450

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 8/158 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF++ WAN+K VQ AL VREGT+  W +CN +LS          Y  +V+ ++
Sbjct  299  WCRPYNYLFSFIWANDKTVQNALHVREGTIKGWEKCNQSLS--------SNYAHDVRTSI  350

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R L+YSGDHDM++P+V T++WI+SL + V+  WRPWFV  QVAGYT  Y
Sbjct  351  DYHRNLTKKNLRALVYSGDHDMLIPYVGTQEWIKSLNLSVDYQWRPWFVNGQVAGYTNAY  410

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            ++K Y LT+ TVKG GHTAPE+KP EC  MI RW + Y
Sbjct  411  TRKTYSLTFVTVKGGGHTAPEFKPMECHAMIDRWFAYY  448



>ref|XP_006422770.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
 gb|ESR36010.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
Length=468

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 113/162 (70%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR DNY ++Y+WANNK VQKAL VREGT+  W RCN +LS          Y  +V + 
Sbjct  317  HWCRKDNYFYSYNWANNKAVQKALRVREGTVEYWTRCNKSLS----------YTSDVSSG  366

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR  T K  +VL+YSGD DM+VP+++TE WI+SL + +E  W+PW VE QVAGY  +
Sbjct  367  VDYHRKLTKKGYQVLVYSGDVDMVVPYMATEAWIKSLNLTIETGWQPWLVESQVAGYWYR  426

Query  378  YSQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y  K  Y LT+ATVKGAGH  PEY+P+ECL MI RW + YPL
Sbjct  427  YKGKNNYHLTFATVKGAGHNGPEYRPKECLAMIDRWFASYPL  468



>ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=476

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYL+A +WAN+K VQ+ALG++EG + EW RCN +LS          Y  NV +++
Sbjct  326  WCRHQNYLYAPTWANDKTVQRALGIQEGMVKEWRRCNKSLS----------YTTNVLSSL  375

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+   K  +VLIYSGD DM +P+V TE WI+SL + ++  W+PW V+ QVAG+ M+Y
Sbjct  376  DYHRNLIKKGYQVLIYSGDVDMEIPYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRY  435

Query  375  SQKE-YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            ++K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW ++YPL
Sbjct  436  AEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL  476



>ref|XP_008236457.1| PREDICTED: putative serine carboxypeptidase-like 52 [Prunus mume]
Length=156

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 8/155 (5%)
 Frame = -1

Query  720  NYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRS  541
            NYLF+Y WAN++ VQ AL +REG++ EW  CN TL         + Y+ +V +++ YH +
Sbjct  10   NYLFSYIWANDRTVQDALHIREGSIKEWEICNKTLH--------DLYISDVSSSLVYHEN  61

Query  540  FTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEY  361
               +  RVLIYSGDHDM +P++ST  WIESL + V+  W+PWF+  QVAGY + YS K+Y
Sbjct  62   LIKQGYRVLIYSGDHDMNIPYLSTMGWIESLNLTVDSRWKPWFLHGQVAGYRVLYSDKKY  121

Query  360  ELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +LTY T+KGAGHTAPEYKP ECL MI RWL+ YPL
Sbjct  122  QLTYTTIKGAGHTAPEYKPEECLAMITRWLAYYPL  156



>ref|XP_008236294.1| PREDICTED: serine carboxypeptidase-like 14 [Prunus mume]
Length=463

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 8/158 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF++ WAN+K VQ AL VREGT+  W +CN ++S          Y  +V+ ++
Sbjct  312  WCRTYNYLFSFIWANDKTVQNALHVREGTIKGWEKCNQSIS--------SNYAHDVRTSI  363

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R L+YSGDHDM++P+V T++WI+SL + V+  WRPWFV+ QVAGYT  Y
Sbjct  364  DYHRNLTKKNLRALVYSGDHDMLIPYVGTQEWIKSLNLSVDYQWRPWFVDGQVAGYTNAY  423

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            ++K Y LT+ TVKG GHTAPE+KP EC  MI RW + Y
Sbjct  424  TRKTYSLTFVTVKGGGHTAPEFKPMECHAMIDRWFAYY  461



>ref|XP_006422778.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36018.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=271

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN+K VQ+A+GV+EGT+  W+RCN +LS          Y  +V +++
Sbjct  121  WCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS----------YTKDVSSSL  170

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y
Sbjct  171  AYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRY  230

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  231  KEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  271



>ref|XP_008236286.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Prunus 
mume]
Length=470

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR   YL +Y WAN+K VQ+AL ++EG++ EW RCN TL         E Y+ +V +++
Sbjct  319  WCRSYAYLLSYIWANDKTVQEALHIQEGSIKEWERCNKTLQ--------EFYISDVSSSL  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM VP+V T  WIESL + V+  W+PWFV+ QVAGY ++Y
Sbjct  371  VYHENLIKQGYRVLVYSGDHDMNVPYVGTMGWIESLNLTVDSHWKPWFVDGQVAGYRVQY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            + K+Y+LTYAT+KGAGHTAPEYKP EC  MI RWL+ YPL
Sbjct  431  TYKKYQLTYATIKGAGHTAPEYKPEECFAMISRWLAYYPL  470



>gb|KDO49556.1| hypothetical protein CISIN_1g023030mg [Citrus sinensis]
Length=288

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN+K VQ+A+GV+EGT+  W+RCN +LS          Y  +V +++
Sbjct  138  WCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS----------YTKDVSSSL  187

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y
Sbjct  188  AYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRY  247

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  248  KEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  288



>ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
 gb|ESR36020.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
Length=476

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY +A +WAN+K VQ+ALG++EG + EW RCN +LS          Y  NV ++V
Sbjct  326  WCRNQNYFYAPTWANDKTVQRALGIQEGMVKEWRRCNKSLS----------YTTNVLSSV  375

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+F  K  +VLIYSGD DM   +V TE WI+SL + ++  W+PW V+ QVAG+ M+Y
Sbjct  376  DYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRY  435

Query  375  SQKE-YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            ++K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW ++YPL
Sbjct  436  AEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL  476



>ref|XP_008236291.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Prunus 
mume]
Length=480

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 115/160 (72%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYL++  W N+K VQ AL ++EG++TEW RCN TL         E Y+ +V +++
Sbjct  329  WCRSYNYLYSSIWENDKTVQDALHIQEGSITEWERCNKTLQ--------ELYITDVSSSL  380

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM +P+V+T  WIESL + V+  W+PWFV+ QVAGY M+Y
Sbjct  381  VYHENIIKQGYRVLVYSGDHDMDIPYVATMAWIESLNLTVDSPWKPWFVDGQVAGYRMQY  440

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            + K+Y+LTYAT+KGAGHTAPEYKP EC  MI RW + YPL
Sbjct  441  TYKKYQLTYATIKGAGHTAPEYKPEECHAMISRWFAYYPL  480



>gb|KCW55076.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=374

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN++ VQ+ALG+R GT  EW RCNHTLS          Y  +V N V
Sbjct  224  WCRPANYIYSYIWANDEKVQEALGIRTGTKQEWNRCNHTLS----------YTKDVLNAV  273

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH   + K+ R L+YSGDHD+ +P+V+T  WI SL + +E  W PWFVE Q+AGY++ Y
Sbjct  274  VYHEYLSEKTLRALVYSGDHDLAIPYVATLDWIRSLNLTLEGSWSPWFVEGQIAGYSILY  333

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  +Y+LT+ T+KG GHTAPEYKP++CL M+ RW S YPL
Sbjct  334  SKNSKYDLTFTTIKGGGHTAPEYKPKQCLAMVDRWFSYYPL  374



>ref|XP_006422775.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 ref|XP_006422776.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36015.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36016.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=330

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN+K VQ+A+GV+EGT+  W+RCN +LS          Y  +V +++
Sbjct  180  WCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS----------YTKDVSSSL  229

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y
Sbjct  230  AYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRY  289

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  290  KEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  330



>ref|XP_007200784.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
 gb|EMJ01983.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
Length=456

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 8/158 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            W +  NY+F + WAN+K VQ AL VREGT+  W RCN +L           YV++V+ ++
Sbjct  305  WLQSYNYIFCFIWANDKTVQNALNVREGTIKGWERCNQSLF--------SNYVYDVRTSI  356

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R L+YSGDHDMI+P+V T +WI+SL + V+  WRPWFV  QVAGYT  Y
Sbjct  357  DYHRNLTKKNLRALVYSGDHDMIIPYVGTREWIKSLNLSVDYQWRPWFVNGQVAGYTNAY  416

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            + K Y LT+ TVKG GH+APEYKP ECL M+ RW + Y
Sbjct  417  TLKAYSLTFVTVKGGGHSAPEYKPMECLAMVDRWFAYY  454



>ref|XP_011030308.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=455

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 15/166 (9%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            QWCR  N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NVK+T
Sbjct  300  QWCRSYNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVKST  349

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+ T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGY M 
Sbjct  350  VDYHRNLTKKPYRALIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYAML  409

Query  378  YSQKE-----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+        Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  410  YADNAQEYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  455



>ref|XP_011030307.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 15/166 (9%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            QWCR  N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NVK+T
Sbjct  329  QWCRSYNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVKST  378

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+ T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGY M 
Sbjct  379  VDYHRNLTKKPYRALIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYAML  438

Query  378  YSQKE-----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+        Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  439  YADNAQEYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  484



>ref|XP_007199819.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01018.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=470

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 115/160 (72%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYL++  W N+K VQ AL ++EG++TEW RCN TL         E Y+ +V +++
Sbjct  319  WCRSYNYLYSSIWENDKTVQDALHIQEGSITEWERCNKTLQ--------ELYISDVSSSL  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM +P+V+T  WIESL + V+  W+PWFV+ QVAGY ++Y
Sbjct  371  VYHENLIKQGYRVLVYSGDHDMDIPYVATMAWIESLNLTVDSPWKPWFVDGQVAGYRVQY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            + K+Y+LTYAT+KGAGHTAPEYKP EC  MI RW + YPL
Sbjct  431  TYKKYQLTYATIKGAGHTAPEYKPEECHAMISRWFAYYPL  470



>ref|XP_008338878.1| PREDICTED: serine carboxypeptidase-like 1 [Malus domestica]
Length=475

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 9/161 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+ +  WAN+K VQ AL VREG++ EW+RCN++L          +Y+ +V +++
Sbjct  323  WCREYNYILSEIWANDKTVQDALHVREGSIEEWVRCNYSLQ--------XSYIKDVSSSL  374

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   K  RVLIYSGDHDM+VP+V T  WIESL + V++ WRPWFV  Q+AGY+++Y
Sbjct  375  VYHENLIKKGYRVLIYSGDHDMVVPYVGTLAWIESLNLTVDNRWRPWFVSGQIAGYSVQY  434

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S    Y+LT+ T+KGAGHTAPEYKP ECL MI RW + YPL
Sbjct  435  SXITNYKLTFTTIKGAGHTAPEYKPEECLAMISRWFAYYPL  475



>ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=470

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN+K VQ A+GVREGT+  W+RCN +LS          Y  +V +++
Sbjct  320  WCRFHNYVYSYIWANDKTVQSAIGVREGTVKYWVRCNQSLS----------YTKDVSSSL  369

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y
Sbjct  370  AYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLSLTIETGWQPWFVEGQVAGYWYRY  429

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  430  KEKNNYHLTFATVKGAGHTAPEYKPKECLAMIDRWFACHPL  470



>ref|XP_008236290.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=473

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR+D   +A  W N+  V+KAL +REGT  EW +CN T            Y F+V ++
Sbjct  323  QLCREDRIRYAVLWQNDINVRKALNIREGTKGEWAKCNKT----------TPYTFDVPSS  372

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+ + K  R ++YSGDHD+ +P++ST  WIESL + +EDDW+PWF + QVAGYTM 
Sbjct  373  VDYHRNLSQKHLRAIVYSGDHDITIPYISTLAWIESLNLTLEDDWKPWFSDHQVAGYTMY  432

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS  EY LTYAT+KG GHTAPEY P+EC  MI RWL+  PL
Sbjct  433  YSNNEYNLTYATIKGGGHTAPEYNPKECFDMINRWLAHSPL  473



>ref|XP_008236280.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=476

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D   ++  WAN+  V+KAL +REGT  EW+RCN          R+  Y+ +V+  V+
Sbjct  328  CRADRLRYSVVWANDMEVRKALNIREGTKGEWVRCN----------RTTPYIKDVQRAVE  377

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR+ + KS R  +YSGDHD+ VP+VSTE WIESL + ++DDW+PWF  +QVAGYT++YS
Sbjct  378  YHRNLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLSLPIDDDWKPWFSNNQVAGYTVRYS  437

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +Y LTYAT+KG GHTAPE+ PREC  MI+RWL   PL
Sbjct  438  NGDYHLTYATIKGGGHTAPEFNPRECFDMIKRWLEHSPL  476



>ref|XP_010028346.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55075.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=464

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN++ VQ+ALG+R GT  EW RCNHTLS          Y  +V N V
Sbjct  314  WCRPANYIYSYIWANDEKVQEALGIRTGTKQEWNRCNHTLS----------YTKDVLNAV  363

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH   + K+ R L+YSGDHD+ +P+V+T  WI SL + +E  W PWFVE Q+AGY++ Y
Sbjct  364  VYHEYLSEKTLRALVYSGDHDLAIPYVATLDWIRSLNLTLEGSWSPWFVEGQIAGYSILY  423

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  +Y+LT+ T+KG GHTAPEYKP++CL M+ RW S YPL
Sbjct  424  SKNSKYDLTFTTIKGGGHTAPEYKPKQCLAMVDRWFSYYPL  464



>ref|XP_008236281.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=472

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D   ++  WAN+  V+KAL +REGT  EW+RCN          R+  Y+ +V+  V+
Sbjct  324  CRADRLRYSVVWANDMEVRKALNIREGTKGEWVRCN----------RTTPYIKDVQRAVE  373

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR+ + KS R  +YSGDHD+ VP+VSTE WIESL + ++DDW+PWF  +QVAGYT++YS
Sbjct  374  YHRNLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLSLPIDDDWKPWFSNNQVAGYTVRYS  433

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +Y LTYAT+KG GHTAPE+ PREC  MI+RWL   PL
Sbjct  434  NGDYHLTYATIKGGGHTAPEFNPRECFDMIKRWLEHSPL  472



>ref|XP_011100017.1| PREDICTED: serine carboxypeptidase-like 13 [Sesamum indicum]
Length=467

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 117/160 (73%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY  +Y WANN+ VQ+AL +R+GT+++W RC+ +LS          Y  +V +  
Sbjct  318  WCRNYNYASSYVWANNETVQEALQIRQGTISDWKRCSRSLS----------YEQDVLSVF  367

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             +H+  ++K  + L YSGDHDMI+P++ST KWI  L + +++DWRPW V+ QVAGYTMKY
Sbjct  368  KHHQLLSDKGFQALAYSGDHDMIIPYMSTLKWIRDLNLTLDEDWRPWTVDGQVAGYTMKY  427

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               + ELT+ATVKGAGHTAPEYKP++CL MI+ WLS+YPL
Sbjct  428  KNNQAELTFATVKGAGHTAPEYKPKQCLAMIKSWLSLYPL  467



>ref|XP_011457834.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR   Y F+Y WAN+K VQ AL VREG++ +W RCN TLS         +Y+ +V +++
Sbjct  314  WCRSYIYRFSYIWANDKTVQDALHVREGSIKDWQRCNKTLSA--------SYISDVSSSL  365

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++   K  RVLIYSGDHDM++P++ T  WIESL + V+  W+PWFV  Q+AGY ++Y
Sbjct  366  VYHQNLIKKGYRVLIYSGDHDMVIPYLGTVAWIESLNLTVDSGWKPWFVNGQIAGYRVQY  425

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            + ++Y+LT+ T+KG GHTAPEY+P ECL M+ RW + YPL
Sbjct  426  TYEKYQLTFTTIKGGGHTAPEYRPEECLAMLSRWFAFYPL  465



>gb|KDP44525.1| hypothetical protein JCGZ_16358 [Jatropha curcas]
Length=209

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR+ NY+ +Y WAN++ VQ+AL +R GT+T+W RCN TL+          Y +++ +T
Sbjct  58   NWCRNSNYVLSYIWANDEGVQEALHIRNGTITDWKRCNKTLA----------YEYDLLST  107

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YH+       R L+YSGDHDM++P+  T  WI SL + + D WRPWFVE Q+AG+T+K
Sbjct  108  VFYHKELLTAGYRALVYSGDHDMLIPYTGTVTWINSLNLTMSDGWRPWFVEGQIAGFTVK  167

Query  378  YSQKEYE-LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS+   + LT+ATVKG GHTAPEYKP+ECL M+ RWLS Y +
Sbjct  168  YSRDVGDGLTFATVKGGGHTAPEYKPKECLAMVDRWLSYYGM  209



>ref|XP_008236288.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Prunus 
mume]
Length=491

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR+D   +A  W N+  V+KAL +REGT  EW +CN T            Y F+V ++
Sbjct  341  QLCREDRIRYAVLWQNDINVRKALNIREGTKGEWAKCNKT----------TPYTFDVPSS  390

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+ + K  R ++YSGDHD+ +P++ST  WIESL + +EDDW+PWF + QVAGYTM 
Sbjct  391  VDYHRNLSQKHLRAIVYSGDHDITIPYISTLAWIESLNLTLEDDWKPWFSDHQVAGYTMY  450

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS  EY LTYAT+KG GHTAPEY P+EC  MI RWL+  PL
Sbjct  451  YSNNEYNLTYATIKGGGHTAPEYNPKECFDMINRWLAHSPL  491



>ref|XP_008236287.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=480

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 8/160 (5%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYL++  W N+K VQ AL ++EG++TEW RCN TL         E Y  +V +++
Sbjct  329  WCRSYNYLYSSIWENDKTVQDALHIQEGSITEWERCNKTLQ--------ELYTSDVSSSL  380

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM +P+V+T  WIESL + V+  W+PWFV+ QVAGY ++Y
Sbjct  381  VYHENIIKQGYRVLVYSGDHDMDIPYVATMAWIESLNLTVDSPWKPWFVDGQVAGYRVQY  440

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            + K+Y+LTYAT+KGAGHTAPEYKP EC  MI RW + YPL
Sbjct  441  TYKKYQLTYATIKGAGHTAPEYKPEECHAMISRWFAYYPL  480



>ref|XP_002298786.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
 gb|EEE83591.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
Length=469

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 113/165 (68%), Gaps = 15/165 (9%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NV++TV
Sbjct  315  WCRSYNYVYIYMWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVESTV  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGY M Y
Sbjct  365  DYHRNLTKKPYRALIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYAMLY  424

Query  375  SQK-----EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +        Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  425  ADNVQDYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  469



>ref|XP_004289672.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+D   ++  W N+  V+ AL +REGT  +W +CN T            Y F++ + ++
Sbjct  326  CREDKIRYSVLWQNDMNVRNALNIREGTKGQWTKCNKT----------TPYTFDIASNIE  375

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR+ + KS R LIYSGDHDM VP++ST  WIES+   +E+DWRPWF  DQVAGYT+ YS
Sbjct  376  YHRNLSQKSLRALIYSGDHDMSVPYISTLAWIESMNFTIEEDWRPWFSNDQVAGYTLYYS  435

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             KEY LTYAT+KG GHTAPEY P+EC  MI RWL+  PL
Sbjct  436  NKEYNLTYATIKGGGHTAPEYNPKECFDMISRWLAHAPL  474



>ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=470

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN+K VQ+A+GV+EGT+  W+RCN +LS          Y  +V +++
Sbjct  320  WCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS----------YTKDVSSSL  369

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y
Sbjct  370  AYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRY  429

Query  375  SQK-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  430  KEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  470



>ref|XP_008236285.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Prunus 
mume]
Length=472

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 10/162 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKN  562
            WCR   YL +Y WAN+K VQ+AL ++E  G++ EW RCN TL         E Y+ +V +
Sbjct  319  WCRSYAYLLSYIWANDKTVQEALHIQENQGSIKEWERCNKTLQ--------EFYISDVSS  370

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            ++ YH +   +  RVL+YSGDHDM VP+V T  WIESL + V+  W+PWFV+ QVAGY +
Sbjct  371  SLVYHENLIKQGYRVLVYSGDHDMNVPYVGTMGWIESLNLTVDSHWKPWFVDGQVAGYRV  430

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  MI RWL+ YPL
Sbjct  431  QYTYKKYQLTYATIKGAGHTAPEYKPEECFAMISRWLAYYPL  472



>ref|XP_010647903.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=464

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   +LF+Y WAN++ VQKALG+REGT+ EW+RCN++L+          Y  +V +TV 
Sbjct  316  CRLYKFLFSYIWANDRRVQKALGIREGTIPEWVRCNNSLA----------YTHDVFSTVA  365

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            Y +    K    LIYSGDHDM+VPH+ T++WI SL + +  DW PWFV+ QVAG++++YS
Sbjct  366  YIQKLHEKGYGGLIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYS  425

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +  +T+ATVKG GHTAPEYKP+ECL MI RWL+ YPL
Sbjct  426  NSKRGMTFATVKGGGHTAPEYKPKECLAMIYRWLAYYPL  464



>ref|XP_011088733.1| PREDICTED: serine carboxypeptidase-like 7 [Sesamum indicum]
Length=493

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 125/182 (69%), Gaps = 13/182 (7%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ NY+ +Y WAN++ VQ+AL +R+GT+TEW RCN +LS          Y  +V++   
Sbjct  313  CRNYNYVTSYVWANDETVQEALHIRKGTITEWKRCNRSLS----------YEHDVESVFQ  362

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +HR    K  + L+YSGDHDM +P++ST KWI  L + ++ DWRPW V+ QVAGYTMKY 
Sbjct  363  HHRLLNEKGFQALVYSGDHDMAIPYLSTLKWICDLNLTLDKDWRPWNVDGQVAGYTMKYK  422

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL*LLCKIILNAYYIPY*NGKCL  193
              E +LT+ATVKGAGHTAPEYKP++CL M+ RWLS YPL +   I ++   IP    +CL
Sbjct  423  NNEAQLTFATVKGAGHTAPEYKPKQCLAMVNRWLSSYPLYI--DISMSELIIPT-TFECL  479

Query  192  AI  187
            A+
Sbjct  480  AM  481



>ref|XP_011100016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 10/155 (6%)
 Frame = -1

Query  720  NYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRS  541
            NY+ +Y WANN+ VQ+AL +R+GT+++W RCN +LS          Y  +V +   +H+ 
Sbjct  272  NYVSSYVWANNETVQEALQIRQGTISDWKRCNRSLS----------YEQDVLSVSKHHQL  321

Query  540  FTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEY  361
             ++K  + L YSGDHDMIVP++ST KWI  L + +++DWRPW V+ QVAGYTMKY   + 
Sbjct  322  LSDKGFQALAYSGDHDMIVPYMSTLKWIRDLNLTLDEDWRPWTVDGQVAGYTMKYKNNQA  381

Query  360  ELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            ELT+ATVKGAGHTAPEYKP++CL MI+RWLS+YPL
Sbjct  382  ELTFATVKGAGHTAPEYKPKQCLAMIKRWLSLYPL  416



>ref|XP_009343182.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 9/161 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCRD NY+F+  WAN++ VQ AL V+EG++ +W+RCN +L         ++ + +V +++
Sbjct  255  WCRDYNYIFSEIWANDRTVQDALHVQEGSIEDWVRCNKSLE--------DSNINDVSSSL  306

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM+VP+V T  WIESL + V+  WRPWFV  Q+AGY+++Y
Sbjct  307  VYHENLIKRGYRVLVYSGDHDMVVPYVGTLAWIESLNLTVDSRWRPWFVSGQIAGYSVQY  366

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S    Y+LT+ T+KGAGHTAPEYKP ECL MI RW + YPL
Sbjct  367  SHITNYKLTFTTIKGAGHTAPEYKPEECLAMISRWFAYYPL  407



>emb|CBI22420.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 116/160 (73%), Gaps = 11/160 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+F+Y WAN+K VQKAL VRE  + +W+RCN +LS          Y  NV ++V
Sbjct  355  WCRSYNYVFSYLWANDKTVQKALHVREA-IKDWVRCNESLS----------YTSNVFSSV  403

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K+ R LIYSGDHDM++P+V T+ WI SL + + +DW+PWFV+ QVAG+ ++Y
Sbjct  404  DYHRNLTKKAYRALIYSGDHDMLIPYVGTQAWIASLNLNISEDWQPWFVDGQVAGFRVEY  463

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               +Y +T+ATVKGAGHTAPEY+P+E   M+ RWL+ Y L
Sbjct  464  LHNKYLMTFATVKGAGHTAPEYRPKEGFAMVYRWLAHYFL  503



>ref|XP_006369720.1| hypothetical protein POPTR_0001s29840g [Populus trichocarpa]
 gb|ERP66289.1| hypothetical protein POPTR_0001s29840g [Populus trichocarpa]
Length=409

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 114/165 (69%), Gaps = 15/165 (9%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NV++TV
Sbjct  255  WCRNYNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVESTV  304

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGYTM Y
Sbjct  305  DYHRNLTKKPYRSLIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYTMLY  364

Query  375  SQK-----EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +        Y+LT+ATVKG GHTA EY+P +C  M+ RW   YPL
Sbjct  365  ADNVQDYITYDLTFATVKGGGHTASEYRPEQCFAMMDRWFDYYPL  409



>emb|CAN83341.1| hypothetical protein VITISV_021484 [Vitis vinifera]
Length=488

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   +LF+Y WAN++ VQKALG+REGT+ EW+RCN++L+          Y  +V +TV 
Sbjct  340  CRLYKFLFSYIWANDRRVQKALGIREGTIPEWVRCNNSLA----------YTHDVFSTVA  389

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            Y +    K    LIYSGDHDM+VPH+ T++WI SL + +  DW PWFV+ QVAG++++YS
Sbjct  390  YIQKLHEKGYGGLIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYS  449

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +  +T+ATVKG GHTAPEYKP+ECL MI RWL+ YPL
Sbjct  450  NSKRGMTFATVKGGGHTAPEYKPKECLAMIYRWLAYYPL  488



>ref|XP_009343181.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Pyrus x 
bretschneideri]
Length=470

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 9/161 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCRD NY+F+  WAN++ VQ AL V+EG++ +W+RCN +L         ++ + +V +++
Sbjct  318  WCRDYNYIFSEIWANDRTVQDALHVQEGSIEDWVRCNKSLE--------DSNINDVSSSL  369

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM+VP+V T  WIESL + V+  WRPWFV  Q+AGY+++Y
Sbjct  370  VYHENLIKRGYRVLVYSGDHDMVVPYVGTLAWIESLNLTVDSRWRPWFVSGQIAGYSVQY  429

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S    Y+LT+ T+KGAGHTAPEYKP ECL MI RW + YPL
Sbjct  430  SHITNYKLTFTTIKGAGHTAPEYKPEECLAMISRWFAYYPL  470



>gb|KCW55069.1| hypothetical protein EUGRSUZ_I010391, partial [Eucalyptus grandis]
Length=328

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WAN++ VQ+AL +REGT  EW RCN +LS          Y  +V N+V
Sbjct  178  WCRNYNYLYSYIWANDRNVQEALHIREGTKPEWDRCNESLS----------YTKDVLNSV  227

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR  +  S R LIYSGDHD+ +P++ T  WI SL + +   W PWFV  QVAGY++ Y
Sbjct  228  VYHRYLSKTSLRALIYSGDHDLAIPYIGTLDWIRSLNLTLLGPWAPWFVNGQVAGYSILY  287

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  +Y+LTY T+KG GHTAPEYKP+EC  M+ RW S YPL
Sbjct  288  SKNNKYDLTYTTIKGGGHTAPEYKPKECFSMVDRWFSYYPL  328



>ref|XP_002300280.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
 gb|EEE85085.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
Length=446

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 114/165 (69%), Gaps = 15/165 (9%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  ++ + Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NV++TV
Sbjct  292  WCRSYDHEYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVESTV  341

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ T K  R LIYSGDHDM++P+V T +WIESL + ++ DW PWFV+ QVAGY M Y
Sbjct  342  DYHRNLTKKPYRALIYSGDHDMLIPYVGTLEWIESLNLTIKYDWEPWFVDGQVAGYAMLY  401

Query  375  SQKE-----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +        Y+LT+ATVKG GHTAPEY+P +C  M+ RW + YPL
Sbjct  402  ADNAQDYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFNYYPL  446



>ref|XP_011030310.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 113/166 (68%), Gaps = 15/166 (9%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR  N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NV++ 
Sbjct  329  HWCRSYNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVESA  378

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+ T K  R LIYSGDHD+I+P++ T +WIESL + ++ DW PWFV+ QVAGY M 
Sbjct  379  VDYHRNLTKKPYRALIYSGDHDIIIPYIGTHEWIESLNLTIKHDWEPWFVDGQVAGYAML  438

Query  378  YSQKE-----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+        Y+L++ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  439  YADNAQEYITYDLSFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  484



>ref|XP_007201024.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
 gb|EMJ02223.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
Length=427

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 10/156 (6%)
 Frame = -1

Query  723  DNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
            D   ++  WAN+  V+K+L +REGT  EW RCN          RS  Y+ +V+  V+YHR
Sbjct  282  DRLRYSVVWANDMKVRKSLNIREGTKGEWARCN----------RSTPYIKDVQRAVEYHR  331

Query  543  SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
            + + KS R  +YSGDHD+ VP+VSTE WIESL + ++DDW+PWF  +QVAGYT++YS  E
Sbjct  332  NLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLSLPIDDDWKPWFSNNQVAGYTVRYSNGE  391

Query  363  YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y LTYAT+KG GHTAPE+ P+EC  MI+RWL   PL
Sbjct  392  YHLTYATIKGGGHTAPEFNPKECFDMIKRWLEHSPL  427



>ref|XP_010028347.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55081.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=487

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR++NY+ +Y WAN++ VQ AL +R GT+ +W RCN +L+          Y  ++ +T
Sbjct  336  NWCRNENYVLSYVWANDQSVQDALHIRNGTIPDWTRCNKSLA----------YEDDLNST  385

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YH        R L+YSGDHDM++P+V+TEKWI SL + V DDWRPWFV+ Q+AGYT K
Sbjct  386  VPYHYELIEAGYRALVYSGDHDMLIPYVATEKWIHSLNMTVVDDWRPWFVDGQIAGYTFK  445

Query  378  YSQKEYE-LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +    + + YATVKGAGHTAPEYKPR+CL M  RWLS YPL
Sbjct  446  STINLGDGMAYATVKGAGHTAPEYKPRQCLEMADRWLSHYPL  487



>emb|CBI22421.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   +LF+Y WAN++ VQKALG+REGT+ EW+RCN++L+          Y  +V +TV 
Sbjct  441  CRLYKFLFSYIWANDRRVQKALGIREGTIPEWVRCNNSLA----------YTHDVFSTVA  490

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            Y +    K    LIYSGDHDM+VPH+ T++WI SL + +  DW PWFV+ QVAG++++YS
Sbjct  491  YIQKLHEKGYGGLIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYS  550

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +  +T+ATVKG GHTAPEYKP+ECL MI RWL+ YPL
Sbjct  551  NSKRGMTFATVKGGGHTAPEYKPKECLAMIYRWLAYYPL  589



>ref|XP_009343180.1| PREDICTED: serine carboxypeptidase-like 1 [Pyrus x bretschneideri]
Length=470

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 115/161 (71%), Gaps = 9/161 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCRD NY+F+  WAN++ VQ AL V+EG++ +W+RCN +L         ++ + +V +++
Sbjct  318  WCRDYNYIFSEIWANDRTVQDALHVQEGSIEDWVRCNKSLE--------DSNINDVSSSL  369

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVL+YSGDHDM+VP+V T  WIE+L + V+  WRPWFV  Q+AGY+++Y
Sbjct  370  VYHENLIKRGYRVLVYSGDHDMVVPYVGTLAWIEALNLTVDSRWRPWFVSGQIAGYSVQY  429

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S    Y+LT+ T+KGAGHTAPEYKP ECL MI RW + YPL
Sbjct  430  SHITNYKLTFTTIKGAGHTAPEYKPEECLAMISRWFAYYPL  470



>gb|KCW55068.1| hypothetical protein EUGRSUZ_I010391, partial [Eucalyptus grandis]
Length=375

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WAN++ VQ+AL +REGT  EW RCN +LS          Y  +V N+V
Sbjct  225  WCRNYNYLYSYIWANDRNVQEALHIREGTKPEWDRCNESLS----------YTKDVLNSV  274

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR  +  S R LIYSGDHD+ +P++ T  WI SL + +   W PWFV  QVAGY++ Y
Sbjct  275  VYHRYLSKTSLRALIYSGDHDLAIPYIGTLDWIRSLNLTLLGPWAPWFVNGQVAGYSILY  334

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  +Y+LTY T+KG GHTAPEYKP+EC  M+ RW S YPL
Sbjct  335  SKNNKYDLTYTTIKGGGHTAPEYKPKECFSMVDRWFSYYPL  375



>ref|XP_006368060.1| PREDICTED: serine carboxypeptidase 1-like [Solanum tuberosum]
Length=120

 Score =   173 bits (439),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  597  ERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRP  418
            ER+E+Y ++V + +DYHR  TNKSCR LIYSGDHDMIVPH+STE+WI +LK+ +  DW P
Sbjct  7    ERTESYAYDVPSAIDYHRHLTNKSCRALIYSGDHDMIVPHLSTEEWINTLKLPIASDWEP  66

Query  417  WFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            WF++ QVAGY +KY Q +YELTYATVKGAGH APE+KP +CLPM+ RW S  PL
Sbjct  67   WFIDGQVAGYKVKYLQNDYELTYATVKGAGHNAPEFKPEQCLPMLDRWCSGDPL  120



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 12/162 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL +Y W N++ VQ+AL VR GT+  W RCN TL           Y  NV +TV
Sbjct  340  WCRNYNYLLSYIWENDEAVQEALHVRNGTIPFWKRCNKTLD----------YDSNVVSTV  389

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+ ++   R LIYSGDHDM++P+V TE+W++SL + V + W PWFV+ QVAGY++ Y
Sbjct  390  PYHRNLSDLGYRALIYSGDHDMLIPYVGTERWVKSLNISVLNGWEPWFVDGQVAGYSVVY  449

Query  375  --SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              ++ E ++TYATVKG GHTAPE++P++CL MI RWL+ YPL
Sbjct  450  QANKTESDITYATVKGGGHTAPEFRPKQCLAMIDRWLAFYPL  491



>ref|XP_003571685.1| PREDICTED: serine carboxypeptidase-like 17 [Brachypodium distachyon]
Length=467

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 110/159 (69%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CRD  Y  +  WANN  V+ ALGV +GT+  WLRCNH   G P       Y  +++++V+
Sbjct  322  CRDAGYRLSSIWANNGAVRAALGVHKGTVPLWLRCNH---GTP-------YTKDIRSSVE  371

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHRS T++  R LIYSGDHDM+VP V T+ WI SL   V+D+WRPW+V  QVAG+T  YS
Sbjct  372  YHRSLTSRGYRSLIYSGDHDMVVPFVGTQAWIRSLGFSVQDEWRPWYVNAQVAGFTRTYS  431

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEYKP+ECL M+ RWLS +PL
Sbjct  432  NN---LTFATVKGGGHTAPEYKPKECLDMVARWLSGHPL  467



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 12/162 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL +Y W N++ VQ+AL VR GT+  W RCN TL           Y  NV +TV
Sbjct  356  WCRNYNYLLSYIWENDEAVQEALHVRNGTIPFWKRCNKTLD----------YDSNVVSTV  405

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+ ++   R LIYSGDHDM++P+V TE+W++SL + V + W PWFV+ QVAGY++ Y
Sbjct  406  PYHRNLSDLGYRALIYSGDHDMLIPYVGTERWVKSLNISVLNGWEPWFVDGQVAGYSVVY  465

Query  375  --SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              ++ E ++TYATVKG GHTAPE++P++CL MI RWL+ YPL
Sbjct  466  QANKTESDITYATVKGGGHTAPEFRPKQCLAMIDRWLAFYPL  507



>ref|XP_011100013.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 115/160 (72%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY  +Y WANN+ VQ+AL +R+GT+++W RCN +LS          Y  +V +  
Sbjct  318  WCRNYNYAASYVWANNETVQEALQIRQGTISDWKRCNKSLS----------YEQDVVSVF  367

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             +H+  ++K  + L YSGDHDM VP++ST KWI +L + +++DWR W V+ QVAGYTMKY
Sbjct  368  KHHQLLSDKGFQALAYSGDHDMEVPYMSTLKWIRNLNLTLDEDWRSWTVDGQVAGYTMKY  427

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               + ELT+ATVKGAGHTA  YKP+ECL MI+RWLS+YPL
Sbjct  428  KNNQAELTFATVKGAGHTASAYKPKECLAMIKRWLSLYPL  467



>ref|XP_007199857.1| hypothetical protein PRUPE_ppa006297mg [Prunus persica]
 gb|EMJ01056.1| hypothetical protein PRUPE_ppa006297mg [Prunus persica]
Length=418

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 107/157 (68%), Gaps = 10/157 (6%)
 Frame = -1

Query  726  DDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYH  547
            +D   +A  W N+  V+KAL +REGT  EW +CN T            Y F+V ++VDYH
Sbjct  272  EDRIRYAVLWQNDINVRKALNIREGTKGEWAKCNKT----------TPYTFDVPSSVDYH  321

Query  546  RSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK  367
            R+ + K  R ++YSGDHD+ +P++ST  WIESL + +EDDW+PWF + QVAGYTM YS  
Sbjct  322  RNLSQKHLRAIVYSGDHDITIPYISTLAWIESLNLTLEDDWKPWFSDHQVAGYTMYYSNN  381

Query  366  EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            EY LTYAT+KG GHTAPEY P+EC  MI RWL+  PL
Sbjct  382  EYNLTYATIKGGGHTAPEYNPKECFDMINRWLAHSPL  418



>ref|XP_008236347.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=536

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 10/162 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKN  562
            WCR   YL +Y WAN+K VQ+AL ++E  G++ EW RCN TL         E Y+ +V +
Sbjct  383  WCRSYTYLLSYIWANDKTVQEALHIQENQGSIKEWERCNKTLQ--------EFYISDVSS  434

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            ++ YH +   +  RVL+YSGDHDM +P+V+T  WIESL + V+  W+PWFV+ QVAGY +
Sbjct  435  SLVYHENLIKQGYRVLVYSGDHDMDIPYVATMAWIESLNLTVDSRWKPWFVDGQVAGYRV  494

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +YS K+Y+LTY T+KGAGHTAPEYKP EC  MI RW + YPL
Sbjct  495  QYSDKKYQLTYTTIKGAGHTAPEYKPEECHAMISRWFAYYPL  536



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 12/162 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL +Y W N++ VQ+AL VR GT+  W RCN TL           Y  NV +TV
Sbjct  348  WCRNYNYLLSYIWENDEAVQEALHVRNGTIPFWKRCNKTLD----------YDSNVVSTV  397

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+ ++   R LIYSGDHDM++P+V TE+W++SL + V + W PWFV+ QVAGY++ Y
Sbjct  398  PYHRNLSDLGYRALIYSGDHDMLIPYVGTERWVKSLNISVLNGWEPWFVDGQVAGYSVVY  457

Query  375  --SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              ++ E ++TYATVKG GHTAPE++P++CL MI RWL+ YPL
Sbjct  458  QANKTESDITYATVKGGGHTAPEFRPKQCLAMIDRWLAFYPL  499



>ref|XP_010065879.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW63577.1| hypothetical protein EUGRSUZ_G01201 [Eucalyptus grandis]
Length=465

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+ +Y+WAN++ VQ+AL VR GT+ +W RCN ++S          Y ++++  +
Sbjct  316  WCRVYNYMLSYTWANDRAVQEALHVRPGTIRKWARCNESIS----------YEYSIREVI  365

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH+    +  R LIYSGDHDM +P+V T  WIE+L + V +DW+ WFV+ QVAGYT  Y
Sbjct  366  DYHKELLKRGYRALIYSGDHDMAIPYVGTLAWIETLNLTVSEDWQAWFVDGQVAGYTTVY  425

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S  E  LTYATVKG GHTAPEYKP+EC  MI RW + Y L
Sbjct  426  SYGEAYLTYATVKGGGHTAPEYKPKECFAMIDRWFAYYYL  465



>ref|XP_010028345.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55077.1| hypothetical protein EUGRSUZ_I01042 [Eucalyptus grandis]
Length=464

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 112/161 (70%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+++Y WAN++ V++ALGVREGT  EW RC+ TLS          Y  +V + V
Sbjct  314  WCRSYNYIYSYIWANDEKVREALGVREGTTQEWTRCSSTLS----------YTKDVLDAV  363

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH   + K+ R L+YSGDHD+ +P+++T  WI SL + +E  W PWFVE Q+AGY++ Y
Sbjct  364  VYHEYLSEKTLRALVYSGDHDLAIPYMATLNWIRSLNLTLEGSWSPWFVEGQIAGYSILY  423

Query  375  -SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                +Y+LT+ T+KGAGHTAPEYKP++CL M+ RW S YPL
Sbjct  424  LKNSKYDLTFTTIKGAGHTAPEYKPKQCLAMVDRWFSYYPL  464



>ref|XP_010028339.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=464

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WAN++ VQ+AL +REGT  EW RCN +LS          Y  +V N+V
Sbjct  314  WCRNYNYLYSYIWANDRNVQEALHIREGTKPEWDRCNESLS----------YTKDVLNSV  363

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR  +  S R LIYSGDHD+ +P++ T  WI SL + +   W PWFV  QVAGY++ Y
Sbjct  364  VYHRYLSKTSLRALIYSGDHDLAIPYIGTLDWIRSLNLTLLGPWAPWFVNGQVAGYSILY  423

Query  375  SQ-KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  +Y+LTY T+KG GHTAPEYKP+EC  M+ RW S YPL
Sbjct  424  SKNNKYDLTYTTIKGGGHTAPEYKPKECFSMVDRWFSYYPL  464



>ref|XP_008238303.1| PREDICTED: putative serine carboxypeptidase-like 52 [Prunus mume]
Length=210

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 110/156 (71%), Gaps = 10/156 (6%)
 Frame = -1

Query  717  YLFAYSWANNKIVQKALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
            YL +Y WAN+K VQ+AL ++E  G++ EW  CN TL         + Y+ +V +++ YH 
Sbjct  63   YLLSYIWANDKTVQEALHIQENQGSIKEWEICNKTLH--------DLYISDVSSSLVYHE  114

Query  543  SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
            +   +  RVLIYSGDHDM +P++ST  WIESL + V+  W+PWF+  QVAGY + YS K+
Sbjct  115  NLIKQGYRVLIYSGDHDMNIPYLSTMGWIESLNLTVDSRWKPWFLHGQVAGYRVLYSDKK  174

Query  363  YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+LTY T+KGAGHTAPEYKP ECL MI RWL+ YPL
Sbjct  175  YQLTYTTIKGAGHTAPEYKPEECLAMITRWLAYYPL  210



>ref|XP_007201023.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
 gb|EMJ02222.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
Length=462

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR +   ++  WAN+  V KAL +REGT  EW RCN ++           Y+ +V+++
Sbjct  312  QLCRVERQRYSEVWANDINVPKALNIREGTKAEWARCNSSIP----------YIKDVRSS  361

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            VDYHR+   KS R  +YSGDHD+ VPH+STE WIESL + + DDW+PWF  +QVAGY + 
Sbjct  362  VDYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVDDWKPWFSNNQVAGYRVG  421

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL   PL
Sbjct  422  YSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWLEHSPL  462



>gb|EYU37560.1| hypothetical protein MIMGU_mgv1a005845mg [Erythranthe guttata]
Length=468

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ NY  +Y WANN+ VQ+AL +R+GT+ +W RCN +LS          Y ++V++ ++
Sbjct  320  CRNYNYASSYVWANNETVQEALHIRKGTIPDWKRCNKSLS----------YEYDVESVLE  369

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
             HR  + K  + L YSGDHDM +P++ST KWI  L + V+DDWRPW    QVAGYT KY 
Sbjct  370  DHRLLSEKGFQALAYSGDHDMSIPYMSTLKWIRELNLTVDDDWRPWTANGQVAGYTQKYK  429

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +  +T+ATVKGAGHTAPEYKP+EC  M +RWLS+YPL
Sbjct  430  NNQAYITFATVKGAGHTAPEYKPKECFAMFERWLSLYPL  468



>ref|XP_011457832.1| PREDICTED: serine carboxypeptidase-like 17 [Fragaria vesca subsp. 
vesca]
Length=471

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 113/160 (71%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +CR+ NY+ AY WAN+  V+KAL VREG++ +W RCN +LS          Y  +V++ +
Sbjct  322  YCRNFNYMLAYVWANDDGVRKALNVREGSLLDWKRCNKSLS----------YTKDVESVI  371

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            +YH+  + K  +VLI++GDHD+ VP+ +TE+WI  L + V +DWRPW V+ Q+AGYT+KY
Sbjct  372  EYHKYLSTKGLQVLIFNGDHDLTVPNTATEQWIRDLDLPVVNDWRPWLVDGQIAGYTIKY  431

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S   Y LTYATVKGAGH+APEYK REC  M  R++  YPL
Sbjct  432  SSNGYRLTYATVKGAGHSAPEYKRRECYIMFDRFIHYYPL  471



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ NY  +Y WANN+ VQ+AL +R+GT+ +W RCN +L          TY ++V++ ++
Sbjct  315  CRNYNYASSYVWANNESVQEALHIRKGTIPDWKRCNTSL----------TYEYDVESVLE  364

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
             HR  + K  + L YSGDHDMI+P++ST KWI  L + V+D+WRPW    QVAGYT KY 
Sbjct  365  DHRLLSEKGFQALAYSGDHDMIIPYMSTLKWIRELNLTVDDEWRPWTANGQVAGYTEKYK  424

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +  +T+ATVKGAGHTAPEYKP+EC  M +RWLS+YPL
Sbjct  425  NNQAYITFATVKGAGHTAPEYKPKECFVMFERWLSLYPL  463



>ref|XP_010046975.1| PREDICTED: serine carboxypeptidase-like 17 [Eucalyptus grandis]
 gb|KCW78695.1| hypothetical protein EUGRSUZ_C00147 [Eucalyptus grandis]
Length=504

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCRD NY+ +  WAN+K V+ ALGVREGT   W RCN +L+          Y  +V ++
Sbjct  354  HWCRDYNYVLSAIWANDKTVRAALGVREGTKGVWNRCNSSLA----------YTKSVTSS  403

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YH++ +  + R LIYSGDHDM V HV T+ WI SL + + D WRPWFV+ Q+AGYT +
Sbjct  404  VGYHQNLSTTNLRALIYSGDHDMSVTHVGTQNWIYSLNLTLYDVWRPWFVDGQIAGYTQE  463

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   ++ L YAT+KGAGH APEYKP++C  M+ RWL+ YPL
Sbjct  464  FINDDFTLDYATIKGAGHVAPEYKPKQCYEMLDRWLAYYPL  504



>ref|XP_010028342.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Eucalyptus 
grandis]
Length=430

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WAN++ VQ+AL +REGT  EW RCN +LS          Y  +V N+V
Sbjct  280  WCRNYNYLYSYIWANDRNVQEALHIREGTKPEWDRCNESLS----------YTKDVLNSV  329

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR  +  S R LIYSGDHDM +P+V T  WI SL + +   W PWFV  QVAGY+  Y
Sbjct  330  VYHRYLSKTSLRALIYSGDHDMAIPYVGTLDWIRSLNLTLLGMWSPWFVGGQVAGYSTLY  389

Query  375  -SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                +Y+LTY T+KG GHTAPEYKP+EC  M+ RW S YPL
Sbjct  390  VVGMKYDLTYTTIKGGGHTAPEYKPKECFAMVDRWFSYYPL  430



>ref|XP_010028341.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Eucalyptus 
grandis]
Length=464

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WAN++ VQ+AL +REGT  EW RCN +LS          Y  +V N+V
Sbjct  314  WCRNYNYLYSYIWANDRNVQEALHIREGTKPEWDRCNESLS----------YTKDVLNSV  363

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR  +  S R LIYSGDHDM +P+V T  WI SL + +   W PWFV  QVAGY+  Y
Sbjct  364  VYHRYLSKTSLRALIYSGDHDMAIPYVGTLDWIRSLNLTLLGMWSPWFVGGQVAGYSTLY  423

Query  375  -SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                +Y+LTY T+KG GHTAPEYKP+EC  M+ RW S YPL
Sbjct  424  VVGMKYDLTYTTIKGGGHTAPEYKPKECFAMVDRWFSYYPL  464



>ref|XP_010682455.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=335

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ +Y+ +Y+WAN+  VQ+AL VREGT+  W+RCN +LS          Y  +V++++ 
Sbjct  187  CRNQHYMLSYTWANDVDVQEALHVREGTVDLWVRCNRSLS----------YTLSVRSSIS  236

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR+F     R LIYSGD D  +P+V + +WI  L++  +  W PWFV  QVAGY  +Y 
Sbjct  237  YHRNFAKTLLRALIYSGDQDAAIPYVDSLEWINQLELSTDTHWNPWFVNGQVAGYVTEYL  296

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  Y LT+ T+KG GHTAPEYKPRECL MI RWL++ PL
Sbjct  297  RFPYRLTFTTIKGGGHTAPEYKPRECLAMIDRWLNLSPL  335



>dbj|BAO04189.1| hypothetical protein, partial [Delphinium grandiflorum]
 dbj|BAO04190.1| hypothetical protein, partial [Delphinium grandiflorum]
Length=292

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 12/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +Y WAN+K VQKAL +R+ T+ EW+RCN         +    Y+++  +++ 
Sbjct  146  CRSYGYMLSYYWANDKEVQKALHIRKDTVPEWIRCN---------QEGLNYLYDNISSIG  196

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   + K CR LIYSGDHD +VP +STE WI SL   + DDWRPWFV  QVAGYT  Y+
Sbjct  197  YHLYLSRKGCRSLIYSGDHDFLVPFLSTETWITSLNYSITDDWRPWFVGGQVAGYTRSYA  256

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 +T+ATVKGAGHTAPEYKP EC  M+++WLS  PL
Sbjct  257  NN---MTFATVKGAGHTAPEYKPYECFSMMKKWLSYEPL  292



>gb|KDP35358.1| hypothetical protein JCGZ_10342 [Jatropha curcas]
Length=485

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+ +  WAN+K V+ AL VRE T   W RCN TL+          Y  +V +TV
Sbjct  336  WCREYNYVLSGVWANDKAVRDALQVRENTTNVWKRCNATLA----------YTKDVLSTV  385

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYHR+ + +S R LIYSGDHDM V H+ T+ WI  L +   + WRPWFV+ QVAGYT KY
Sbjct  386  DYHRNLSKQSLRALIYSGDHDMSVTHIGTQNWIHLLNLTTNEYWRPWFVDGQVAGYTEKY  445

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               +Y L +ATVKG GH APEYKP+EC  MI R+L+ +PL
Sbjct  446  LNGDYTLIFATVKGGGHVAPEYKPKECYSMIDRFLAYFPL  485



>ref|XP_011003871.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=472

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+   +WAN++ V+ AL VR GT+T W RCN  L       +   Y +NV   V
Sbjct  320  WCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRCNSFL-------QDVLYTYNVFTAV  372

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  373  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  432

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +     LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  433  TDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  472



>ref|XP_011045684.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=472

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+   +WAN++ V+ AL VR GT+T W RCN  L       +   Y +NV   V
Sbjct  320  WCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRCNSFL-------QDVLYTYNVFTAV  372

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  373  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  432

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +     LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  433  TDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  472



>ref|XP_010065814.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW63480.1| hypothetical protein EUGRSUZ_G01113 [Eucalyptus grandis]
Length=482

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++ +YL    W N   VQ ALGVR+GT++E+ RCN +LS          Y  +V N +
Sbjct  333  WCKNFDYLLVDIWGNYPGVQDALGVRQGTVSEFFRCNISLS----------YTVDVNNVL  382

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T+   +VL++SGDHDM++PH   E WI+ L +  + DWRPWFV+ QVAGYT KY
Sbjct  383  DYHKNLTSLGMQVLVFSGDHDMVIPHNGIETWIKWLDLTTDVDWRPWFVDGQVAGYTEKY  442

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYAT+KG+GH+ PEYK REC  M +RW+  YPL
Sbjct  443  TDGGYRLTYATIKGSGHSPPEYKRRECYKMFERWIHYYPL  482



>ref|XP_008236276.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Prunus 
mume]
Length=395

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 104/156 (67%), Gaps = 10/156 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR +   ++  WAN+  V+KAL +REGT  EW RCN ++           Y+ +V ++
Sbjct  246  QLCRVERQRYSEVWANDMNVRKALNIREGTKAEWARCNSSIP----------YIKDVHSS  295

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YHR+   KS R  +YSGDHD+ VPH+STE WIESL + + DDW+PWF  +QVAGY + 
Sbjct  296  VYYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVDDWKPWFSNNQVAGYRVG  355

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL
Sbjct  356  YSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWL  391



>ref|XP_011045683.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=473

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+   +WAN++ V+ AL VR GT+T W RCN  L       +   Y +NV   V
Sbjct  321  WCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRCNSFL-------QDVLYTYNVFTAV  373

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  374  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  433

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +     LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  434  TDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  473



>ref|XP_011003870.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=473

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+   +WAN++ V+ AL VR GT+T W RCN  L       +   Y +NV   V
Sbjct  321  WCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRCNSFL-------QDVLYTYNVFTAV  373

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  374  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  433

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +     LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  434  TDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  473



>ref|XP_010656847.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Vitis 
vinifera]
Length=381

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C + NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV
Sbjct  231  FCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTV  281

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W  + QVAGYT  +
Sbjct  282  AYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETF  341

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  342  TNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  381



>ref|XP_011100014.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = -1

Query  720  NYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRS  541
            NY  +Y WANN+ VQ+AL +R+GT+++W RCN +LS          Y  +V +   +H+ 
Sbjct  272  NYAASYVWANNETVQEALQIRQGTISDWKRCNKSLS----------YEQDVVSVFKHHQL  321

Query  540  FTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEY  361
             ++K  + L YSGDHDM VP++ST KWI +L + +++DWR W V+ QVAGYTMKY   + 
Sbjct  322  LSDKGFQALAYSGDHDMEVPYMSTLKWIRNLNLTLDEDWRSWTVDGQVAGYTMKYKNNQA  381

Query  360  ELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            ELT+ATVKGAGHTA  YKP+ECL MI+RWLS+YPL
Sbjct  382  ELTFATVKGAGHTASAYKPKECLAMIKRWLSLYPL  416



>ref|XP_002300184.2| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
 gb|EEE84989.2| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
Length=452

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+    WAN++ V+ AL VR GT+T W  CN  L       +   Y +NV   V
Sbjct  300  WCQNFEYVLVDVWANDERVRDALHVRRGTVTTWYTCNSFL-------QDVLYTYNVFTAV  352

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  353  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  412

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   + LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  413  TDYGFRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  452



>ref|XP_010040884.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=456

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 104/160 (65%), Gaps = 20/160 (13%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ +YL+ Y WAN+K          GT TEW+RCN           S +Y  +V  + 
Sbjct  317  WCRNYDYLYCYVWANDK----------GTKTEWIRCN----------ESSSYAHDVIKST  356

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T K  R LIYSGDHDM+VP++ T  WIE+L + +  DW  WFV+ QVAGYT +Y
Sbjct  357  DYHQNLTEKKLRALIYSGDHDMVVPYIGTMAWIETLNLSLSTDWEAWFVDGQVAGYTQQY  416

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                YELTYATVKGAGHTAPEYKP+E L MI RW + YPL
Sbjct  417  EHDNYELTYATVKGAGHTAPEYKPKETLAMIYRWFAHYPL  456



>gb|KDP40909.1| hypothetical protein JCGZ_24908 [Jatropha curcas]
Length=472

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ +Y     WANNK VQ AL VR GT+ EW RCN++L+         TY +N+ +  
Sbjct  320  WCRNFDYKLLDIWANNKTVQDALHVRNGTIKEWYRCNNSLA-------HNTYTYNIGSAA  372

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ TN   +VL+YSGDHD++VP+ ST +WIE L + V+  WRPWFV+ QVAGYT++ 
Sbjct  373  DYYQNLTNSGIQVLLYSGDHDLVVPYTSTLEWIEDLNLTVDYAWRPWFVDGQVAGYTLRN  432

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                + +T+AT+KGAGH+  EYKP EC  M +RW+  YPL
Sbjct  433  EYHGFRITFATLKGAGHSPTEYKPVECYKMFERWIHYYPL  472



>ref|XP_010682454.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ +Y+ +Y+WAN+  VQ+AL VREGT+  W+RCN +LS          Y  +V++++ 
Sbjct  311  CRNQHYMLSYTWANDVDVQEALHVREGTVDLWVRCNRSLS----------YTLSVRSSIS  360

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR+F     R LIYSGD D  +P+V + +WI  L++  +  W PWFV  QVAGY  +Y 
Sbjct  361  YHRNFAKTLLRALIYSGDQDAAIPYVDSLEWINQLELSTDTHWNPWFVNGQVAGYVTEYL  420

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  Y LT+ T+KG GHTAPEYKPRECL MI RWL++ PL
Sbjct  421  RFPYRLTFTTIKGGGHTAPEYKPRECLAMIDRWLNLSPL  459



>ref|XP_006369794.1| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
 gb|ERP66363.1| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
Length=472

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y+    WAN++ V+ AL VR GT+T W  CN  L       +   Y +NV   V
Sbjct  320  WCQNFEYVLVDVWANDERVRDALHVRRGTVTTWYTCNSFL-------QDVLYTYNVFTAV  372

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QVAGYT+KY
Sbjct  373  DYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQVAGYTVKY  432

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   + LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  433  TDYGFRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  472



>ref|XP_003633198.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Vitis 
vinifera]
Length=450

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C + NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV
Sbjct  300  FCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTV  350

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W  + QVAGYT  +
Sbjct  351  AYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETF  410

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  411  TNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  450



>ref|XP_008236275.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=461

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 104/156 (67%), Gaps = 10/156 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR +   ++  WAN+  V+KAL +REGT  EW RCN ++           Y+ +V ++
Sbjct  312  QLCRVERQRYSEVWANDMNVRKALNIREGTKAEWARCNSSIP----------YIKDVHSS  361

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YHR+   KS R  +YSGDHD+ VPH+STE WIESL + + DDW+PWF  +QVAGY + 
Sbjct  362  VYYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVDDWKPWFSNNQVAGYRVG  421

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL
Sbjct  422  YSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWL  457



>ref|XP_003633199.2| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Vitis 
vinifera]
Length=461

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C + NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV
Sbjct  311  FCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTV  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W  + QVAGYT  +
Sbjct  362  AYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETF  421

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  422  TNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  461



>ref|XP_009375674.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 109/161 (68%), Gaps = 8/161 (5%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            QWCR DNY+F+  WAN+K V+ AL +REG++ EW RCN +L          +++ ++ ++
Sbjct  310  QWCRKDNYIFSDIWANDKAVRNALHIREGSIEEWARCNTSLQ--------TSFIHDIASS  361

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            + Y  +   +  RVL+YSGD DM VP+++T  WIESL + V   W+PW V  QVAGY ++
Sbjct  362  LIYLENLIKQGYRVLVYSGDQDMNVPYMATIAWIESLNLTVASHWKPWLVNGQVAGYRVQ  421

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+ + Y+LT+ T+KG GH APEYKP ECL M+ RW + YPL
Sbjct  422  YTHESYQLTHTTIKGGGHAAPEYKPEECLAMVSRWFAYYPL  462



>ref|XP_009382032.1| PREDICTED: serine carboxypeptidase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 12/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  YL +++WANN  V++ALG+REG++  WLRC+  L+          Y ++V +++ 
Sbjct  333  CRNYWYLLSHAWANNDTVRQALGIREGSVQIWLRCDIGLN---------NYTYDVLSSIK  383

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S T++  R L+YSGDHD+ VP + T+ WI SL   + DDWRPW VE QVAG+T  YS
Sbjct  384  YHLSLTSRGYRALVYSGDHDLTVPFLGTQAWIRSLNFSIVDDWRPWSVEGQVAGFTRSYS  443

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY+P+EC  M+QRWLS  PL
Sbjct  444  NN---LTFATVKGGGHTAPEYQPKECFAMVQRWLSGAPL  479



>ref|XP_010656846.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Vitis 
vinifera]
Length=474

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C + NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV
Sbjct  324  FCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTV  374

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W  + QVAGYT  +
Sbjct  375  AYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETF  434

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  435  TNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  474



>emb|CDP08179.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CRDD Y+ +  W N+  VQ+AL +REGT  +W RCN          RS +Y  +V +  D
Sbjct  350  CRDDTYVLSRVWMNDPTVQEALQIREGTKEQWRRCN----------RSISYDMDVASVFD  399

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH+    K  + LIYSGDHDM+VP++ T +WI  L + VEDDWRPWFV  Q+AGYT+ Y 
Sbjct  400  YHQVLIRKGYQALIYSGDHDMMVPYLGTLQWIRDLNLTVEDDWRPWFVNGQIAGYTLNYQ  459

Query  372  QKEYE--LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              E     T+ATV GAGHTAPEYKP+EC  MI RW + YPL
Sbjct  460  FNEDVCCFTFATVMGAGHTAPEYKPKECFAMIDRWFTNYPL  500



>emb|CDP08199.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CRDD Y+ +  W N+  VQ+AL +REGT  +W RCN          RS +Y  +V +  D
Sbjct  368  CRDDTYVLSRVWMNDPTVQEALQIREGTKEQWRRCN----------RSISYDMDVASVFD  417

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH+    K  + LIYSGDHDM+VP++ T +WI  L + VEDDWRPWFV  Q+AGYT+ Y 
Sbjct  418  YHQVLIRKGYQALIYSGDHDMMVPYLGTLQWIRDLNLTVEDDWRPWFVNGQIAGYTLNYQ  477

Query  372  QKEYE--LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              E     T+ATV GAGHTAPEYKP+EC  MI RW + YPL
Sbjct  478  FNEDVCCFTFATVMGAGHTAPEYKPKECFAMIDRWFTNYPL  518



>dbj|BAO04183.1| putative acyl-glucose-dependent anthocyanin acyltransferase [Delphinium 
grandiflorum]
Length=470

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 12/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +Y WAN+K VQKAL +R+ T+ EW+RCN         +    Y+++  +++ 
Sbjct  324  CRSYGYMLSYYWANDKEVQKALHIRKDTVPEWIRCN---------QEGLNYLYDNISSIG  374

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   + K CR LIYSGDHD +VP +STE WI SL   + DDWRPWFV  QVAGYT  Y+
Sbjct  375  YHLYLSRKGCRSLIYSGDHDFLVPFLSTETWITSLNYSITDDWRPWFVGGQVAGYTRSYA  434

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 +T+ATVKGAGHTAPEYKP EC  M+++WLS  PL
Sbjct  435  N---NMTFATVKGAGHTAPEYKPYECFSMMKKWLSYEPL  470



>ref|XP_010065870.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Eucalyptus 
grandis]
Length=441

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+RCN TLS          Y  N    +
Sbjct  292  WCRNYNYLYIYIWASAKVVRDALHIREGTVEKWVRCNKTLS----------YTSNFLVVI  341

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  RVLIYSGDHDM++P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  342  DIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  401

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            S      T+ TVKGAGHTAPEYKP+EC  +I RW 
Sbjct  402  SSFPSLFTFVTVKGAGHTAPEYKPKECFALISRWF  436



>ref|XP_008349845.1| PREDICTED: serine carboxypeptidase-like 18 [Malus domestica]
Length=420

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 105/167 (63%), Gaps = 16/167 (10%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            Q CR+D   +A  WAN+  V+KA  +REGT  EW  CN T            Y F+V ++
Sbjct  264  QLCREDRIRYAVLWANDXNVRKAXNIREGTKGEWAXCNKTTP----------YTFDVPSS  313

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
             +YH   + KS R L+YSGDHDM +P+VST  WIESL + +EDDW+PWF + QVAGYT+ 
Sbjct  314  FEYHXXLSKKSLRALVYSGDHDMSIPYVSTLAWIESLNLTLEDDWKPWFSDHQVAGYTIY  373

Query  378  YSQKEYELTYATVKGA------GHTAPEYKPRECLPMIQRWLSIYPL  256
            +S KEY LTYAT+K        GHTAPEY P+EC  M  RWL   P+
Sbjct  374  HSNKEYNLTYATIKACPITSVRGHTAPEYNPKECFDMFNRWLGHSPI  420



>ref|XP_010939013.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=456

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y WAN+ I +KAL +++GT+ EW RCN  L+          Y  ++ N ++
Sbjct  311  CRSYAYFLSYYWANSNITRKALHIKKGTVREWQRCNSDLA----------YAKDIPNNIN  360

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S TNK  R L+YSGDHD++VP V T+ WI SL   V D+WR W V  QVAGYT  +S
Sbjct  361  YHLSLTNKGYRALVYSGDHDLVVPFVGTQAWIRSLNFSVVDEWRSWHVGGQVAGYTTAFS  420

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATV+GAGHTAPEYKP ECL M+QRW+S  PL
Sbjct  421  NN---LTFATVRGAGHTAPEYKPEECLAMLQRWISSRPL  456



>gb|KCW63605.1| hypothetical protein EUGRSUZ_G01232, partial [Eucalyptus grandis]
Length=428

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC+  +Y     W N   VQ+AL VR GT++++ RCN++L+          Y  +V + +
Sbjct  278  WCKYFDYYLVDVWGNYPGVQEALHVRPGTVSDFFRCNNSLAA---------YTEDVDDVL  328

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ TN   +VL++SGDHDM +PH   E+WI+ L + ++ DWRPWFV+ QVAGYT KY
Sbjct  329  DYHKNLTNLGMQVLVFSGDHDMFIPHNGIEEWIKWLNLTIDTDWRPWFVDGQVAGYTRKY  388

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYAT+KGAGH++PEYK REC  M QRW+  YPL
Sbjct  389  TDDGYRLTYATLKGAGHSSPEYKRRECYKMFQRWIHYYPL  428



>ref|XP_010065869.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63572.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=470

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+RCN TLS          Y  N    +
Sbjct  321  WCRNYNYLYIYIWASAKVVRDALHIREGTVEKWVRCNKTLS----------YTSNFLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  RVLIYSGDHDM++P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            S      T+ TVKGAGHTAPEYKP+EC  +I RW 
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALISRWF  465



>emb|CBI17848.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C + NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV
Sbjct  413  FCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTV  463

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W  + QVAGYT  +
Sbjct  464  AYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETF  523

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  524  TNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  563



>ref|XP_010065871.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Eucalyptus 
grandis]
Length=470

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WA+++ VQ AL +REGT+ +W+RCN TLS          Y  NV   +
Sbjct  321  WCREYNYLYSYIWASDRAVQDALHIREGTVEKWVRCNKTLS----------YTSNVLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  R LIYSGDHDM+ P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRALIYSGDHDMVFPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            S      T+ TVKGAGHTAPEYKP+EC  +I RW 
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALISRWF  465



>ref|XP_002460078.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
 gb|EER96599.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
Length=457

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +  WANN  V++ALG+ +GT+  WLRCN          +  TYV +++++V 
Sbjct  312  CRTMLYTLSRLWANNATVREALGIHKGTVPLWLRCN----------KGITYVKDIQSSVK  361

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T K  R L+YSGDHDM VP++ T+ WI SL   V DDWRPW+V+ QVAGYT  YS
Sbjct  362  YHLDVTTKGYRSLVYSGDHDMAVPYIGTQSWIRSLNFSVVDDWRPWYVDGQVAGYTTLYS  421

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY PR+CL M+ RWL+  PL
Sbjct  422  NN---LTFATVKGAGHTAPEYMPRQCLAMLSRWLAGLPL  457



>ref|XP_010094886.1| Serine carboxypeptidase-like 18 [Morus notabilis]
 gb|EXB57415.1| Serine carboxypeptidase-like 18 [Morus notabilis]
Length=427

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 11/150 (7%)
 Frame = -1

Query  702  SWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSC  523
            +W N K V+K+L VRE T T W RCN          RS  Y F+V+++V YHR+ T K  
Sbjct  288  NWGNKKEVKKSLKVREETKTTWTRCN----------RSIPYTFDVQSSVVYHRNLTKKFL  337

Query  522  RVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVE-DQVAGYTMKYSQKEYELTYA  346
            R LIYSGDHDM+VP+ ST +WIESL + ++ DWRPWF +  +V GYTMKY+ K+Y+LTYA
Sbjct  338  RALIYSGDHDMVVPYFSTIEWIESLGLAIDYDWRPWFSDHHEVLGYTMKYTNKKYQLTYA  397

Query  345  TVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            T+KG GHTAP+Y P EC  M  RWL+ YPL
Sbjct  398  TIKGGGHTAPQYYPEECFRMFDRWLAHYPL  427



>ref|XP_010065819.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW63481.1| hypothetical protein EUGRSUZ_G01114 [Eucalyptus grandis]
Length=482

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 105/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  YL    W N   VQ AL VR GT++E+ RCN +L+          Y  +V N +
Sbjct  333  WCRNIEYLLVVIWGNYPGVQDALHVRPGTVSEFFRCNISLA----------YTEDVDNVL  382

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T+   +VL++SGDHD ++PH   E+WI+ L + V+ DWRPWFV+ QVAGYT KY
Sbjct  383  DYHKNLTSLGMQVLVFSGDHDFVIPHNGIEEWIKWLDLTVDIDWRPWFVDGQVAGYTRKY  442

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYAT+KGAGH+ PEYK REC  M  RW+  YPL
Sbjct  443  TDSGYRLTYATIKGAGHSPPEYKRRECYEMFHRWIHYYPL  482



>ref|XP_002522137.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40337.1| serine carboxypeptidase, putative [Ricinus communis]
Length=479

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 11/160 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR+ NY+ +Y WAN++ VQ AL VR  T+ +W RCN +L+          Y +N+ +T
Sbjct  328  NWCRNANYVLSYIWANDEDVQNALHVRNDTIMDWKRCNKSLA----------YSYNMLST  377

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V YH+       R L+YSGDHDM++P+  T  WI +L +   D+WRPWFVE QVAG+T+K
Sbjct  378  VFYHKELIMNGYRALVYSGDHDMLIPYTGTVHWIHTLNLTTVDEWRPWFVEGQVAGFTVK  437

Query  378  YSQKEYE-LTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            Y+    + L +ATVKGAGHTAPEYKP+EC  M+ RWLS Y
Sbjct  438  YAHNIGDGLVFATVKGAGHTAPEYKPKECFAMVDRWLSYY  477



>ref|XP_009343914.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 108/161 (67%), Gaps = 8/161 (5%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            QWCR DNY+F+  WAN+K V+ AL +REG++ EW RCN ++          +++ ++ ++
Sbjct  310  QWCRKDNYIFSDIWANDKAVRNALHIREGSIEEWARCNTSVQ--------TSFIHDIASS  361

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            + Y  +   +  RVL+YSGD DM VP+++T  WIESL + V   W PW V  QVAGY ++
Sbjct  362  LIYLENLIKQGYRVLVYSGDQDMNVPYMATIAWIESLNLTVASHWNPWLVNGQVAGYRVQ  421

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y+ + Y+LT+ T+KG GH APEYKP ECL M+ RW + YPL
Sbjct  422  YTHESYQLTHTTIKGGGHAAPEYKPEECLAMVSRWFAYYPL  462



>ref|XP_010065865.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW63575.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=470

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 102/155 (66%), Gaps = 10/155 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+RCN TLS          Y  NV   +
Sbjct  321  WCRNYNYLYIYIWASAKVVRDALHIREGTVEKWVRCNKTLS----------YTSNVLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  R L+YSGDHDM++P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRALVYSGDHDMVIPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
            S      T+ TVKGAGHTAPEYKP+EC  +I RW 
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALISRWF  465



>ref|XP_010936156.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=394

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL +R+GT+  W RCNH L           Y ++V +++ 
Sbjct  249  CRSSGYLLSYFWADNNTVREALNIRKGTVQHWQRCNHDLH----------YAYDVPSSLK  298

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T+   R L+YSGDHDMIVP V T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  299  FHLNLTSIGYRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYS  358

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ TVKG GH APEY+P+ECL M+QRWLS  PL
Sbjct  359  NN---LTFVTVKGGGHLAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_002266615.3| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI25147.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  +  +  WAN K VQ AL +R GT+ E+ RCN +LS          Y  NV N  
Sbjct  312  WCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFRCNSSLS----------YTENVNNVF  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   RVL++SGDHDM++PHV  E+WI+SL + +  DWRPWFV+ Q+ GYT KY
Sbjct  362  GYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKSLNISLGSDWRPWFVDGQIGGYTRKY  421

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              K Y LTY+T+KGAGH+  EY+ RE   M  RW+  YPL
Sbjct  422  VNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWIHHYPL  461



>emb|CAN78674.1| hypothetical protein VITISV_009248 [Vitis vinifera]
Length=461

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  +  +  WAN K VQ AL +R GT+ E+ RCN +LS          Y  NV N  
Sbjct  312  WCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFRCNSSLS----------YTENVNNVF  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   RVL++SGDHDM++PHV  E+WI+SL + +  DWRPWFV+ Q+ GYT KY
Sbjct  362  GYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKSLNISLGSDWRPWFVDGQIGGYTRKY  421

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              K Y LTY+T+KGAGH+  EY+ RE   M  RW+  YPL
Sbjct  422  VNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWIHHYPL  461



>gb|KDP44533.1| hypothetical protein JCGZ_16366 [Jatropha curcas]
Length=471

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            +WC + NY  +Y WAN++ VQ AL VR  T+ +W RCN +L           Y ++V + 
Sbjct  321  KWCHNFNYSLSYVWANDESVQSALNVRRKTVRDWKRCNKSLD----------YDYDVTSV  370

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            + YHR+FT K  + L+Y+GDHD  +P+V T++WI+ L + + +DWRPW V+ QVAGYT+K
Sbjct  371  ISYHRNFTTKGLQALVYNGDHDFTIPNVGTQQWIKELNLTIVNDWRPWLVDGQVAGYTIK  430

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS+  Y LTYATVKGAGH+  EYK REC  M  R++  YP+
Sbjct  431  YSENGYRLTYATVKGAGHSPQEYKRRECYDMFDRFIHYYPI  471



>ref|XP_010065873.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW63566.1| hypothetical protein EUGRSUZ_G01194 [Eucalyptus grandis]
Length=470

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 10/158 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WA++K VQ AL +REGT+  W+RCN TLS          Y  NV   +
Sbjct  321  WCRNYNYLYSYIWASDKAVQDALHIREGTIEAWVRCNKTLS----------YTSNVLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  R LIYSGDHDM++P+V T+  I++L + +  DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRALIYSGDHDMVIPYVGTQASIDTLNMTISTDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
            S     LT+ATVKGAGHTAPEYKP EC  +I RW   +
Sbjct  431  SSFPSLLTFATVKGAGHTAPEYKPEECFALISRWFDYF  468



>ref|XP_009384628.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384629.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +Y WANN  V++ALGVREGT   W+RCN+ ++          Y  +V +++ 
Sbjct  327  CRSSGYVLSYFWANNDTVREALGVREGTKQMWVRCNYGIN----------YTNDVSSSLK  376

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S T++  R L YSGDHDM VP V T+ WI SL   + DDWR WFV+ QVAG+T  YS
Sbjct  377  YHLSLTSRGYRALAYSGDHDMSVPFVGTQAWIRSLNFSIVDDWRSWFVDGQVAGFTRTYS  436

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ T+KG GHTAPEYKP+ECL M+ RW +  PL
Sbjct  437  NN---LTFVTIKGGGHTAPEYKPKECLAMVDRWFAGSPL  472



>gb|KCW63569.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=470

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 103/156 (66%), Gaps = 10/156 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL++Y WA+++ VQ AL +REGT+ +W+RCN TLS          Y  NV   +
Sbjct  321  WCREYNYLYSYIWASDRAVQDALHIREGTVEKWVRCNKTLS----------YTSNVLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  R LIYSGDHDM+ P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRALIYSGDHDMVFPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
            S      T+ TVKGAGHTAPEYKP+EC  +I RW +
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALICRWFN  466



>ref|XP_010694004.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  302  WCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA----------YEYNVESTV  351

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ T +   VLIYSGD DM + +V T  WI+ L + + +DWRPWFV DQVAGYT ++
Sbjct  352  GYHQNLTQEFIHVLIYSGDQDMKISYVGTLGWIKMLNISISEDWRPWFVNDQVAGYTTRF  411

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   PL
Sbjct  412  ANDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESRPL  451



>dbj|BAO04182.1| hypothetical protein [Delphinium grandiflorum]
Length=475

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 12/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +Y WAN+K VQKAL +R+G + EW+RCN         +    YV++VK +  
Sbjct  329  CRSYGYMLSYYWANDKEVQKALKIRKGMVQEWVRCN---------KEDLHYVYDVKASTG  379

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDMIVP++ TE WI+SL   + DDWR WFV  QVAGYT  Y+
Sbjct  380  YHLNLSRKGYRSLIYSGDHDMIVPYMGTEAWIKSLNYSIIDDWRSWFVGGQVAGYTRTYA  439

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 +T+ATVKG GHTAPEYKP ECL M++RWLS
Sbjct  440  N---NMTFATVKGGGHTAPEYKPCECLAMLKRWLS  471



>ref|XP_010936146.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=394

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WANN  V++ L + +GT+ +W RCN+ L           Y  ++ +++ 
Sbjct  249  CRSSGYLLSYFWANNDTVREVLNIHKGTVQQWQRCNYGLP----------YAHDIPSSLK  298

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDMIVP V T+ WI SL   + DDWRPW    QVAG+T  YS
Sbjct  299  FHLNLTSRGHRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYS  358

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  359  NN---LTFATVKGAGHTAPEYRPKECLVMLQRWLSGAPL  394



>gb|KDP44531.1| hypothetical protein JCGZ_16364 [Jatropha curcas]
Length=549

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+ +Y+W N+K+VQKAL +REGT+  W+RCN +L           Y  ++ ++ 
Sbjct  311  WCRTYNYIPSYAWLNDKMVQKALHIREGTIENWVRCNTSL----------LYTKDLTSSF  360

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
              HR+ T K  +VLIYSGD D+ VP +ST  WIE+L + +E DW PWF++ QVAGY M+Y
Sbjct  361  GLHRNLTEKGLKVLIYSGDQDISVPFLSTMAWIEALNLTIEYDWNPWFLDGQVAGYWMEY  420

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             +  Y LTYAT+KG GHTAPEYKP+EC  MI R
Sbjct  421  YRNMYMLTYATIKGGGHTAPEYKPKECFAMIDR  453



>ref|XP_002266867.3| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI25151.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  +  +  WAN K VQ AL +R GT+ E+ RCN +LS          Y  NV N  
Sbjct  312  WCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFRCNISLS----------YTENVNNVF  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ TN   RVL++SGDHDM++PHV  E+WI+SL + +  DWRPWFV+ Q+ GYT KY
Sbjct  362  GYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKSLNISLGSDWRPWFVDGQIGGYTRKY  421

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              K Y LTY+T+KGAGH+  EY+ RE   M  RW+  YPL
Sbjct  422  VNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWIHHYPL  461



>ref|XP_010656845.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=480

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C D  Y+ + +WANN+ V++AL VREGT   W RCN  +SG         Y  +V ++V
Sbjct  330  FCHDYMYILSETWANNRDVREALHVREGTKGYWKRCN--ISG-------LAYTEDVISSV  380

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+ +    R LIYSGDHDM VPH+ T++WI+SL + + D WR W+ E QVAGYT +Y
Sbjct  381  AYHRNLSKTGLRALIYSGDHDMSVPHIGTQQWIDSLNLTLADTWRAWYTEGQVAGYTKRY  440

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  ++ LTYATVKGAGH APEYKP++C  M++RW + Y L
Sbjct  441  TNDDFALTYATVKGAGHVAPEYKPQQCYAMLKRWFAYYQL  480



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 107/159 (67%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL +R+GT+  W RCNH L           Y +++ +++ 
Sbjct  837  CRSFGYLLSYFWADNDTVREALNIRKGTVQHWQRCNHDL----------LYTYDIPSSIK  886

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDM VP V T+ WI SL   + DDWRPW V+ QVAG+T  YS
Sbjct  887  FHLNLTSRGYRALVYSGDHDMGVPFVGTQGWIRSLNFSIVDDWRPWSVDGQVAGFTRTYS  946

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  947  NN---LTFATVKGAGHTAPEYRPKECLAMLQRWLSGAPL  982


 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL +R+GT+  W RCN  L           Y  NV +++ 
Sbjct  331  CRSSAYLLSYFWADNDTVREALNIRKGTVQHWQRCNSDL----------LYTHNVPSSLK  380

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDM+VP + T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  381  FHLNLTSRGYRALVYSGDHDMLVPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYS  440

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  441  NN---LTFATVKGAGHTAPEYRPKECLAMLQRWLSGVPL  476



>gb|EMT21721.1| Serine carboxypeptidase-like 17 [Aegilops tauschii]
Length=489

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 107/159 (67%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y  +  WANN+ V++ALGV +GT+  WLRCNH   G P       Y  ++++ V+
Sbjct  344  CREKGYSMSGIWANNRSVREALGVHKGTVPLWLRCNH---GTP-------YTTDIRSIVE  393

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +HRS T++  R LIYSGDHDM VP +ST+ WI SL   V D+WRPW+   QVAG+T  Y+
Sbjct  394  FHRSVTSRGYRSLIYSGDHDMTVPFISTQAWIRSLGFAVVDEWRPWYATGQVAGFTTLYA  453

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P+ECL M+ RWLS  P+
Sbjct  454  NN---LTFATVKGGGHTAPEYMPKECLAMVDRWLSGRPV  489



>ref|XP_010065898.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=483

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC+  +Y     W N   VQ+AL VR GT++E+ RCN++L+          Y  +V + +
Sbjct  333  WCKYFDYYLVDVWGNYPGVQEALHVRPGTVSEFFRCNNSLAA---------YTEDVDDVL  383

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T+   +VL++SGDHDM +PH   E+WI+ L + ++ DWRPWFV+ QVAGYT KY
Sbjct  384  DYHKNLTSLGMQVLVFSGDHDMFIPHNGIEEWIKWLNLTIDTDWRPWFVDGQVAGYTRKY  443

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYAT+KGAGH++PEYK REC  M QRW+  YPL
Sbjct  444  TDDGYRLTYATLKGAGHSSPEYKRRECYEMFQRWIHYYPL  483



>ref|XP_010694000.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 105/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  302  WCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNRTLA----------YEYNVRSTV  351

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ T +    LIYSGD D  V +V T  WI+ L + + +DWRPWFV DQVAGYT ++
Sbjct  352  GYHQNLTQEFLHALIYSGDQDRKVSYVGTLGWIKMLNISISEDWRPWFVNDQVAGYTTRF  411

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL  +PL
Sbjct  412  SNDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESHPL  451



>ref|XP_010028337.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55060.1| hypothetical protein EUGRSUZ_I01035 [Eucalyptus grandis]
Length=485

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY  +Y+W+N+  VQKAL VR GT+ +W RCN +L+          Y  ++++ V
Sbjct  336  WCRTFNYALSYTWSNDLRVQKALNVRPGTVMDWKRCNKSLA----------YTKDIQSVV  385

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            + H++ +     VL+  GD DM+VP V T +WI+ L + V +DWRPWFV+ QVAGYT KY
Sbjct  386  EVHKNLSTLGLEVLVECGDRDMVVPFVGTVEWIKRLNLTVVNDWRPWFVDGQVAGYTKKY  445

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  Y LTYATVKGAGHTAPEY  REC  M  RW+  YPL
Sbjct  446  SEHGYRLTYATVKGAGHTAPEYYRRECYEMFMRWVHYYPL  485



>emb|CBI17847.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 9/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C D  Y+ + +WANN+ V++AL VREGT   W RCN  +SG         Y  +V ++V
Sbjct  380  FCHDYMYILSETWANNRDVREALHVREGTKGYWKRCN--ISG-------LAYTEDVISSV  430

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YHR+ +    R LIYSGDHDM VPH+ T++WI+SL + + D WR W+ E QVAGYT +Y
Sbjct  431  AYHRNLSKTGLRALIYSGDHDMSVPHIGTQQWIDSLNLTLADTWRAWYTEGQVAGYTKRY  490

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +  ++ LTYATVKGAGH APEYKP++C  M++RW + Y L
Sbjct  491  TNDDFALTYATVKGAGHVAPEYKPQQCYAMLKRWFAYYQL  530



>gb|KDP44532.1| hypothetical protein JCGZ_16365 [Jatropha curcas]
Length=472

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y  +Y + NN+ VQ ALGVREGT+  W RC  +           TY  NV+++V 
Sbjct  323  CREFGYALSYKYMNNETVQTALGVREGTVETWSRCFKSFP---------TYTENVQSSVY  373

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
             H++ +    R L+YSGDHD+ +P+V T +WI+SL++ V D+WRPW+V+ Q+AGY  K+ 
Sbjct  374  IHKNLSKTGLRALVYSGDHDISIPYVGTLEWIKSLEIPVFDEWRPWYVDGQIAGYQTKFM  433

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             + + LTYAT+KG GHTAPEYKP ECL ++ RW + YP+
Sbjct  434  NEHFRLTYATIKGGGHTAPEYKPTECLALVDRWFARYPV  472



>ref|XP_010065817.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW63484.1| hypothetical protein EUGRSUZ_G01116 [Eucalyptus grandis]
Length=482

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  YL    W N   VQ AL VR GT++E+ RCN +L+          Y  +V N +
Sbjct  333  WCRNFEYLLVDIWGNYPGVQDALHVRPGTVSEFFRCNISLA----------YTEDVDNVL  382

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T+   +VL++SGDHD ++PH   E+WI+ L + V+ +WRPWFV+ QVAGYT KY
Sbjct  383  DYHKNLTSLGMQVLVFSGDHDFVIPHNGIEEWIKWLDLTVDIEWRPWFVDGQVAGYTRKY  442

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYAT+KGAGH+ PEYK REC  M  RW+  YPL
Sbjct  443  TDSGYRLTYATIKGAGHSPPEYKRRECYEMFHRWIHYYPL  482



>gb|KCW44823.1| hypothetical protein EUGRSUZ_L016101, partial [Eucalyptus grandis]
Length=123

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = -1

Query  654  GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
            GT TEW+RCN           S +Y  +V  + DYH++ T K  R LIYSGDHDM+VP++
Sbjct  1    GTKTEWIRCN----------ESSSYAHDVIKSTDYHQNLTEKKLRALIYSGDHDMVVPYI  50

Query  474  STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
             T  WIE+L + +  DW  WFV+ QVAGYT +Y    YELTYATVKGAGHTAPEYKP+E 
Sbjct  51   GTMAWIETLNLSLSTDWEAWFVDGQVAGYTQQYEHDNYELTYATVKGAGHTAPEYKPKET  110

Query  294  LPMIQRWLSIYPL  256
            L MI RW + YPL
Sbjct  111  LAMIYRWFAHYPL  123



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   174 bits (442),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL + +GT+  W RCNH L           Y +++ +++ 
Sbjct  827  CRSSGYLLSYFWADNDTVREALNIHKGTVQHWQRCNHDL----------LYTYDIPSSIK  876

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDM VP V T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  877  FHLNLTSRGYRALVYSGDHDMAVPFVGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYS  936

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  937  NN---LTFATVKGAGHTAPEYRPKECLAMLQRWLSGVPL  972


 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL + +GT+  W RCNH L           Y +++ +++ 
Sbjct  331  CRSSGYLLSYIWADNDTVREALNIHKGTVQHWQRCNHDL----------LYTYDIPSSIK  380

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHD+++P + T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  381  FHLNLTSRGYRALVYSGDHDLLIPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRAYS  440

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGH APEY+P+E L M+QRWLS  PL
Sbjct  441  NN---LTFATVKGAGHLAPEYRPKESLAMLQRWLSGAPL  476



>ref|XP_010237149.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=313

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 15/161 (9%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CRD+ Y+ +  WAN + V++ALGV +G++  WLRCNH +           Y  ++ ++V+
Sbjct  166  CRDEGYVMSSIWANKEEVREALGVHKGSVPLWLRCNHGIP----------YTTDILSSVE  215

Query  552  YHRSF--TNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            YHRS   +    R L+YSGDHDM+VP V T+ WI SL   + D WRPW+ + QVAG+T  
Sbjct  216  YHRSLLTSGGGYRSLVYSGDHDMVVPFVGTQAWIRSLGFAIVDQWRPWYADIQVAGFTRM  275

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS     LT+ATVKG GHTAPEYKP+ECL M+ RWLS  PL
Sbjct  276  YSNN---LTFATVKGGGHTAPEYKPKECLAMVVRWLSGRPL  313



>ref|XP_010936145.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=394

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++ L + +GT+ +W RCN+ L           Y  ++ +++ 
Sbjct  249  CRSSGYLLSYFWADNDTVREVLNIHKGTVQQWQRCNYGLP----------YAHDIPSSLK  298

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDMIVP V T+ WI SL   + DDWRPW    QVAG+T  YS
Sbjct  299  FHLNLTSRGHRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYS  358

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  359  NN---LTFATVKGAGHTAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_010694001.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 10/159 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC+D  Y   Y WAN+  V+ AL +++GT + W RCN TL+          Y  N+ + V
Sbjct  304  WCQDSIYRLFYYWANDIQVRTALDIQKGTKSHWTRCNRTLA----------YAHNLTSVV  353

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T +S   LIYSGD DM+V ++ T +WI+ L + + +DWRPWF   QVAGY  KY
Sbjct  354  DYHQNLTMESIHALIYSGDQDMVVSYLGTLEWIKMLNITIAEDWRPWFANGQVAGYITKY  413

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
            S   Y LTYATVKGAGHTAPEYK  EC  M+ +W +++P
Sbjct  414  SNDNYHLTYATVKGAGHTAPEYKRAECFTMLTKWFAMHP  452



>gb|KCW63571.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=471

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+RCN TLS          Y  N    +
Sbjct  321  WCRNYNYLYIYIWASAKVVRDALHIREGTVEKWVRCNKTLS----------YTSNFLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  RVLIYSGDHDM++P+V T+ WI++L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWIDTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
            S      T+ TVKGAGHTAPEYKP+EC  +I+++
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALIRKF  464



>emb|CAN82419.1| hypothetical protein VITISV_044004 [Vitis vinifera]
Length=398

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 9/157 (6%)
 Frame = -1

Query  726  DDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYH  547
            D  Y+ + +WANN+ V++AL VREGT   W RCN  +SG         Y  +V ++V YH
Sbjct  251  DYMYILSETWANNRDVREALHVREGTKGYWKRCN--ISGL-------AYTEDVISSVAYH  301

Query  546  RSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK  367
            R+ +    R LIYSGDHDM VPH+ T++WI+SL + + D WR W+ E QVAGYT +Y+  
Sbjct  302  RNLSKTGLRALIYSGDHDMSVPHIGTQQWIDSLNLTLADTWRAWYTEGQVAGYTKRYTND  361

Query  366  EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            ++ LTYATVKGAGH APEYKP++C  M++RW + Y L
Sbjct  362  DFALTYATVKGAGHVAPEYKPQQCYAMLKRWFAYYQL  398



>ref|XP_004983497.1| PREDICTED: serine carboxypeptidase-like 18-like [Setaria italica]
Length=486

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +  WANN  V++ALG+ +GT+  W RCN+++           Y  ++ +TV 
Sbjct  341  CRTAGYIMSSVWANNASVREALGIHKGTVPSWSRCNYSI----------PYTSDIPSTVK  390

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T K  R L+YSGDHDMI+PH+ T+ WI+SL   + D WRPWFV+ QVAG+T  YS
Sbjct  391  YHLDVTTKDYRSLVYSGDHDMIIPHIGTQAWIKSLNFSIMDHWRPWFVDGQVAGFTRSYS  450

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY PR+C  M  RW+S  PL
Sbjct  451  NN---LTFATVKGGGHTAPEYMPRQCFAMFARWISGDPL  486



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 106/159 (67%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL + +GT+ +W RCN+ L           Y  ++ +++ 
Sbjct  354  CRTSGYLLSYFWADNDTVREALNIHKGTVQQWQRCNYGLP----------YAHDIPSSLK  403

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHD++VP V T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  404  FHLNLTSRGYRALVYSGDHDLLVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYS  463

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  464  NN---LTFATVKGAGHTAPEYRPKECLVMLQRWLSGAPL  499



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++AL + +GT+ +W RCN+ L           Y  +V +++ 
Sbjct  331  CRTYGYLLSYIWADNDTVREALNIHKGTVQQWQRCNYGLP----------YAHDVPSSLK  380

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T+   R L+YSGDHDMIVP V T+ WI SL   + DDWRPW  + QVAG+T  YS
Sbjct  381  FHLNLTSIGYRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYS  440

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  441  NN---LTFATVKGAGHTAPEYRPKECLVMLQRWLSDAPL  476



>gb|KJB73511.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=470

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ N      WA++  VQ+ALG+R+GT+ EW+RCN  L           Y  +V + VD
Sbjct  325  CRNYNTYLCKIWASDDGVQQALGIRKGTIREWIRCNENL----------LYDKDVGSVVD  374

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R LIYSGDHD +VP+V TE W++SL + + DDWRPWFV+DQVAGY+ +Y 
Sbjct  375  YHLSLNTEGYRALIYSGDHDTVVPYVGTESWVKSLNLSIVDDWRPWFVDDQVAGYSREYG  434

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                  T+ATVKG GHTAPE+KP+EC  M  RW+S
Sbjct  435  NN---FTFATVKGGGHTAPEFKPKECFAMFSRWIS  466



>gb|KJB73512.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=466

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ N      WA++  VQ+ALG+R+GT+ EW+RCN  L           Y  +V + VD
Sbjct  321  CRNYNTYLCKIWASDDGVQQALGIRKGTIREWIRCNENL----------LYDKDVGSVVD  370

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R LIYSGDHD +VP+V TE W++SL + + DDWRPWFV+DQVAGY+ +Y 
Sbjct  371  YHLSLNTEGYRALIYSGDHDTVVPYVGTESWVKSLNLSIVDDWRPWFVDDQVAGYSREYG  430

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                  T+ATVKG GHTAPE+KP+EC  M  RW+S
Sbjct  431  NN---FTFATVKGGGHTAPEFKPKECFAMFSRWIS  462



>gb|EMS46782.1| Serine carboxypeptidase-like 18 [Triticum urartu]
Length=364

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +  WANN  V++ALG+ +GT+  WLRCN  +           Y  ++ ++V+
Sbjct  219  CRTAEYMLSMIWANNDTVREALGIHKGTVPSWLRCNFDIR----------YTNDIFSSVE  268

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H   T +  R LIYSGDHDMIVP + T+ WI+SL   V D+WRPW+V+ QVAGYT  YS
Sbjct  269  HHLDVTTRGYRSLIYSGDHDMIVPSIGTQAWIKSLNFSVVDEWRPWYVDAQVAGYTRSYS  328

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P++CL M  RWLS  PL
Sbjct  329  NN---LTFATVKGGGHTAPEYMPKQCLAMFARWLSGEPL  364



>ref|XP_010939017.1| PREDICTED: serine carboxypeptidase-like 12 isoform X2 [Elaeis 
guineensis]
Length=471

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y WAN+ + +KAL +++GT+ EW RCN  L           Y+ ++ N ++
Sbjct  326  CRTYAYFLSYYWANSNVTRKALHIKKGTVREWQRCNDDLG----------YIKDIPNNIN  375

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S T+K  R LIYSGDHD+++P + T+ WI SL   V D+WR W V  QVAGYT  YS
Sbjct  376  YHLSLTSKGYRALIYSGDHDLMIPFLGTQAWISSLNFSVVDEWRSWHVGGQVAGYTTTYS  435

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LT+ATVKGAGHTAPEYKP ECL M+QRW+S
Sbjct  436  NN---LTFATVKGAGHTAPEYKPEECLAMLQRWIS  467



>ref|XP_010936148.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Elaeis 
guineensis]
Length=342

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 13/158 (8%)
 Frame = -1

Query  729  RDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDY  550
            +   YL +Y WANN  V++ L + +GT+ +W RCN+ L           Y  ++ +++ +
Sbjct  198  KSSGYLLSYFWANNDTVREVLNIHKGTVQQWQRCNYGLP----------YAHDIPSSLKF  247

Query  549  HRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ  370
            H + T++  R L+YSGDHDMIVP V T+ WI SL   + DDWRPW    QVAG+T  YS 
Sbjct  248  HLNLTSRGHRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSN  307

Query  369  KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                LT+ATVKGAGHTAPEY+P+ECL M+QRWLS  PL
Sbjct  308  N---LTFATVKGAGHTAPEYRPKECLVMLQRWLSGAPL  342



>ref|XP_004296446.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY+    WAN+  V+KAL V E ++  W RCN +++          Y   V ++V
Sbjct  326  WCRYYNYVILGVWANDHAVRKALNVSENSIGVWKRCNMSIA----------YTKTVTSSV  375

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            +YH++ ++ + R LIYSGDHDM VPH+ T++WI  L +   + WRPW+V+ QVAGY+ K+
Sbjct  376  EYHKNLSDTNLRALIYSGDHDMSVPHIGTQEWIRYLNLTNSEIWRPWYVDGQVAGYSEKF  435

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S  +Y L YATVKGAGH APEYK +EC  MI RWL+ YPL
Sbjct  436  SNNDYSLQYATVKGAGHVAPEYKAKECYAMIDRWLAYYPL  475



>gb|KJB73510.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=492

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 102/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ N      WA++  VQ+ALG+R+GT+ EW+RCN  L           Y  +V + VD
Sbjct  347  CRNYNTYLCKIWASDDGVQQALGIRKGTIREWIRCNENL----------LYDKDVGSVVD  396

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R LIYSGDHD +VP+V TE W++SL + + DDWRPWFV+DQVAGY+ +Y 
Sbjct  397  YHLSLNTEGYRALIYSGDHDTVVPYVGTESWVKSLNLSIVDDWRPWFVDDQVAGYSREYG  456

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                  T+ATVKG GHTAPE+KP+EC  M  RW+S
Sbjct  457  NN---FTFATVKGGGHTAPEFKPKECFAMFSRWIS  488



>ref|XP_010939016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=498

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y WAN+ + +KAL +++GT+ EW RCN  L           Y+ ++ N ++
Sbjct  353  CRTYAYFLSYYWANSNVTRKALHIKKGTVREWQRCNDDLG----------YIKDIPNNIN  402

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S T+K  R LIYSGDHD+++P + T+ WI SL   V D+WR W V  QVAGYT  YS
Sbjct  403  YHLSLTSKGYRALIYSGDHDLMIPFLGTQAWISSLNFSVVDEWRSWHVGGQVAGYTTTYS  462

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LT+ATVKGAGHTAPEYKP ECL M+QRW+S
Sbjct  463  NN---LTFATVKGAGHTAPEYKPEECLAMLQRWIS  494



>ref|XP_004289772.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 106/162 (65%), Gaps = 11/162 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
             WCR+ NY+ +Y WAN++ VQ+AL +R GT+T+W RCN +L+          Y ++V + 
Sbjct  333  HWCRNSNYVLSYIWANDESVQEALSIRNGTITDWKRCNKSLA----------YEYDVLSV  382

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            V+YH     +  R LIYSGDHD ++P+V T  WI  L + V D WRPW+V   VAG+T K
Sbjct  383  VNYHDELIGRGYRSLIYSGDHDGLIPYVGTLAWINYLNLTVSDGWRPWYVNGNVAGFTEK  442

Query  378  YSQKEYE-LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y     + LT+AT+KGAGHTAPEY P + L M+ RWL+ YPL
Sbjct  443  YINDVSDGLTFATLKGAGHTAPEYMPEQALDMVDRWLAYYPL  484



>gb|KDP44530.1| hypothetical protein JCGZ_16363 [Jatropha curcas]
Length=467

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 110/158 (70%), Gaps = 11/158 (7%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            +WCRD   L+++ WAN+K VQ AL VREGT+TEW RCN +L           Y F+V + 
Sbjct  316  EWCRDYMLLYSHIWANDKSVQSALHVREGTITEWPRCNLSLR----------YDFDVLSV  365

Query  558  VDYHRSFTNKSC-RVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            V YHR+FT  S  RVLI+SGDHD+ +P+++T  WI++L + V  +W+PW V+ QVAG+ +
Sbjct  366  VQYHRNFTKTSAYRVLIFSGDHDLALPYLATYAWIQTLNLTVTKNWQPWLVDHQVAGHVI  425

Query  381  KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
             YS+++Y LT+A V+G  H+A E +P+EC  MI RWL+
Sbjct  426  AYSKRKYNLTFAIVQGGSHSASEIRPKECFAMIDRWLA  463



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +  WAN+  V+KAL +REGT+ EW+RCN+ ++          Y   + +T+ 
Sbjct  327  CRTYGYLLSIYWANDNSVRKALHIREGTVGEWIRCNYGIN----------YRREISSTIK  376

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H   +NK  R LIYSGDHDM+V  V T+ WI SL   + DDWRPW +E QVAGYT  YS
Sbjct  377  HHLYLSNKGYRSLIYSGDHDMLVSFVGTQAWIRSLNFSIVDDWRPWHLEGQVAGYTRSYS  436

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             K   +TYAT+KG GHTAPEYKP EC  M +RW S  PL
Sbjct  437  NK---MTYATIKGGGHTAPEYKPEECFAMFKRWTSQEPL  472



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D Y+ A  WANN  VQ+AL +R+ T+ EW RC   LS  PE E S           +
Sbjct  324  CRTDGYILAPYWANNATVQEALHIRKNTIREWQRCAMGLSYTPEIESS----------FE  373

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDMIVP  ST+ WI SL   + DDWR W VE QV GYT  YS
Sbjct  374  YHVTLSKKGYRSLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYS  433

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++T+ATVKG GHTAPEY+P+EC  M +RW+S  PL
Sbjct  434  N---QMTFATVKGGGHTAPEYRPKECFGMYKRWVSGQPL  469



>ref|XP_007199854.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
 gb|EMJ01053.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
Length=449

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 102/160 (64%), Gaps = 29/160 (18%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NYLF+Y WAN+K VQ AL ++EG++ EWLRCNHTL         ++Y+F+V +++
Sbjct  319  WCRSYNYLFSYIWANDKTVQDALHIQEGSIKEWLRCNHTLK--------DSYIFDVSSSL  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVLIYSGDHDM+VP+V+T  WIESL + V+  W+PWFV+ Q        
Sbjct  371  VYHENLIKQGYRVLIYSGDHDMLVPYVATMAWIESLNLTVDSRWKPWFVDGQ--------  422

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                         GAGHTAPEYKP EC  MI RW + YPL
Sbjct  423  -------------GAGHTAPEYKPEECHAMISRWFAYYPL  449



>ref|XP_008778119.1| PREDICTED: serine carboxypeptidase-like 18, partial [Phoenix 
dactylifera]
Length=271

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y WAN+ + +KAL +++GT+ EW RCN  L           Y  ++ N ++
Sbjct  126  CRSYAYFLSYYWANSNVTRKALHIKKGTVREWQRCNLDLP----------YTKDIPNNIN  175

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S T+K  R L+YSGDHD++VP + T+ W  SL   V D+WR W V   +AGYT  YS
Sbjct  176  YHLSITSKGYRALVYSGDHDLVVPFLGTQAWTRSLNFSVVDEWRSWHVGGHIAGYTTTYS  235

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATV+GAGHTAPEYKP EC  M+QRW+S  PL
Sbjct  236  NN---LTFATVRGAGHTAPEYKPEECFAMVQRWISSRPL  271



>ref|XP_010065872.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
Length=470

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 100/156 (64%), Gaps = 10/156 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NYL+ Y WA+ K V  AL +REGT+ +W+RCN TLS          Y  +V   +
Sbjct  321  WCRNYNYLYIYIWASAKAVPDALHIREGTVEKWVRCNKTLS----------YTSHVLVVI  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H+    +  R LIYSGDHDM++P+V T+ WI +L + + +DW  WFV+ QVAGY   Y
Sbjct  371  DIHKELIKRGFRALIYSGDHDMLIPYVGTQAWIHTLNLTISEDWHAWFVDGQVAGYATLY  430

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
            S      T+ TVKGAGHTAPEYKP+EC  +I RW +
Sbjct  431  SSFPSLFTFVTVKGAGHTAPEYKPKECFALICRWFN  466



>ref|XP_008236344.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=509

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 36/188 (19%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKN  562
            WCR   YL +Y WAN+K VQ+AL ++E  G++ EW RCN TL         E Y+ +V +
Sbjct  330  WCRSYTYLLSYIWANDKTVQEALHIQENQGSIKEWERCNKTLQ--------EFYISDVSS  381

Query  561  TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
            ++ YH +   +  RVL+YSGDHDM +P++ST  WIESL + V+  W+PWFV+ QVAG+  
Sbjct  382  SLVYHENLIKQGYRVLVYSGDHDMNIPYMSTMGWIESLNLTVDSRWKPWFVDGQVAGFVS  441

Query  381  KYSQ--------------------------KEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
              S                           ++Y+LTYAT+KGAGHTAP+YKP EC  MI 
Sbjct  442  ISSSFYFVSSLVRKSDYNYLIVMIQSAVHIQKYQLTYATIKGAGHTAPDYKPEECFAMIS  501

Query  279  RWLSIYPL  256
            RWL+ YPL
Sbjct  502  RWLAYYPL  509



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 101/155 (65%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ N      WA +  VQKAL VR+GT+TEW+RCN +L           Y  +V++ V 
Sbjct  331  CRNYNGYLCKVWATDISVQKALYVRQGTVTEWVRCNSSL----------LYDKDVESAVG  380

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YHR    K  R LIYSGDHD +VP+V TE WI+SL   + DDWRPWFV+ QV GY+ +Y 
Sbjct  381  YHRYLNTKGYRALIYSGDHDTVVPYVGTEAWIKSLNFSIVDDWRPWFVDGQVGGYSREYG  440

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                  T+ATVKG GHTAPEYKP+ECL M +RW+S
Sbjct  441  NN---FTFATVKGGGHTAPEYKPKECLAMFKRWIS  472



>ref|XP_002522133.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40333.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y  +Y + NN  VQ ALGVR GT+  W RC  T           TY  NV++T+ 
Sbjct  331  CREFGYALSYKYMNNDTVQSALGVRNGTVETWSRCLKTFP---------TYTENVESTLY  381

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
             H++ +    R LIYSGDHD+ VP+V T  WI SL++ V D+WRPW+++ QVAGY +K+ 
Sbjct  382  IHKNLSKTGLRALIYSGDHDISVPYVGTLNWIRSLEIPVFDEWRPWYLDGQVAGYQVKFM  441

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             + + LTY T+KG GHTAPEYKP EC  M+ RW + YP+
Sbjct  442  NEHFRLTYVTIKGGGHTAPEYKPEECQAMVDRWFARYPI  480



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D Y+ A  WANN  VQ+AL +R+ T+ EW RC   LS  PE E S           +
Sbjct  358  CRTDGYILAPYWANNATVQEALHIRKNTIREWQRCAMGLSYTPEIESS----------FE  407

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDMIVP  ST+ WI SL   + DDWR W VE QV GYT  YS
Sbjct  408  YHVTLSKKGYRSLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYS  467

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++T+ATVKG GHTAPEY+P+EC  M +RW+S  PL
Sbjct  468  N---QMTFATVKGGGHTAPEYRPKECFGMYKRWVSGQPL  503



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL A  W N+  V+KAL +R+G+  EW+RCN+ L           Y   + N+  
Sbjct  322  CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLP----------YTHEIGNSFS  371

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDMI+P + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  372  YHVSLSTKGYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYS  431

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  432  N---QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis]
Length=453

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +  W N+K V+KAL +REG++ EW RCN+ L          TY + V + + 
Sbjct  308  CRTYAYLLSKYWVNDKSVRKALHIREGSIGEWTRCNYGL----------TYTYEVFSAIK  357

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH     K  R LIYSGDHDM+VP V T+ WI SL   + DDW+PW +E QVAGYT  YS
Sbjct  358  YHLYLGKKGYRSLIYSGDHDMLVPFVGTQAWIRSLNFSIVDDWQPWHIEGQVAGYTRSYS  417

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++TYATVKG GHTAPEYK  EC  M +RW+S  PL
Sbjct  418  N---QMTYATVKGGGHTAPEYKQAECFAMFKRWISREPL  453



>gb|EMT02053.1| Serine carboxypeptidase-like 18 [Aegilops tauschii]
Length=514

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  + +WANN  V++ALG+ +GT+  WLRCN  +           Y  ++ ++V+
Sbjct  369  CRTAEYAMSMTWANNDTVREALGIHKGTVPSWLRCNFDIR----------YTNDIFSSVE  418

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H   T +  R LIYSGDHDMIVP + T+ WI+SL   V D+WRPW+V+ QVAGYT  YS
Sbjct  419  HHLDVTTRGYRSLIYSGDHDMIVPSIGTQAWIKSLNFSVVDEWRPWYVDAQVAGYTRSYS  478

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P++CL M  RWLS  PL
Sbjct  479  NN---LTFATVKGGGHTAPEYMPKQCLAMFGRWLSGEPL  514



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL A  W N+  V+KAL VR+G+  EW+RCN+ L           Y   + N+  
Sbjct  322  CRSYGYLLARYWDNDHNVRKALHVRQGSKGEWIRCNYDLP----------YTHEIGNSFS  371

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDM++P + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  372  YHVSLSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYS  431

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  432  N---QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>emb|CAN82418.1| hypothetical protein VITISV_044003 [Vitis vinifera]
Length=455

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 11/159 (7%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
             ++ NY+F+  WANNK V++AL VREGT   W+RCN T         +  +  +V +TV 
Sbjct  308  SKEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------NLAFTKDVTSTVA  358

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W+ + QVAGYT  ++
Sbjct  359  YHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWYTDGQVAGYTETFT  418

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              +++LT+AT  GAGH A EYKP+EC  MI RW + YPL
Sbjct  419  NDDFDLTFAT--GAGHVAIEYKPKECYAMIDRWFAHYPL  455



>ref|XP_010694009.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 104/160 (65%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++       +WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  302  WCQESITGLLDNWANDIQVQAALHIQEGTKRYWIRCNRTLA----------YEYNVQSTV  351

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ T +   VLIYSGD DM + +V T  WI+ L + + +DWRPWFV DQVAGY+ ++
Sbjct  352  GYHQNLTQEFIHVLIYSGDQDMKISYVGTLGWIKMLNISISEDWRPWFVNDQVAGYSTRF  411

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   PL
Sbjct  412  SNDRYNLTFATVKGAGHTAPEYKRAECFNMVMKWLESRPL  451



>ref|XP_003573757.1| PREDICTED: serine carboxypeptidase-like 13 [Brachypodium distachyon]
Length=483

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ + +WANN  V+ ALG+ +GT+  WLRCN+ +           Y  +++++V+
Sbjct  338  CRTAEYIMSRTWANNDAVRDALGIHKGTVPSWLRCNYDI----------LYTNDIRSSVE  387

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H   T +  R L+YSGDHDM++P + T+ WI SL   V D+WRPW+V+ QVAGYT  YS
Sbjct  388  HHLDVTTRGYRSLVYSGDHDMVIPFIGTQAWIRSLNFSVVDEWRPWYVDTQVAGYTRSYS  447

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P++CL M  RW+S  PL
Sbjct  448  NN---LTFATVKGGGHTAPEYMPKQCLAMFARWVSGDPL  483



>ref|NP_001151152.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG41791.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACN35614.1| unknown [Zea mays]
Length=477

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +  WANN  V++ALG+ +GT+  WLRCN  +           Y+ ++K++V 
Sbjct  332  CRTMLYTLSRIWANNATVREALGIHKGTVPLWLRCNTDIP----------YLKDIKSSVK  381

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T K  + L+YSGDHDM VP++ T+ WI SL   + DDWRPW+V+ QVAGYT+ YS
Sbjct  382  YHLDVTTKGYKSLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWRPWYVDGQVAGYTVLYS  441

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LT+ATVKGAGHTAPEY PR+CL M+ RWL+
Sbjct  442  N---NLTFATVKGAGHTAPEYMPRQCLAMLSRWLA  473



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL A  W N+  V+KAL +R+G+  EW+RCN+ L           Y   + N+  
Sbjct  322  CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLP----------YTHEIGNSFS  371

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDM++P + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  372  YHVSLSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYS  431

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  432  N---QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>tpg|DAA39921.1| TPA: Serine carboxypeptidase 1 [Zea mays]
Length=522

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +  WANN  V++ALG+ +GT+  WLRCN  +           Y+ ++K++V 
Sbjct  377  CRTMLYTLSRIWANNATVREALGIHKGTVPLWLRCNTDIP----------YLKDIKSSVK  426

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T K  + L+YSGDHDM VP++ T+ WI SL   + DDWRPW+V+ QVAGYT+ YS
Sbjct  427  YHLDVTTKGYKSLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWRPWYVDGQVAGYTVLYS  486

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LT+ATVKGAGHTAPEY PR+CL M+ RWL+
Sbjct  487  N---NLTFATVKGAGHTAPEYMPRQCLAMLSRWLA  518



>ref|XP_006662125.1| PREDICTED: serine carboxypeptidase-like 18-like [Oryza brachyantha]
Length=525

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +  WANN  V++ALG+ +GT+  W RCN+ +           Y  ++K++V 
Sbjct  380  CRTAEYTMSRIWANNDTVREALGIHQGTVPSWQRCNYDV----------LYTSDIKSSVR  429

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T +  R LIYSGDHDM++P + T+ WI+SL   V D+WRPWFV  QVAGYT  YS
Sbjct  430  YHLDLTTRGYRSLIYSGDHDMVIPFIGTQAWIKSLNFPVVDEWRPWFVNGQVAGYTRSYS  489

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P++CL M+ RW+S  PL
Sbjct  490  NN---LTFATVKGGGHTAPEYMPKQCLAMLGRWVSGDPL  525



>gb|KHG24307.1| Serine carboxypeptidase-like 18 [Gossypium arboreum]
Length=446

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 15/155 (10%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+ N      WA++  VQ+ALG+R+GT+ EW+RCN +L           Y  +V + VD
Sbjct  303  CRNYNTYLCKIWASDDSVQQALGIRKGTIREWIRCNESL----------LYDKDVGSVVD  352

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   K  R LIYSGDHD +VP+V TE WI+SL + + DDWRPWFV+DQVAGY+ +Y 
Sbjct  353  YHLSLNTKGYRALIYSGDHDRLVPYVGTESWIKSLNLSIVDDWRPWFVDDQVAGYSREYG  412

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LT+AT  G GHTAPE+KP+EC  M  RW+S
Sbjct  413  NN---LTFAT--GGGHTAPEFKPKECFAMFNRWIS  442



>ref|XP_010065863.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW63563.1| hypothetical protein EUGRSUZ_G01192 [Eucalyptus grandis]
Length=464

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 109/160 (68%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC + NY  +Y WAN++ VQ+ALGVR GT+ +W+RCN +L           Y  +V + +
Sbjct  315  WCHNFNYAMSYWWANDQGVQEALGVRLGTVGDWVRCNKSLQ----------YTMDVSSVL  364

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D H++ + K  +VL+Y+GDHD+ +P   T++W++ L + + ++WRPW V+ Q+AGYT+KY
Sbjct  365  DVHQNLSTKGLQVLVYNGDHDLTIPSTGTQQWVKVLDLTIVNNWRPWLVDGQIAGYTIKY  424

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  Y LTY ++KGAGH+  EYK REC  M +R++  YP+
Sbjct  425  SEHGYRLTYVSLKGAGHSPQEYKRRECYEMFRRFIHYYPI  464



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +YSW N+  V++AL +R+G++ +W RCN+ L+          Y  ++ +T+ 
Sbjct  332  CRTYGYRLSYSWTNDDNVREALHIRKGSIGDWQRCNNELN----------YTNDISSTLQ  381

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   + + CR LIYSGDHDMIVP + T+ WI SL   + DDWR W V  QVAGYT  YS
Sbjct  382  YHAKLSARGCRSLIYSGDHDMIVPFMGTQAWIRSLNYSIIDDWRSWMVRGQVAGYTRTYS  441

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 +T+ATVKG GHTAPEYKP EC  M +RW+S  PL
Sbjct  442  NG---MTFATVKGGGHTAPEYKPEECFAMFERWISREPL  477



>gb|KJB58677.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=455

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y     WAN+  V+ AL +R+G++ +WLRCNH L           Y  +V  ++ 
Sbjct  310  CRTYAYYLCRHWANDDNVRNALHIRKGSIGKWLRCNHGLP----------YNNDVPTSLP  359

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDM+VPH++T+ WI  L   + DDWRPW V+ QVAGYT  YS
Sbjct  360  YHANLSAKGYRYLIYSGDHDMVVPHLATQAWIRFLNYPIIDDWRPWMVQSQVAGYTRTYS  419

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKG GHTAPEYKP ECL M+ RW+S  PL
Sbjct  420  NR---MTFATVKGGGHTAPEYKPAECLAMLTRWISGQPL  455



>ref|XP_010277008.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 13/161 (8%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            ++CR D YL +Y WAN+  V+KAL +R+G++ EW RCN+ LS          Y   ++++
Sbjct  301  EFCRTDGYLLSYYWANDDNVRKALNIRKGSIGEWRRCNYGLS----------YTAEIQSS  350

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
              YH + + K  R LIYSGDHD+IVP ++T+ WI SL   + D WR W V+ QV GYT  
Sbjct  351  FSYHVNLSRKGYRSLIYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVVDGQVGGYTRT  410

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS     +T+ATVKG GHTAPEY+P+ CL M +RW+   PL
Sbjct  411  YSNN---MTFATVKGGGHTAPEYQPKACLAMYKRWIDEEPL  448



>dbj|BAF56655.1| serine carboxypeptitase-like protein 1 [Diospyros kaki]
Length=452

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 10/160 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTM-TEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            CR  +++ +Y + N++ VQ+ALGV+EGTM + W RC  +L           Y  +V +TV
Sbjct  302  CRSSSWMLSYIYMNDEGVQRALGVKEGTMNSTWRRCAKSL---------PFYEEDVSSTV  352

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++FT  + R LIYSGD  + +P++ T +WI SL V + D WRPWFV+ QVAGYT KY
Sbjct  353  AYHKNFTRTALRALIYSGDQALSIPYLGTLEWINSLGVPIFDTWRPWFVDGQVAGYTQKY  412

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +  Y LT+ATVKGAG TAPEYK +E L M+ RW + YP+
Sbjct  413  EKNSYSLTFATVKGAGETAPEYKRKEALAMVNRWFAGYPV  452



>gb|AAL73563.1|AC079632_7 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|AAM08635.1|AC108883_8 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|EAZ15041.1| hypothetical protein OsJ_30451 [Oryza sativa Japonica Group]
Length=432

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 13/154 (8%)
 Frame = -1

Query  717  YLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSF  538
            Y  +  WANN  V++ALG+ +GT+  W RCN+ +           Y +++K++V YH   
Sbjct  292  YTMSRIWANNDTVREALGIHQGTVPSWQRCNYDI----------LYTYDIKSSVRYHLDL  341

Query  537  TNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE  358
            T +  R LIYSGDHDMI+P + T+ WI SL   V D+WRPWFV+ QVAGY   YS     
Sbjct  342  TTRGYRSLIYSGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSNN---  398

Query  357  LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            LT+ATVKG GHTAPEY P++CL M+ RW+S  PL
Sbjct  399  LTFATVKGGGHTAPEYMPKQCLAMLARWVSGNPL  432



>gb|KHG16860.1| Serine carboxypeptidase-like 19 [Gossypium arboreum]
Length=339

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y     WAN+  V+ AL +R+G++ +WLRCNH L           Y  +V  ++ 
Sbjct  194  CRTYAYYLCRYWANDDNVRNALHIRKGSIGKWLRCNHGLP----------YNNDVPTSLP  243

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDM+VPH++T+ WI  L   + DDWRPW V+ QVAGYT  YS
Sbjct  244  YHANLSAKGYRYLIYSGDHDMVVPHLATQAWIRFLNYQIIDDWRPWMVQSQVAGYTRTYS  303

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKG GHTAPEYKP EC  M  RW+S  PL
Sbjct  304  NR---MTFATVKGGGHTAPEYKPAECFAMFTRWISGQPL  339



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 13/161 (8%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            ++CR D YL +Y WAN+  V+KAL +R+G++ EW RCN+ LS          Y   ++++
Sbjct  320  EFCRTDGYLLSYYWANDDNVRKALNIRKGSIGEWRRCNYGLS----------YTAEIQSS  369

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
              YH + + K  R LIYSGDHD+IVP ++T+ WI SL   + D WR W V+ QV GYT  
Sbjct  370  FSYHVNLSRKGYRSLIYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVVDGQVGGYTRT  429

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS     +T+ATVKG GHTAPEY+P+ CL M +RW+   PL
Sbjct  430  YSNN---MTFATVKGGGHTAPEYQPKACLAMYKRWIDEEPL  467



>gb|EEE60599.1| hypothetical protein OsJ_13996 [Oryza sativa Japonica Group]
Length=219

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y+ +  WAN++ V+++LG+ +GT+T W RCNH L           Y   + ++V+
Sbjct  74   CRNATYVLSKIWANDEAVRESLGIHKGTVTTWERCNHDL----------LYKKQIVSSVE  123

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R L+YSGDHD +V  + T+ W+ SL + +   WRPW+V  QV G+T  YS
Sbjct  124  YHLSLITQGYRGLVYSGDHDSVVSLIGTQGWLRSLNLSITHGWRPWYVNSQVVGFTRTYS  183

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LTYATVKGAGHTAPEY P+ECL M+ RWLS  PL
Sbjct  184  NN---LTYATVKGAGHTAPEYMPKECLAMVDRWLSGEPL  219



>ref|NP_001064014.1| Os10g0101100 [Oryza sativa Japonica Group]
 gb|ABB46564.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF25928.1| Os10g0101100 [Oryza sativa Japonica Group]
Length=460

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 13/154 (8%)
 Frame = -1

Query  717  YLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSF  538
            Y  +  WANN  V++ALG+ +GT+  W RCN+ +           Y +++K++V YH   
Sbjct  320  YTMSRIWANNDTVREALGIHQGTVPSWQRCNYDI----------LYTYDIKSSVRYHLDL  369

Query  537  TNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE  358
            T +  R LIYSGDHDMI+P + T+ WI SL   V D+WRPWFV+ QVAGY   YS     
Sbjct  370  TTRGYRSLIYSGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSNN---  426

Query  357  LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            LT+ATVKG GHTAPEY P++CL M+ RW+S  PL
Sbjct  427  LTFATVKGGGHTAPEYMPKQCLAMLARWVSGNPL  460



>gb|AIW39897.1| serine carboxypeptidase-like protein [Camellia sinensis]
Length=480

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+ +Y W+N+  VQ+AL VR+G++  W RCN +LS          Y  ++   V
Sbjct  331  WCRNFNYVLSYIWSNDDTVQEALHVRKGSVLNWERCNKSLS----------YTKDILTVV  380

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
              H         VL+ +GD DM+VP V T KWI+SL + V +DWRPWFV+ QVAGYT+ Y
Sbjct  381  PVHEELKELGLEVLVETGDRDMVVPFVGTVKWIKSLNLTVVNDWRPWFVDGQVAGYTINY  440

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S+  Y LTYATVKGAGHTAPEY   EC  M  RW   YP+
Sbjct  441  SEHGYRLTYATVKGAGHTAPEYYRMECYYMFDRWTHYYPI  480



>ref|XP_009388678.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 101/154 (66%), Gaps = 13/154 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y WAN+  V++AL +++GT+ EW RCN  L           Y   +K+ ++
Sbjct  334  CRGYAYFLSYYWANSNAVRQALHIKKGTVEEWQRCNSDL----------PYANGLKSNLE  383

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + T +  R L+YSGDHD+ +P V T  WI+SL   + DDWR W VE QVAGYTMKY+
Sbjct  384  YHLNLTTRGFRALVYSGDHDLYIPFVGTMAWIKSLNFSLVDDWRSWHVEGQVAGYTMKYA  443

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
                 LT+ATVKG GHTAPEY+P++CL MIQRW+
Sbjct  444  NN---LTFATVKGGGHTAPEYRPKQCLAMIQRWI  474



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y WA+N  V++ L + +GT+  W RCN+ L           Y  ++ +++ 
Sbjct  331  CRSSGYLLSYFWADNDTVREVLNIHKGTVQHWQRCNYGLP----------YAHDIPSSLK  380

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H + T++  R L+YSGDHDM+VP + T+ WI SL   + DDWR W  + QVAG+T  YS
Sbjct  381  FHLNLTSRGYRALVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWSADGQVAGFTRTYS  440

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY+P+ECL M+QRWLS  PL
Sbjct  441  NN---LTFATVKGGGHTAPEYRPKECLVMLQRWLSGAPL  476



>ref|XP_002272116.1| PREDICTED: serine carboxypeptidase-like 16 [Vitis vinifera]
 emb|CBI25133.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY  +Y WAN++ VQ+AL VR GT+  W RCN +LS          Y  +V++ +
Sbjct  320  WCRNFNYALSYIWANDESVQEALNVRVGTVKYWSRCNKSLS----------YTKDVQSVI  369

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            D HR  + K   VL+  GD D++VP+    +WI  L + +   WRPWFV+ ++AGYT K+
Sbjct  370  DVHRYLSKKQLEVLVEVGDRDLVVPYPGAVEWIRLLNLTIVSPWRPWFVDGEIAGYTEKH  429

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            SQ  Y LTYATVKGAGHTAPEY  REC  M +RW+  YPL
Sbjct  430  SQNGYRLTYATVKGAGHTAPEYYRRECYYMFKRWVHYYPL  469



>ref|XP_009393004.1| PREDICTED: serine carboxypeptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 13/160 (8%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +CR   Y+ +Y WANN++ ++AL +++GT  EW RCN  L    E          VK+T+
Sbjct  322  YCRTYAYVLSYYWANNQVTREALHIKKGTKEEWRRCNEDLPFRKE----------VKSTI  371

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH + T +  R L+YSGDHD++VP + T  WI+SL   + DDWR W V+ QVAGYTM Y
Sbjct  372  KYHANLTRRGYRALVYSGDHDLVVPFLGTMAWIKSLNYSIVDDWRSWHVDGQVAGYTMTY  431

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  LT+ATVK  GHT PEY+P+ECL MI+RW+S  PL
Sbjct  432  VNN---LTFATVKNGGHTTPEYRPKECLAMIRRWISYQPL  468



>emb|CAN67390.1| hypothetical protein VITISV_034715 [Vitis vinifera]
Length=472

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 103/171 (60%), Gaps = 21/171 (12%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  +  +  WAN K VQ AL +R GT+ E+ RCN +LS          Y  NV N  
Sbjct  312  WCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFRCNISLS----------YTENVNNVF  361

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAG-----  391
             YH++ TN   RVL++SGDHDM++PHV  E+WI+SL + +  DWRPWFV+ Q+ G     
Sbjct  362  GYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKSLNISLGSDWRPWFVDGQIGGLIIIP  421

Query  390  ------YTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  YT KY  K Y LTY+T+KGAGH+  EY+ RE   M  RW+  YPL
Sbjct  422  LHICYRYTRKYVNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWIHHYPL  472



>gb|KCW55058.1| hypothetical protein EUGRSUZ_I01033, partial [Eucalyptus grandis]
Length=412

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 101/146 (69%), Gaps = 11/146 (8%)
 Frame = -1

Query  720  NYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRS  541
            NYL++Y WAN++ V +AL +REGT  EW RCN++LS          Y  +V N+V YHR 
Sbjct  277  NYLYSYIWANDRNVHEALHIREGTKPEWDRCNNSLS----------YTKDVLNSVVYHRY  326

Query  540  FTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KE  364
             +  S R LIYSGDHD+ +P+V T  WI SL + +   W PWFVE QVAGY++ YS+  +
Sbjct  327  LSKTSLRALIYSGDHDLAIPYVGTLDWIRSLNLTLLGQWAPWFVEGQVAGYSILYSENNK  386

Query  363  YELTYATVKGAGHTAPEYKPRECLPM  286
            Y+LT+ T+KG GHTAPEYKP+ECL M
Sbjct  387  YDLTFTTIKGGGHTAPEYKPKECLAM  412



>ref|XP_010048652.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW80985.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=495

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 10/156 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ NY+ +  WANN+ V+ ALG+REGT   W RCN +L+          Y   V ++V
Sbjct  346  WCREYNYVLSGVWANNEDVRAALGIREGTKGVWKRCNSSLA----------YTKTVSSSV  395

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ +N + R LIYSGDHDM V ++ T  WI SL + +   WR W+V  QVAGYT ++
Sbjct  396  PYHQNLSNTNLRALIYSGDHDMSVTYLGTHFWIFSLNLTLSTAWREWYVNGQVAGYTEEF  455

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
            +  ++ L +ATVKG GH APEYKPREC  M+ RWL+
Sbjct  456  TSNQFTLDFATVKGGGHVAPEYKPRECYEMLDRWLA  491



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y  +Y W +++ V++AL +REG++ +WLRCN+ +           Y  ++ +++ 
Sbjct  323  CRTYAYTLSYIWVDDRSVRQALHIREGSVKQWLRCNYGIP----------YASDIPSSIK  372

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   + K  R LIYSGDHDMIVP + T+ W+ SL   + DDWRPW V+ QVAGYT  YS
Sbjct  373  YHAYLSKKGYRSLIYSGDHDMIVPFLGTQGWVRSLNYSITDDWRPWKVQGQVAGYTRTYS  432

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKG GHTAPEYKP ECL M +RW +  PL
Sbjct  433  NR---MTFATVKGGGHTAPEYKPAECLAMFKRWTNQEPL  468



>ref|XP_004289770.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=471

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 108/161 (67%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            ++C + NY  +Y WAN+  V+ AL +R GT+ +W RCN +L           Y ++V + 
Sbjct  321  EFCHNFNYALSYVWANDDDVRAALNIRNGTVFDWKRCNKSLD----------YTYDVSSV  370

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            ++YH++ + K  +VLI++GDHD+ +P+  TE+WI+ L + V +DWRPW V+ Q+AGYT+K
Sbjct  371  LEYHQNLSTKGLQVLIFNGDHDLTIPNTGTEEWIKKLDLTVVNDWRPWLVDGQIAGYTIK  430

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS+  Y LTYAT+KGAGH+  EYK RE   M  R++  YP+
Sbjct  431  YSENGYRLTYATLKGAGHSPQEYKRREGYDMFDRFIHYYPI  471



>ref|XP_010048542.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW80817.1| hypothetical protein EUGRSUZ_C02185 [Eucalyptus grandis]
Length=471

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+ N++  Y WAN K VQ+AL VR GT T W  CN TL+          Y   + + V
Sbjct  322  WCRNYNHMVCYIWANLKSVQEALQVRPGTKTYWPYCNSTLA----------YTKVISSVV  371

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T  + R LI+SGDHDM +PH+ T+ WI +L + +++ WR W V+ Q AGY  KY
Sbjct  372  DYHKNLTKGNIRGLIFSGDHDMSIPHIGTQAWINALNLTLDESWRVWSVDGQTAGYAKKY  431

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             + +Y LT+ TVKGAGH A EYK +EC  ++ RW++ YP+
Sbjct  432  IKDDYSLTFVTVKGAGHFAAEYKVKECFQLVDRWMAYYPV  471



>emb|CBI22419.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR  +Y+ +Y W N+  VQ AL V+ GT+  W RC  +           +Y  NV +TV 
Sbjct  314  CRSFSYVLSYKWLNDINVQNALHVQPGTVKTWRRCPKSF---------PSYTENVDSTVA  364

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH++FT    R LIYSGDHD+  P++ T +WI+SL V V D WRPW+V+ Q+AGYT K+ 
Sbjct  365  YHKNFTRTGLRALIYSGDHDLSTPYIGTLEWIKSLDVPVFDKWRPWYVDGQIAGYTTKFM  424

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               Y LTYAT+KGAG TAPEYK +E L ++ RW + YP+
Sbjct  425  NDHYRLTYATLKGAGLTAPEYKHKESLALVDRWFAYYPI  463



>ref|XP_002269439.1| PREDICTED: serine carboxypeptidase-like 7 [Vitis vinifera]
Length=488

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR  +Y+ +Y W N+  VQ AL V+ GT+  W RC  +           +Y  NV +TV 
Sbjct  339  CRSFSYVLSYKWLNDINVQNALHVQPGTVKTWRRCPKSF---------PSYTENVDSTVA  389

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH++FT    R LIYSGDHD+  P++ T +WI+SL V V D WRPW+V+ Q+AGYT K+ 
Sbjct  390  YHKNFTRTGLRALIYSGDHDLSTPYIGTLEWIKSLDVPVFDKWRPWYVDGQIAGYTTKFM  449

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               Y LTYAT+KGAG TAPEYK +E L ++ RW + YP+
Sbjct  450  NDHYRLTYATLKGAGLTAPEYKHKESLALVDRWFAYYPI  488



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 14/159 (9%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+D Y+ +  WA++  V++AL +R+GT+ +W+RC            S  Y   V +++ 
Sbjct  320  CRNDWYILSSHWADDSQVREALHIRKGTIGKWVRC-----------ASLQYQKTVMSSIP  368

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHD +V  +ST+ WI+SL   + DDWRPW V++QVAGYT  YS
Sbjct  369  YHANLSAKGYRSLIYSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIVDNQVAGYTRSYS  428

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ TVKGAGHTAPEYKPRECL M++RW+S  PL
Sbjct  429  NR---MTFVTVKGAGHTAPEYKPRECLAMLKRWMSYKPL  464



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 98/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y W N+  V+KAL +R G+  EW RCN  L           Y   + ++  
Sbjct  323  CRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGL----------PYAREIHSSFS  372

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDM+VP + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  373  YHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIADDWRPWILHSQVAGYTRTYS  432

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  433  NR---MTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>dbj|BAF99696.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=481

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 12/162 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR D+Y   + WAN+  VQKAL +REGT+ EW+RCN+++S          Y   +   +
Sbjct  330  WCRKDSYFLTHVWANDPSVQKALHIREGTIKEWVRCNYSIS----------YSEKLDTVL  379

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            +YH   + +  + L YSGDHD+ +P+ +T +WI +L + V D+WRPW V++QVAGYT ++
Sbjct  380  EYHHLLSKRGYKTLAYSGDHDLYIPYTATLEWIHTLNLPVADEWRPWKVDNQVAGYTKRF  439

Query  375  SQKEYE--LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               E    +T+ATVK AGHTAPEYK RECL M+ R+ S  PL
Sbjct  440  IHNETGKYVTFATVKAAGHTAPEYKRRECLAMVARFFSDSPL  481



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 98/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y W N+  V+KAL +R G+  EW RCN  L           Y   + ++  
Sbjct  323  CRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGL----------PYAREIHSSFS  372

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDM+VP + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  373  YHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYS  432

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  433  NR---MTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>gb|KCW63602.1| hypothetical protein EUGRSUZ_G01229, partial [Eucalyptus grandis]
Length=418

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 9/152 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC+  +Y     W N   VQ AL VR GT++E+ RCN++L+          Y  +V + +
Sbjct  276  WCKYFDYYLVDVWGNYPGVQAALHVRPGTVSEFFRCNNSLAA---------YTEDVDDVL  326

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
            DYH++ T+   +VL++SGDHDM +PH   E+WI+ L + ++ DWRPWFV+ QVAGYT KY
Sbjct  327  DYHKNLTSLGMQVLVFSGDHDMFIPHNGIEEWIKWLNLTIDTDWRPWFVDGQVAGYTRKY  386

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
            +   Y LTYAT+KGAGH++PEYK REC  M Q
Sbjct  387  TDDGYRLTYATLKGAGHSSPEYKRRECYEMFQ  418



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 98/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL +Y W N+  V+KAL +R G+  EW RCN  L           Y   + ++  
Sbjct  323  CRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGL----------PYAREIHSSFS  372

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S + K  R LIYSGDHDM+VP + TE WI+SL   + DDWRPW +  QVAGYT  YS
Sbjct  373  YHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYS  432

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +TYATVKG GHTAPEY+P EC  M QRW++  PL
Sbjct  433  NR---MTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>ref|XP_002268517.1| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI17849.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            C +  Y+F+  W+N++ V++AL VREGT   W+RCN  +SG         Y  +VK+++ 
Sbjct  323  CHEYMYVFSEIWSNDESVREALHVREGTKGHWVRCN--VSGL-------AYTRDVKSSIP  373

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            Y R+ T    R LIYSGDHDM +PHV T++WI  L + + D WR W+ + QV+GYT +++
Sbjct  374  YQRNLTQTGLRALIYSGDHDMSIPHVGTQEWINLLNLTLADTWRAWYTDAQVSGYTQRFT  433

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              ++ LT+ATVKGAGH A EYK +EC  MI+RW   YPL
Sbjct  434  NDDFSLTFATVKGAGHVAIEYKAKECYAMIKRWFGYYPL  472



>ref|XP_004299780.2| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 98/160 (61%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  N++ AY WAN+  VQ ALGVR GT   W  CN TL+          Y   V + +
Sbjct  349  WCRSYNHMLAYIWANHPSVQDALGVRRGTKRFWQYCNSTLA----------YTQEVTSVI  398

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
              H+S      R LIYSGDHDM +PH++T+KWI  L + + + WR W V++Q AGYT K+
Sbjct  399  SLHQSLATVGLRALIYSGDHDMTIPHIATQKWINLLNLTLNETWRAWSVDNQTAGYTKKF  458

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              + + LT+ATVKG GH A EYK +EC  MI RW++  PL
Sbjct  459  VNEVFNLTFATVKGGGHIAAEYKVKECSEMIDRWMAQTPL  498



>ref|XP_010030506.1| PREDICTED: serine carboxypeptidase-like 7 [Eucalyptus grandis]
Length=506

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+   L    WANN  VQ+AL +R+G +  W+RCN          RS  Y  +V++ V 
Sbjct  361  CREYYDLLCDIWANNPAVQEALHIRQGILRCWVRCN----------RSLAYAHDVRSAVS  410

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            +H    ++ CR LIYSGDHDM++P++ T+ WI++L +   DDWRPW V DQVAG+T +YS
Sbjct  411  HHLYLNSRGCRSLIYSGDHDMVIPYLGTQSWIKTLNLSTMDDWRPWMVGDQVAGFTREYS  470

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY P EC  M +RW+   PL
Sbjct  471  NG---LTFATVKGGGHTAPEYLPEECFAMYKRWIHREPL  506



>ref|XP_002446557.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
 gb|EES10885.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
Length=468

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 98/155 (63%), Gaps = 13/155 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            C +  Y  +Y+W N++ VQ++LGVR+GT+ EW R NH L           Y  ++++ V 
Sbjct  323  CTESLYSLSYTWGNDETVQESLGVRKGTIGEWKRFNHEL----------LYNHDIQSAVG  372

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH     K  R LIYSGDHD +VPHV T+ WI  L + + DDWRPW+V  QVAG+T  Y+
Sbjct  373  YHSRLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGGQVAGFTRSYA  432

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                 LTYATVKGAGH AP YKP EC  M+ RW+S
Sbjct  433  SG---LTYATVKGAGHIAPMYKPLECQKMLIRWIS  464



>ref|XP_008644916.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Zea mays]
Length=481

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 98/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ +  WAN+  V++ALG+ +GT+  W RCN+ +           Y  ++ + V 
Sbjct  336  CRTAGYMMSSMWANDASVRQALGIHKGTVPSWSRCNYDIP----------YTNDIPSAVK  385

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH   T K  R L+Y+GDHDM+VP + T+ WI SL     D+WRPWFV+ QVAG+T  YS
Sbjct  386  YHLDVTTKGYRSLVYNGDHDMVVPFIGTQAWIRSLNFSTVDEWRPWFVDGQVAGFTRSYS  445

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKG GHTAPEY PR+C  M  RW+S  PL
Sbjct  446  NN---LTFATVKGGGHTAPEYMPRQCFAMFVRWVSGDPL  481



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 14/159 (9%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+D Y  +  WA++  V++AL +R+GT+ +W+RC            S  Y   V +++ 
Sbjct  285  CRNDWYKHSTHWADDGQVREALHIRKGTIGKWVRC-----------ASLQYQKTVMSSIP  333

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHD +V  +ST+ WI+SL   + DDWRPW +++QVAGYT  YS
Sbjct  334  YHANLSAKGYRSLIYSGDHDKVVISLSTQAWIKSLNYSIIDDWRPWVIDNQVAGYTRSYS  393

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKGAGHTAPEYKPRECL M++RW+S  PL
Sbjct  394  NR---MTFATVKGAGHTAPEYKPRECLAMLKRWMSYKPL  429



>ref|XP_006653168.1| PREDICTED: serine carboxypeptidase-like 18-like, partial [Oryza 
brachyantha]
Length=444

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 99/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y+ +  WAN + V+++LGV +GT+  W RCN+ +           Y  ++ + V+
Sbjct  299  CRNATYVLSKIWANEETVKESLGVHKGTVATWKRCNYEVP----------YTMDIHSAVE  348

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   K  R L+YSGDHD  +  V TE WI SL + + D+WRPW+   QV G+T  YS
Sbjct  349  YHLSLITKGYRGLVYSGDHDSKISFVGTEGWIRSLNLSITDNWRPWYFNSQVVGFTKTYS  408

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LTYATVKGAGHTAPEY P+ECL M+ RWLS  PL
Sbjct  409  NN---LTYATVKGAGHTAPEYMPKECLAMVDRWLSGQPL  444



>ref|NP_001067860.1| Os11g0460800 [Oryza sativa Japonica Group]
 gb|ABG22477.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABG22478.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28223.1| Os11g0460800 [Oryza sativa Japonica Group]
 dbj|BAG90172.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 12/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR  +++    WAN++ V+++LGV++GT+ EW RCN          R   Y  +V++TV+
Sbjct  337  CRKASHVLLKIWANDETVRESLGVQKGTVGEWKRCN----------RDIDYNSDVRSTVE  386

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH +   K  R +IYSGDHD  VP +ST+ WI  L + + DDWRPW+V+ QVAG+T  ++
Sbjct  387  YHLTLMRKGYRAIIYSGDHDSRVPSISTQAWIRLLNLSIADDWRPWYVDGQVAGFTRSFA  446

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LTYATVKGAGHTA EYKP+EC  M  RW+S  PL
Sbjct  447  SN--NLTYATVKGAGHTAAEYKPKECQEMFARWISGTPL  483



>ref|XP_010046973.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW78694.1| hypothetical protein EUGRSUZ_C00146 [Eucalyptus grandis]
Length=478

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 102/161 (63%), Gaps = 11/161 (7%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR+  ++ +  WAN+K VQ+AL +R+GT+T W  CN ++S          Y     + +
Sbjct  328  WCRNYRHVLSGIWANDKSVQEALHIRDGTITLWKMCNSSMS----------YDEEFDSVI  377

Query  555  DYHRSFTNKS-CRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
             YH++F+  S  R LIYSGDHDM +PH++T +WI+S  + + D WRPWFV  QVAGYT +
Sbjct  378  SYHKNFSESSELRALIYSGDHDMSIPHLATRQWIQSFDMTLLDTWRPWFVNAQVAGYTEE  437

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            Y   +Y L + TVKG GH A EYK  +C  M+ RW + YPL
Sbjct  438  YENNDYTLHFVTVKGGGHIAAEYKQEQCAAMMDRWFAYYPL  478



>gb|KDP44534.1| hypothetical protein JCGZ_16367 [Jatropha curcas]
Length=465

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            +C +  YL +  W N + VQ AL VR+  + E+ RCN +L           Y  ++   +
Sbjct  316  YCHNFPYLLSDIWTNYRSVQAALKVRQAMIPEFHRCNISLG----------YTVDMDTVI  365

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH++ T    +VL++SGDHDM++PH   E+WI SL + ++ DWRPWFV+ QVAGYT KY
Sbjct  366  PYHKNLTKTGLQVLVFSGDHDMVMPHNGIEQWITSLDLTIDTDWRPWFVDGQVAGYTRKY  425

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +   Y LTYATVKGAGH+  E+K +EC  M  RW+  YPL
Sbjct  426  TNTGYRLTYATVKGAGHSPQEFKRKECFDMFHRWIHYYPL  465



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   YL  Y WAN+  VQKAL +R+G++ +W RC  TL  P        Y  +V ++  
Sbjct  328  CRTYAYLLCYYWANDNNVQKALHIRKGSIGQWQRC--TLGLP--------YTADVPSSFP  377

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + +  R LIYSGDHD+ VP ++T+ WI SL   + DDWRPW +  QV GYT  YS
Sbjct  378  YHANLSARGIRALIYSGDHDLTVPFLATQAWIRSLNYTIVDDWRPWVLRGQVVGYTRTYS  437

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKG GHTAPEY+P ECL M +RW+S  PL
Sbjct  438  NR---MTFATVKGGGHTAPEYRPAECLAMFKRWISEEPL  473



>gb|ACN30985.1| unknown [Zea mays]
Length=471

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            C +  Y+ +Y+W N+  VQ++LG+R+GT+  W R +H L           Y +++++ VD
Sbjct  326  CAEALYILSYAWGNDDTVQESLGIRKGTIGAWKRYSHALP----------YNYDIQSAVD  375

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH     K  R LIYSGDHD +VPHV T+ WI  L + + DDWRPW+V DQVAG+T  Y+
Sbjct  376  YHSGLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGDQVAGFTRSYA  435

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LT+ATVKGAGH AP YK  EC  M   W+S  PL
Sbjct  436  SG---LTFATVKGAGHVAPLYKTLECQKMFITWISGNPL  471



>ref|XP_010694007.1| PREDICTED: serine carboxypeptidase-like 7 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 105/181 (58%), Gaps = 31/181 (17%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  258  WCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA----------YEYNVESTV  307

Query  555  DYHRSFTNKSCRVLIY---------------------SGDHDMIVPHVSTEKWIESLKVG  439
             YH++ T +   VLIY                      GD DM + +V T  WI+ L + 
Sbjct  308  GYHQNLTQEFIHVLIYRDEEEHVKHLERVLKLLEHCQCGDQDMKISYVGTLGWIKMLNIS  367

Query  438  VEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
            + +DWRPWFV DQVAGYT +++   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   P
Sbjct  368  ISEDWRPWFVNDQVAGYTTRFANDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESRP  427

Query  258  L  256
            L
Sbjct  428  L  428



>dbj|BAF99698.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=484

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D Y+ AY WAN+  V++AL + +G++  W+RCN          RS  +  +++N V 
Sbjct  339  CRTDGYIPAYYWANDDRVREALHIHKGSIKNWVRCN----------RSLPFEDSIRNVVP  388

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHD +VP ++T+ WI SL   + D+WR W VE QVAGYT  Y+
Sbjct  389  YHANLSKKGYRSLIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQWIVEGQVAGYTRTYA  448

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++T+ATVKG GHTAPEYKP+EC  M +RW++  PL
Sbjct  449  N---QMTFATVKGGGHTAPEYKPKECKAMFKRWITHKPL  484



>ref|XP_010691546.1| PREDICTED: serine carboxypeptidase-like 18 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 105/165 (64%), Gaps = 15/165 (9%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WCR  NY  + +WAN++ VQ AL VR+GT+ +W RCN T+S          Y  +  + V
Sbjct  321  WCRSFNYGLSDTWANDEAVQNALHVRKGTVNQWSRCNKTIS----------YTKDQPSVV  370

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE----DDWRPWFVEDQVAGY  388
              H++ TN + R+L+YSGD DM+V  V   +WI+S+K  V     D WRPWFV+ QV GY
Sbjct  371  QVHQNLTNYNLRLLVYSGDRDMVVTFVGVVQWIKSIKNSVNLTLSDRWRPWFVDAQVGGY  430

Query  387  TMKYSQKE-YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            T KY +   Y LTYATVKG GHTA EY  REC  M +RW+S+YPL
Sbjct  431  TRKYEKNSAYFLTYATVKGGGHTAAEYYRRECYEMFRRWVSLYPL  475



>ref|XP_003602921.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=270

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y     WAN+  VQ AL +R+G++ +W RCN  +           +   + N+ +
Sbjct  125  CRSHAYFLGAYWANDANVQNALHIRKGSIGKWKRCNFDIP----------FKHEIDNSFE  174

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHDM VP V+T+ WI SL   + DDWR W+   QVAGYT  YS
Sbjct  175  YHVNLSRKGYRSLIYSGDHDMKVPFVATQAWIRSLNYSIVDDWRQWYSNSQVAGYTRTYS  234

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +   +T+ATVKGAGHTAPEYK  ECL M+ RW+S  PL
Sbjct  235  NR---MTFATVKGAGHTAPEYKREECLAMLSRWISNNPL  270



>ref|XP_010694006.1| PREDICTED: serine carboxypeptidase-like 7 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=436

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 105/181 (58%), Gaps = 31/181 (17%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  266  WCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA----------YEYNVESTV  315

Query  555  DYHRSFTNKSCRVLIY---------------------SGDHDMIVPHVSTEKWIESLKVG  439
             YH++ T +   VLIY                      GD DM + +V T  WI+ L + 
Sbjct  316  GYHQNLTQEFIHVLIYRDEEEHVKHLERVLKLLEHCQCGDQDMKISYVGTLGWIKMLNIS  375

Query  438  VEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
            + +DWRPWFV DQVAGYT +++   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   P
Sbjct  376  ISEDWRPWFVNDQVAGYTTRFANDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESRP  435

Query  258  L  256
            L
Sbjct  436  L  436



>ref|XP_008669340.1| PREDICTED: serine carboxypeptidase-like 7 [Zea mays]
Length=488

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR  +Y+ +  WAN++ VQ++LGVR+GT+  W RCN  +           Y  NV++ V 
Sbjct  344  CRRASYVLSRVWANDETVQESLGVRKGTIGAWKRCNQDI----------LYNQNVQSVVP  393

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH     K  R LIYSGDHD IVP V T+ WI  L + V DDWRPW+V  QVAG+T    
Sbjct  394  YHSRLAAKGYRALIYSGDHDRIVPFVGTQAWIRYLNLTVVDDWRPWYVGGQVAGFT----  449

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            +    L YATVKGAGHTAPEYKP EC  M ++W+S  PL
Sbjct  450  RNSGNLIYATVKGAGHTAPEYKPTECQTMFRKWVSRDPL  488



>ref|XP_008236284.1| PREDICTED: putative serine carboxypeptidase-like 52 [Prunus mume]
Length=170

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 24/160 (15%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC   +Y+F Y WAN+K VQ AL ++EG++ EW+RCN TL         + Y+ +V +++
Sbjct  35   WCWHYDYIFTYIWANDKTVQDALHIQEGSIKEWVRCNETLQ--------DLYISDVPSSL  86

Query  555  DYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY  376
             YH +   +  RVLIY+                ESL + +   W+PWFV  QVAGY M+Y
Sbjct  87   VYHENLIKQGYRVLIYT----------------ESLNLTIGSRWKPWFVNRQVAGYRMQY  130

Query  375  SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            S K+Y+LTY T+KGAGHTAP+YKP EC  MI RW + YPL
Sbjct  131  SDKKYQLTYTTIKGAGHTAPQYKPEECHAMISRWFAYYPL  170



>dbj|BAF99697.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=494

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR D Y+ AY WAN+  V++AL + +G++  W+RCN          RS  +  +++N V 
Sbjct  349  CRTDGYIPAYYWANDDRVREALHIHKGSIKNWVRCN----------RSLPFEDSIRNVVP  398

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH + + K  R LIYSGDHD +VP ++T+ WI SL   + D+WR W VE QVAGYT  Y+
Sbjct  399  YHANLSKKGYRSLIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQWIVEGQVAGYTRTYA  458

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                ++T+ATVKG GHTAPEYKP+EC  M +RW++  PL
Sbjct  459  N---QMTFATVKGGGHTAPEYKPKECKAMFKRWITHKPL  494



>ref|XP_004289771.1| PREDICTED: serine carboxypeptidase-like 17 [Fragaria vesca subsp. 
vesca]
Length=472

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = -1

Query  738  QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNT  559
            ++C   +Y  +Y WAN+  V+ AL +R GT+ +W RCN +L           Y ++V + 
Sbjct  322  EFCHTFSYSLSYVWANSDGVRAALNIRNGTVFDWKRCNKSLD----------YTYDVPSV  371

Query  558  VDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMK  379
            ++YH++ + K  +VLI++GDHD+I+P+  TE WI+ L + + +DWRPW V+ Q+AGYT+K
Sbjct  372  LEYHQNLSTKGLQVLIFNGDHDLIIPNTGTEAWIKELGLTIVNDWRPWLVDGQIAGYTIK  431

Query  378  YSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
            YS+  Y L YAT+KGAGH+  EYK RE   M  R++  YP+
Sbjct  432  YSENGYRLIYATLKGAGHSPQEYKRREAYNMFDRFIHYYPI  472



>ref|XP_010235061.1| PREDICTED: serine carboxypeptidase-like 10 [Brachypodium distachyon]
Length=480

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y  +  WAN++ V+++LG+R+GT+  W RC+  L           Y   + +TV 
Sbjct  335  CRNSTYFLSEVWANDEAVRESLGIRKGTVPLWQRCDFHLP----------YTKEISSTVG  384

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
             H +   +  R ++YSGDHD  +  V T+ WI  L + + DDWRPW+V+ QVAG+T  YS
Sbjct  385  EHLALITRGYRSMVYSGDHDSKISFVGTQAWIRQLNLSITDDWRPWYVDSQVAGFTRAYS  444

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  TYATVKGAGHTAPEY PRECL MI RWLS +PL
Sbjct  445  NN---FTYATVKGAGHTAPEYMPRECLAMIDRWLSGHPL  480



>ref|NP_001052165.1| Os04g0176400 [Oryza sativa Japonica Group]
 emb|CAE01973.2| OSJNBb0051N19.2 [Oryza sativa Japonica Group]
 dbj|BAF14079.1| Os04g0176400 [Oryza sativa Japonica Group]
Length=467

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y+ +  WAN++ V+++LG+ +GT+T W RCNH L           Y   + ++V+
Sbjct  322  CRNATYVLSKIWANDEAVRESLGIHKGTVTTWERCNHDL----------LYKKQIVSSVE  371

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R L+YSGDHD +V  + T+ W+ SL + +   WRPW+V  QV G+T  YS
Sbjct  372  YHLSLITQGYRGLVYSGDHDSVVSLIGTQGWLRSLNLSITHGWRPWYVNSQVVGFTRTYS  431

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LTYATVKGAGHTAPEY P+ECL M+ RWLS  PL
Sbjct  432  NN---LTYATVKGAGHTAPEYMPKECLAMVDRWLSGEPL  467



>ref|XP_010694003.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 105/181 (58%), Gaps = 31/181 (17%)
 Frame = -1

Query  735  WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTV  556
            WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+          Y +NV++TV
Sbjct  302  WCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA----------YEYNVESTV  351

Query  555  DYHRSFTNKSCRVLIY---------------------SGDHDMIVPHVSTEKWIESLKVG  439
             YH++ T +   VLIY                      GD DM + +V T  WI+ L + 
Sbjct  352  GYHQNLTQEFIHVLIYRDEEEHVKHLERVLKLLEHCQCGDQDMKISYVGTLGWIKMLNIS  411

Query  438  VEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
            + +DWRPWFV DQVAGYT +++   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   P
Sbjct  412  ISEDWRPWFVNDQVAGYTTRFANDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESRP  471

Query  258  L  256
            L
Sbjct  472  L  472



>ref|XP_011457835.1| PREDICTED: serine carboxypeptidase-like 7 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR   Y+ AY W N++ V+ ALGVR GT+  W+RC   L+          Y   + +++ 
Sbjct  318  CRGYTYVLAYRWMNDETVRAALGVRNGTVENWVRCPKALT---------YYTEEITSSLA  368

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            Y ++ +    R LIYSGDHD+ VP ++T+ WI++L V V D+WRPW+V  Q+AGY +K+ 
Sbjct  369  YQKNLSETGLRALIYSGDHDISVPWIATQYWIKALDVAVFDEWRPWYVNGQIAGYQVKFM  428

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               + LTY TVKGAGHTAPEYK +E L M  R+L+ YP+
Sbjct  429  NDNFRLTYVTVKGAGHTAPEYKHKETLAMFDRFLARYPI  467



>gb|EAY93240.1| hypothetical protein OsI_15047 [Oryza sativa Indica Group]
Length=469

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -1

Query  732  CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVD  553
            CR+  Y+ +  WAN++ V+++LG+ +GT+T W RCNH L           Y   + ++V+
Sbjct  324  CRNATYVLSKIWANDEAVRESLGIHKGTVTTWERCNHDL----------LYKKQIVSSVE  373

Query  552  YHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYS  373
            YH S   +  R L+YSGDHD +V  + T+ W+ SL + +   WRPW+V  QV G+T  YS
Sbjct  374  YHLSLITQGYRGLVYSGDHDSVVSLIGTQGWLRSLNLSITHGWRPWYVNSQVVGFTRTYS  433

Query  372  QKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                 LTYATVKGAGHTAPEY P+ECL M+ RWLS  PL
Sbjct  434  NN---LTYATVKGAGHTAPEYMPKECLAMVDRWLSGEPL  469



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515