BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039M05

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      217   2e-63   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      216   6e-63   Nicotiana sylvestris
gb|KJB23365.1|  hypothetical protein B456_004G094500                    213   7e-62   Gossypium raimondii
gb|KHG18393.1|  hypothetical protein F383_22096                         212   1e-61   Gossypium arboreum [tree cotton]
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    211   4e-61   
ref|XP_006354142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   8e-61   Solanum tuberosum [potatoes]
ref|XP_010316236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      210   1e-60   Solanum lycopersicum
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   2e-60   Citrus sinensis [apfelsine]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             209   2e-60   
gb|KJB66065.1|  hypothetical protein B456_010G126400                    207   6e-60   Gossypium raimondii
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Sesamum indicum [beniseed]
gb|KJB66066.1|  hypothetical protein B456_010G126400                    207   1e-59   Gossypium raimondii
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   7e-59   Nelumbo nucifera [Indian lotus]
gb|KHG04722.1|  hypothetical protein F383_29074                         204   2e-58   Gossypium arboreum [tree cotton]
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      203   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   1e-57   Glycine max [soybeans]
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             201   2e-57   Prunus persica
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      201   3e-57   Prunus mume [ume]
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    201   4e-57   Glycine max [soybeans]
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 199   2e-56   Morus notabilis
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_011048218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   4e-56   Populus euphratica
ref|XP_002297638.2|  hypothetical protein POPTR_0001s04360g             197   7e-56   
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      197   1e-55   Fragaria vesca subsp. vesca
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   2e-55   Pyrus x bretschneideri [bai li]
gb|AFK45712.1|  unknown                                                 192   2e-55   Lotus japonicus
ref|XP_010673491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    195   4e-55   
emb|CDP16794.1|  unnamed protein product                                195   5e-55   Coffea canephora [robusta coffee]
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    194   6e-55   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      194   9e-55   Eucalyptus grandis [rose gum]
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    194   1e-54   Cicer arietinum [garbanzo]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    193   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    191   1e-53   
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   2e-53   
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    190   2e-53   
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   2e-53   
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      190   5e-53   Glycine soja [wild soybean]
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    190   5e-53   Glycine max [soybeans]
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   6e-53   Glycine max [soybeans]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               189   1e-52   
gb|AFU52654.1|  beta-1,3-glucanase 21                                   187   1e-52   Solanum tuberosum [potatoes]
ref|XP_003601614.1|  Glucan endo-1,3-beta-glucosidase                   188   2e-52   Medicago truncatula
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   5e-52   Sesamum indicum [beniseed]
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      186   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   6e-51   Cucumis sativus [cucumbers]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   184   7e-51   Medicago truncatula
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             184   9e-51   Capsella rubella
ref|XP_011087559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   1e-50   
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg                183   1e-50   Erythranthe guttata [common monkey flower]
emb|CAN72077.1|  hypothetical protein VITISV_020314                     182   2e-50   Vitis vinifera
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   3e-50   Cucumis melo [Oriental melon]
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        182   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37243.1|  unknown                                                 182   4e-50   Medicago truncatula
ref|XP_011025159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   4e-50   Populus euphratica
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    182   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010651370.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   3e-49   
ref|XP_010651369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   7e-49   Vitis vinifera
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g             178   1e-48   Phaseolus vulgaris [French bean]
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-48   Cicer arietinum [garbanzo]
ref|XP_007159412.1|  hypothetical protein PHAVU_002G236300g             177   3e-48   Phaseolus vulgaris [French bean]
gb|KDP42112.1|  hypothetical protein JCGZ_01900                         176   5e-48   Jatropha curcas
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             175   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      173   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      172   2e-46   Elaeis guineensis
ref|XP_009388453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388452.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      165   8e-44   Brassica rapa
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   2e-43   Phoenix dactylifera
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   2e-43   
gb|KGN54064.1|  hypothetical protein Csa_4G280410                       164   4e-43   Cucumis sativus [cucumbers]
dbj|BAH57260.1|  AT3G13560                                              161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   1e-42   Cucumis melo [Oriental melon]
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   2e-42   Cucumis melo [Oriental melon]
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-42   Cucumis melo [Oriental melon]
ref|XP_009413316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004142250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41   
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   2e-41   
ref|XP_004162024.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    159   3e-41   
ref|XP_006858991.1|  hypothetical protein AMTR_s00068p00134210          158   4e-41   Amborella trichopoda
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      155   3e-40   Brachypodium distachyon [annual false brome]
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       154   8e-40   Zea mays [maize]
gb|ACF87545.1|  unknown                                                 152   1e-39   Zea mays [maize]
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39   Cucumis melo [Oriental melon]
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   2e-39   Cucumis melo [Oriental melon]
ref|XP_004173668.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   2e-39   
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    152   3e-39   
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   5e-39   Cucumis sativus [cucumbers]
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   7e-39   Elaeis guineensis
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    150   2e-38   Zea mays [maize]
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   3e-38   Elaeis guineensis
ref|NP_001060087.2|  Os07g0577300                                       150   3e-38   
gb|EEE67465.1|  hypothetical protein OsJ_24859                          150   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          149   5e-38   Sorghum bicolor [broomcorn]
ref|XP_009406531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   1e-37   
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    148   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    148   1e-37   
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             147   2e-37   
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             147   2e-37   Citrus clementina [clementine]
gb|EMS53703.1|  Glucan endo-1,3-beta-glucosidase 4                      147   2e-37   Triticum urartu
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             147   3e-37   
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   3e-37   
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             147   4e-37   Eutrema salsugineum [saltwater cress]
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   4e-37   Phoenix dactylifera
gb|EMT28432.1|  Glucan endo-1,3-beta-glucosidase 4                      148   4e-37   
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      146   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          146   5e-37   Sorghum bicolor [broomcorn]
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  146   5e-37   Citrus sinensis [apfelsine]
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    146   5e-37   
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    146   6e-37   
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      146   6e-37   Sesamum indicum [beniseed]
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      146   7e-37   Tarenaya hassleriana [spider flower]
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      146   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009390355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   7e-37   
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             145   9e-37   Capsella rubella
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   1e-36   Setaria italica
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   1e-36   Nelumbo nucifera [Indian lotus]
gb|AAK85402.2|  beta-1,3-glucanase                                      145   1e-36   Camellia sinensis [black tea]
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             144   2e-36   
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   2e-36   Oryza brachyantha
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             145   2e-36   Populus trichocarpa [western balsam poplar]
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                145   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      145   2e-36   Prunus mume [ume]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             144   2e-36   Prunus persica
dbj|BAJ89950.1|  predicted protein                                      144   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             144   2e-36   
emb|CDM84006.1|  unnamed protein product                                144   2e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     144   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002312452.2|  glucan endo-1 family protein                       144   3e-36   
ref|XP_010546762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      144   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      144   3e-36   Populus euphratica
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   4e-36   
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   4e-36   Cucumis melo [Oriental melon]
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    144   4e-36   
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      144   5e-36   Brassica rapa
gb|EEC82319.1|  hypothetical protein OsI_26597                          144   5e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   5e-36   Phoenix dactylifera
ref|XP_009382992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY48807.1|  BnaC02g34070D                                          143   6e-36   Brassica napus [oilseed rape]
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      143   6e-36   Fragaria vesca subsp. vesca
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   7e-36   Glycine max [soybeans]
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     143   7e-36   Triticum urartu
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             143   7e-36   Phaseolus vulgaris [French bean]
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   8e-36   Phoenix dactylifera
emb|CBI16509.3|  unnamed protein product                                143   8e-36   Vitis vinifera
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          142   9e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71452.1|  hypothetical protein OsI_03677                          142   9e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001044198.1|  Os01g0739700                                       142   9e-36   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      143   9e-36   Fragaria vesca subsp. vesca
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 142   9e-36   
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Glycine max [soybeans]
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        142   1e-35   
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Eucalyptus grandis [rose gum]
ref|XP_004295275.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Fragaria vesca subsp. vesca
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    142   1e-35   Ricinus communis
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Populus euphratica
ref|XP_011459999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Fragaria vesca subsp. vesca
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      142   1e-35   Glycine soja [wild soybean]
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Populus euphratica
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Populus euphratica
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     142   2e-35   Phoenix dactylifera
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   Populus euphratica
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         142   2e-35   Jatropha curcas
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   Eucalyptus grandis [rose gum]
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     142   2e-35   
gb|AET05176.2|  glucan endo-1,3-beta-glucosidase-like protein           142   2e-35   Medicago truncatula
ref|XP_009388881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO42272.1|  unknown protein                                         139   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01635.1|  unnamed protein product                                141   2e-35   Coffea canephora [robusta coffee]
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          142   3e-35   
dbj|BAJ85556.1|  predicted protein                                      141   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY31214.1|  BnaC08g15090D                                          141   3e-35   Brassica napus [oilseed rape]
ref|XP_009397186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   3e-35   
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   3e-35   Pyrus x bretschneideri [bai li]
gb|KJB30776.1|  hypothetical protein B456_005G159100                    141   3e-35   Gossypium raimondii
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35   
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35   Glycine max [soybeans]
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                141   3e-35   Erythranthe guttata [common monkey flower]
gb|KJB30775.1|  hypothetical protein B456_005G159100                    141   3e-35   Gossypium raimondii
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   4e-35   Glycine max [soybeans]
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   4e-35   Elaeis guineensis
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             141   4e-35   Citrus clementina [clementine]
ref|XP_007026106.1|  O-Glycosyl hydrolases family 17 protein            141   4e-35   Theobroma cacao [chocolate]
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35   Citrus sinensis [apfelsine]
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      141   5e-35   Brassica rapa
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      140   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        140   5e-35   
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   5e-35   Eucalyptus grandis [rose gum]
ref|XP_008365635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   5e-35   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             140   6e-35   Phaseolus vulgaris [French bean]
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 140   6e-35   Morus notabilis
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   6e-35   Cucumis sativus [cucumbers]
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   6e-35   Glycine max [soybeans]
gb|KJB57756.1|  hypothetical protein B456_009G179400                    140   6e-35   Gossypium raimondii
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             140   6e-35   Citrus clementina [clementine]
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    140   6e-35   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            140   7e-35   
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   7e-35   Elaeis guineensis
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     140   7e-35   
ref|XP_006828511.1|  hypothetical protein AMTR_s00060p00188740          140   8e-35   
ref|XP_003558472.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      140   9e-35   Brachypodium distachyon [annual false brome]
gb|KHG03844.1|  hypothetical protein F383_07460                         140   9e-35   Gossypium arboreum [tree cotton]
ref|XP_006599427.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   9e-35   Glycine max [soybeans]
gb|KJB15378.1|  hypothetical protein B456_002G174100                    139   9e-35   Gossypium raimondii
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein            140   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      140   1e-34   Prunus mume [ume]
ref|XP_007211541.1|  hypothetical protein PRUPE_ppa003984mg             140   1e-34   
gb|KJB15376.1|  hypothetical protein B456_002G174100                    140   1e-34   Gossypium raimondii
gb|KHG17836.1|  hypothetical protein F383_07126                         140   1e-34   Gossypium arboreum [tree cotton]
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   1e-34   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   Prunus mume [ume]
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   Brachypodium distachyon [annual false brome]
ref|XP_006657748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   Oryza brachyantha
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Populus euphratica
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   
ref|NP_001150141.1|  glucan endo-1,3-beta-glucosidase 3 precursor       139   2e-34   
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Glycine max [soybeans]
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             139   2e-34   Phaseolus vulgaris [French bean]
gb|KHG26459.1|  hypothetical protein F383_04538                         139   2e-34   Gossypium arboreum [tree cotton]
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      139   2e-34   Glycine soja [wild soybean]
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Sesamum indicum [beniseed]
gb|KJB57757.1|  hypothetical protein B456_009G179400                    139   2e-34   Gossypium raimondii
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440          139   2e-34   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                    139   2e-34   Arabis alpina [alpine rockcress]
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           139   2e-34   Medicago truncatula
ref|XP_006599425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34   Glycine max [soybeans]
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34   Cicer arietinum [garbanzo]
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   3e-34   Oryza brachyantha
gb|KJB65051.1|  hypothetical protein B456_010G078300                    138   3e-34   Gossypium raimondii
gb|KJB27172.1|  hypothetical protein B456_004G282300                    138   3e-34   Gossypium raimondii
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           138   3e-34   Medicago truncatula
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34   Glycine max [soybeans]
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    137   4e-34   
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    138   4e-34   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34   Brachypodium distachyon [annual false brome]
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     138   4e-34   Populus euphratica
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   4e-34   Cicer arietinum [garbanzo]
emb|CDP00829.1|  unnamed protein product                                138   5e-34   Coffea canephora [robusta coffee]
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      138   5e-34   Populus euphratica
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   6e-34   Populus euphratica
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           138   6e-34   Medicago truncatula
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   6e-34   Vitis vinifera
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   6e-34   Glycine max [soybeans]
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g             137   6e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   6e-34   Cicer arietinum [garbanzo]
ref|XP_009593892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      137   6e-34   Nicotiana tomentosiformis
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      137   7e-34   Glycine soja [wild soybean]
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34   Sesamum indicum [beniseed]
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      137   7e-34   Vitis vinifera
gb|ACN30650.1|  unknown                                                 137   7e-34   Zea mays [maize]
gb|KHG06295.1|  hypothetical protein F383_32557                         137   7e-34   Gossypium arboreum [tree cotton]
ref|NP_001049413.1|  Os03g0221500                                       137   8e-34   
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   8e-34   Cicer arietinum [garbanzo]
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    137   8e-34   
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   138   8e-34   
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   9e-34   Nicotiana tomentosiformis
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   Cicer arietinum [garbanzo]
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      137   1e-33   Sesamum indicum [beniseed]
ref|XP_006348130.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   1e-33   Solanum tuberosum [potatoes]
ref|XP_009772723.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      137   1e-33   Nicotiana sylvestris
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        136   1e-33   Populus trichocarpa [western balsam poplar]
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   136   1e-33   Citrus sinensis [apfelsine]
gb|EMT05308.1|  Glucan endo-1,3-beta-glucosidase 3                      136   1e-33   
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    136   2e-33   Gossypium raimondii
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           136   2e-33   Medicago truncatula
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      136   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             135   2e-33   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         136   2e-33   
gb|EEC82125.1|  hypothetical protein OsI_26155                          136   2e-33   
ref|NP_001152289.1|  glucan endo-1,3-beta-glucosidase 3 precursor       136   2e-33   
ref|NP_001059752.1|  Os07g0510200                                       136   2e-33   
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g             136   2e-33   
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                136   2e-33   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_010686818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      136   2e-33   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
gb|EPS65983.1|  hypothetical protein M569_08793                         135   2e-33   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     136   2e-33   
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg             139   2e-33   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            136   2e-33   
gb|AIR93909.1|  glucanase                                               135   2e-33   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   136   3e-33   
gb|KHN03485.1|  Glucan endo-1,3-beta-glucosidase 1                      133   3e-33   
ref|XP_003630700.1|  Glucan endo-1,3-beta-glucosidase                   135   3e-33   
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
emb|CDP03239.1|  unnamed protein product                                135   3e-33   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     135   3e-33   
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      135   3e-33   
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   4e-33   
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   4e-33   
tpg|DAA62863.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    136   4e-33   
ref|XP_010094029.1|  Glucan endo-1,3-beta-glucosidase 1                 135   4e-33   
ref|XP_002468258.1|  hypothetical protein SORBIDRAFT_01g042560          135   4e-33   
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   4e-33   
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   4e-33   
gb|KHG04832.1|  hypothetical protein F383_29565                         135   5e-33   
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             134   5e-33   
ref|XP_004959695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   5e-33   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   135   5e-33   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             135   5e-33   
ref|NP_001130376.1|  putative O-Glycosyl hydrolase superfamily pr...    135   5e-33   
gb|EMS47617.1|  Glucan endo-1,3-beta-glucosidase 3                      135   6e-33   
ref|XP_008789820.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   6e-33   
gb|ACF80565.1|  unknown                                                 134   6e-33   
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   6e-33   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg             137   7e-33   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              134   7e-33   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              134   7e-33   
ref|XP_010923877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   7e-33   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             134   8e-33   
ref|XP_004232702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      134   8e-33   
emb|CBI23232.3|  unnamed protein product                                137   8e-33   
gb|KJB10512.1|  hypothetical protein B456_001G204900                    135   8e-33   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              133   1e-32   
ref|XP_002518468.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    134   1e-32   
ref|XP_007012993.1|  O-Glycosyl hydrolases family 17 protein isof...    133   1e-32   
ref|XP_008440948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      134   1e-32   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              133   1e-32   
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   1e-32   
gb|ACU24280.1|  unknown                                                 131   2e-32   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         134   2e-32   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     133   2e-32   
gb|AAO64485.1|  putative beta 1-3-glucanase                             129   2e-32   
gb|KDP20735.1|  hypothetical protein JCGZ_21206                         134   2e-32   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    133   2e-32   
gb|EPS73640.1|  hypothetical protein M569_01113                         133   2e-32   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             133   2e-32   
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    133   2e-32   
ref|XP_002892658.1|  predicted protein                                  133   2e-32   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        133   2e-32   
ref|XP_008777062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
ref|XP_011023920.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                      134   2e-32   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     133   2e-32   
ref|XP_004507681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   3e-32   
emb|CDP04414.1|  unnamed protein product                                136   3e-32   
ref|XP_010052862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    133   3e-32   
ref|XP_010244498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
ref|XP_010244497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_008777063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
dbj|BAC83070.1|  putative elicitor inducible beta-1,3-glucanase         134   4e-32   
ref|XP_008777061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
gb|KJB57758.1|  hypothetical protein B456_009G179400                    132   4e-32   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   4e-32   
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   5e-32   
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   5e-32   
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     132   5e-32   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   5e-32   
gb|AIR93910.1|  glucanase                                               132   5e-32   
ref|XP_004158003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   6e-32   
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      132   6e-32   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     132   7e-32   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     131   7e-32   
ref|XP_006449751.1|  hypothetical protein CICLE_v10014440mg             133   7e-32   
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   8e-32   
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   8e-32   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    131   8e-32   
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      131   8e-32   
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             131   9e-32   
emb|CBI26850.3|  unnamed protein product                                131   9e-32   
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   1e-31   
ref|XP_010553446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-31   
ref|XP_010553445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-31   
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    131   1e-31   
gb|KHG27056.1|  hypothetical protein F383_08405                         131   1e-31   
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     131   1e-31   
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   1e-31   
gb|AAC17632.1|  Similar to glucan endo-1,3-beta-D-glucosidase pre...    131   1e-31   
ref|XP_010059559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    131   1e-31   
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   1e-31   
ref|XP_007153962.1|  hypothetical protein PHAVU_003G079900g             131   1e-31   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     131   1e-31   
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   2e-31   
gb|KHG27055.1|  hypothetical protein F383_08405                         131   2e-31   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      130   2e-31   
gb|KJB22745.1|  hypothetical protein B456_004G064200                    130   2e-31   
gb|KJB15377.1|  hypothetical protein B456_002G174100                    130   2e-31   
ref|XP_003563040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   2e-31   
gb|KHG14816.1|  hypothetical protein F383_17797                         130   2e-31   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     130   2e-31   
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     130   3e-31   
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             130   3e-31   
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   3e-31   
emb|CDY14214.1|  BnaA08g13450D                                          130   3e-31   
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   3e-31   
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      129   4e-31   
gb|ABD91576.1|  beta-1,3-glucanase                                      129   4e-31   
ref|XP_003600716.1|  Glucan endo-1,3-beta-glucosidase                   129   4e-31   
gb|ABD91577.1|  beta-1,3-glucanase                                      129   4e-31   
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-31   
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-31   
gb|AFU52641.1|  beta-1,3-glucanase 6                                    129   5e-31   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                132   5e-31   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     129   5e-31   
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   129   5e-31   
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-31   
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   6e-31   
tpg|DAA62861.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    130   6e-31   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      129   6e-31   
tpg|DAA62864.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    130   6e-31   
tpg|DAA62862.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    130   6e-31   
tpg|DAA62865.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    130   6e-31   
dbj|BAC83956.1|  putative beta-1,3-glucanase                            129   6e-31   
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   6e-31   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               129   8e-31   
gb|EPS74061.1|  hypothetical protein M569_00697                         128   9e-31   
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           128   1e-30   
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    128   1e-30   
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      128   1e-30   
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   1e-30   
emb|CDY62033.1|  BnaC03g77660D                                          128   2e-30   
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   2e-30   
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_010057914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_009127478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_006602009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   3e-30   
gb|ADU15553.1|  GLU                                                     127   3e-30   
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    127   3e-30   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               127   3e-30   
emb|CDY58676.1|  BnaCnng33550D                                          127   4e-30   
ref|XP_010929494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   5e-30   
ref|XP_010929500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   5e-30   
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     126   5e-30   
emb|CDY32869.1|  BnaC09g33160D                                          126   6e-30   
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   7e-30   
gb|EYU27773.1|  hypothetical protein MIMGU_mgv1a006342mg                125   7e-30   
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   7e-30   
emb|CDY16440.1|  BnaA02g12440D                                          125   8e-30   
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             125   8e-30   
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             125   9e-30   
gb|EMT32814.1|  Glucan endo-1,3-beta-glucosidase 3                      126   1e-29   
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               125   1e-29   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   2e-29   
emb|CAN82488.1|  hypothetical protein VITISV_006804                     124   2e-29   
emb|CDY64970.1|  BnaAnng19910D                                          124   3e-29   
ref|XP_010553447.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   3e-29   
gb|KJB62900.1|  hypothetical protein B456_009G442700                    124   3e-29   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     124   3e-29   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    124   5e-29   
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   5e-29   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             124   5e-29   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     123   6e-29   
gb|KJB10513.1|  hypothetical protein B456_001G204900                    124   7e-29   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       123   7e-29   
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   8e-29   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   123   9e-29   
ref|NP_176799.2|  glucan endo-1,3-beta-glucosidase 2                    123   9e-29   
gb|ABI93926.1|  At1g66250                                               123   9e-29   
gb|KHN33020.1|  Glucan endo-1,3-beta-glucosidase 1                      120   1e-28   
gb|KHG04965.1|  hypothetical protein F383_30444                         122   1e-28   
emb|CDY06818.1|  BnaC01g09170D                                          122   1e-28   
emb|CDY68826.1|  BnaA01g34890D                                          122   2e-28   
ref|XP_007147720.1|  hypothetical protein PHAVU_006G149100g             122   2e-28   
ref|XP_006598340.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               122   3e-28   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   3e-28   
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    121   4e-28   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     121   4e-28   
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     120   5e-28   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             120   6e-28   
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   9e-28   
ref|XP_007147719.1|  hypothetical protein PHAVU_006G149100g             120   1e-27   
ref|XP_006300850.1|  hypothetical protein CARUB_v10019942mg             121   1e-27   
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    120   1e-27   
gb|KJB54309.1|  hypothetical protein B456_009G028300                    119   2e-27   
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     119   2e-27   
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         119   2e-27   
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   119   3e-27   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          118   3e-27   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             118   3e-27   



>ref|XP_009631831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631834.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631835.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631836.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
Length=499

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 149/187 (80%), Gaps = 5/187 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSNDTGPPS+ K PI  +IYE+FNEDKRPGP+SERSWGIF  NGS VY ++LG  S+G I
Sbjct  298  VSNDTGPPSQPKNPIDTFIYEMFNEDKRPGPISERSWGIFSINGSEVYSLSLG--SSGGI  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            ++NS+A VFCIA+ GA ENKLQ GI+WACG QG+ANCSAIQ GQPCY PDTLQNHASYAY
Sbjct  356  SDNSTA-VFCIAKKGADENKLQDGINWACG-QGHANCSAIQSGQPCYFPDTLQNHASYAY  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  202
            NDYYQR++SVGGTCDFDGTATTTT DPS  +C FTGSS    G  P  AFGP +P  + S
Sbjct  414  NDYYQRMRSVGGTCDFDGTATTTTQDPSSKTCKFTGSSTPG-GLFPPAAFGPISPTSQSS  472

Query  201  MARAPDI  181
              RA  I
Sbjct  473  TIRASVI  479



>ref|XP_009778460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778464.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778465.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
Length=496

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 151/187 (81%), Gaps = 5/187 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSNDTGPPS+ K PI+ +IYE+FNEDKRPGP+SERSWGIF  NGS +Y ++L GSSAG I
Sbjct  295  VSNDTGPPSQPKNPINTFIYEMFNEDKRPGPISERSWGIFSTNGSEIYSLSL-GSSAG-I  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            ++NS+A VFCIA+ GA ENKLQ GI+WACG QG+ANCSAIQ GQPCY PDTLQNHASYAY
Sbjct  353  SDNSTA-VFCIAKKGADENKLQDGINWACG-QGHANCSAIQSGQPCYFPDTLQNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  202
            NDYYQR++S+GGTCDFDGTATTTT DPS  +C FTGSS    G  P  AFGP +P  +G 
Sbjct  411  NDYYQRMRSLGGTCDFDGTATTTTQDPSSKTCKFTGSSTPG-GLFPPAAFGPISPTSQGP  469

Query  201  MARAPDI  181
              RA  I
Sbjct  470  TIRATVI  476



>gb|KJB23365.1| hypothetical protein B456_004G094500 [Gossypium raimondii]
Length=492

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 151/183 (83%), Gaps = 6/183 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSN++GPPS+  +PI+ YIYELFNEDKRPGP+SE++WG+ F NG+AV+P++LGG S  QI
Sbjct  295  VSNNSGPPSQPTIPINTYIYELFNEDKRPGPISEKNWGLLFTNGTAVFPLSLGGPS--QI  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NS+A VFC+A+  ASE+KL+ GI+WACG QG ANCSAIQ GQPCY P+ ++NHASYAY
Sbjct  353  TGNSTA-VFCVAKDDASEDKLRDGINWACG-QGQANCSAIQSGQPCYLPNNIKNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG--GVPTPAFGPTAPVGK  208
            NDYYQ++ +VGGTCDFDGTATTTT+DPSYGSCIFTGSSNSS G   +P  A GP +P G 
Sbjct  411  NDYYQKMHTVGGTCDFDGTATTTTIDPSYGSCIFTGSSNSSTGRESLPPTALGPISPGGS  470

Query  207  GSM  199
              +
Sbjct  471  TKL  473



>gb|KHG18393.1| hypothetical protein F383_22096 [Gossypium arboreum]
Length=492

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (83%), Gaps = 6/183 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSN++GPPS+  +PI+ YIYELFNEDKRPGP+SE++WG+ F NG+AV+P++LGG S  QI
Sbjct  295  VSNNSGPPSQPTIPINTYIYELFNEDKRPGPISEKNWGLLFTNGTAVFPLSLGGPS--QI  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NS+A VFC+A+  ASE+KL+ G++WACG QG ANCSAIQ GQPCY P+ ++NHASYAY
Sbjct  353  TGNSTA-VFCVAKDDASEDKLRDGLNWACG-QGQANCSAIQSGQPCYLPNNIKNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG--GVPTPAFGPTAPVGK  208
            NDYYQ++ +VGGTCDFDGTATTTT+DPSYGSCIFTGSSNSS G   +P  A GP +P G 
Sbjct  411  NDYYQKMHTVGGTCDFDGTATTTTIDPSYGSCIFTGSSNSSTGRESLPPTALGPISPGGS  470

Query  207  GSM  199
              +
Sbjct  471  TKL  473



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 8/184 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSN++GPPS+  +PI+ YIYELFNEDKRPGP SE++WG+ F NG+AVYP++L GSS  QI
Sbjct  296  VSNNSGPPSQPTIPINTYIYELFNEDKRPGPASEKNWGVLFLNGTAVYPLSLSGSS--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NS+  VFC+A+   SE+KLQ G++WACG QG ANCSAIQ GQPCY P+ ++NHASYAY
Sbjct  354  TGNSTT-VFCVAKDDTSEDKLQDGLNWACG-QGQANCSAIQSGQPCYLPNNIKNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI---GGV-PTPAFGPTAPV  214
            NDYYQ++ S+GGTCDFDGTATTTT +PSYGSCIFTGS NS+    GG+ P  AFGP +P 
Sbjct  412  NDYYQKMHSLGGTCDFDGTATTTTNNPSYGSCIFTGSLNSTTATGGGISPPEAFGPISPF  471

Query  213  GKGS  202
            GK +
Sbjct  472  GKST  475



>ref|XP_006354142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Solanum tuberosum]
Length=501

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 145/188 (77%), Gaps = 4/188 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSNDTGPPS+ K+PI+ +IYE+FNEDKRPGP+SERSWG+F  NGS VY + LG S +   
Sbjct  298  VSNDTGPPSQPKIPINTFIYEMFNEDKRPGPISERSWGVFSTNGSDVYTLGLGSSDSISD  357

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             ++++   FC+A+PGA ENKLQ GI+WACG QG ANCSAIQ G+PCY PDT+QNHASYAY
Sbjct  358  NSSTA---FCVAKPGADENKLQDGINWACG-QGRANCSAIQSGKPCYFPDTIQNHASYAY  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  202
            NDYYQR+ S+GGTCDFDGTAT TT DPS  +C FTGSSNS  G  P  AFGP +   + S
Sbjct  414  NDYYQRMHSLGGTCDFDGTATMTTQDPSSRTCKFTGSSNSGGGVFPPAAFGPISATSQCS  473

Query  201  MARAPDIG  178
              R+P I 
Sbjct  474  TIRSPVIA  481



>ref|XP_010316236.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
 ref|XP_010316237.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
Length=501

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSNDTGPPS+ K+PI+ +IYE+FNEDKRPGP+SERSWGIF  NGS VY + LG S +   
Sbjct  298  VSNDTGPPSQPKIPINTFIYEMFNEDKRPGPISERSWGIFSTNGSDVYSLGLGSSDSISN  357

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             ++S+   FC+A+PGA ENKLQ GI+WACG QG ANCSAIQ GQPCY PDT+QNHASYAY
Sbjct  358  NSSSA---FCVAKPGADENKLQDGINWACG-QGRANCSAIQSGQPCYFPDTIQNHASYAY  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGV-PTPAFGP-TAPVGK  208
            NDYYQR+ S+GGTCDFDGTAT TT DPS  +C FTGSSNS  GGV P  AFGP  AP  +
Sbjct  414  NDYYQRMHSLGGTCDFDGTATMTTQDPSSRTCKFTGSSNS--GGVFPPAAFGPIVAPTSQ  471

Query  207  GSMARAPDIG  178
             S  R+P I 
Sbjct  472  SSTIRSPVIA  481



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTGPPS+  MPI+ Y+YELFNEDKRPGP+SE++WG+FF NG++VYP+N  GS  GQI
Sbjct  296  VLNDTGPPSQPDMPINTYVYELFNEDKRPGPISEKNWGVFFTNGTSVYPLNFSGS--GQI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG+ANCSAIQPGQPCY P+ +++HASYAY
Sbjct  354  IGNSS-GVFCVAKDDADSDKLQNGLNWACG-QGHANCSAIQPGQPCYLPNNIKSHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG--VPTPAFGPTAP  217
            NDYYQ+++SVGGTC+FDGTA TTT DPSYGSC + GSS+SS  G  +P  A GP +P
Sbjct  412  NDYYQKMRSVGGTCNFDGTAMTTTKDPSYGSCTYAGSSHSSTRGGFLPPVASGPVSP  468



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTGPPS+  MPI+ Y+YELFNEDKRPGP+SE++WG+FF NG++VYP+N  GS  GQI
Sbjct  296  VLNDTGPPSQPDMPINTYVYELFNEDKRPGPISEKNWGVFFTNGTSVYPLNFSGS--GQI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG+ANCSAIQPGQPCY P+ +++HASYAY
Sbjct  354  IGNSS-GVFCVAKDDADSDKLQNGLNWACG-QGHANCSAIQPGQPCYLPNNIKSHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG--VPTPAFGPTAP  217
            NDYYQ+++SVGGTC+FDGTA TTT DPSYGSC + GSS+SS  G  +P  A GP +P
Sbjct  412  NDYYQKMRSVGGTCNFDGTAMTTTKDPSYGSCTYAGSSHSSTRGGFLPPVASGPVSP  468



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS   +PI+ YIYELFNEDKRPGPVSE++WG+ + NG+AV+P++  GSS  QI
Sbjct  260  VSNDSGPPSRPNIPINTYIYELFNEDKRPGPVSEKNWGVLYTNGTAVFPLSFSGSS--QI  317

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N++  VFC+A+  ASE KLQ G++WACG QG ANCS IQ GQPCY P+  +NHASYAY
Sbjct  318  MGNATT-VFCVAKDDASEGKLQDGLNWACG-QGQANCSVIQSGQPCYLPNNTKNHASYAY  375

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  208
            NDYYQR+ +VG TCDF GTAT T+ DPSY SCIFTGSSNSS   G +P  AFGP +P+G+
Sbjct  376  NDYYQRMHTVGATCDFGGTATITSNDPSYRSCIFTGSSNSSAREGLLPPGAFGPVSPLGE  435



>ref|XP_011087532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
Length=499

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 5/190 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS+  +PI+ YIYELFNEDKRPGPVSER+WG+ F NG+AVY ++L  S +   
Sbjct  295  VSNDSGPPSQPTIPINTYIYELFNEDKRPGPVSERNWGVLFTNGTAVYDVSLSDSDSLG-  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+S+A  FCIA+PGA E+ L+ G++WACGP G ANC+AIQ GQPCYSP+T+QNHASYAY
Sbjct  354  ANSSTA--FCIARPGADESSLRDGLNWACGP-GQANCAAIQKGQPCYSPNTVQNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGV-PTPAFGPTAPVGKG  205
            NDYYQ+++S GGTCDF GTA+ TT DPSYGSC F GS NSS+GG+ P  A GP  P    
Sbjct  411  NDYYQKMRSSGGTCDFGGTASLTTADPSYGSCRFIGSGNSSMGGLFPPAALGPIGPSSGS  470

Query  204  SMARAPDIGR  175
            S +     GR
Sbjct  471  STSIVLRFGR  480



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS   +PI+ YIYELFNEDKRPGPVSE++WG+ + NG+AV+P++  GSS  QI
Sbjct  296  VSNDSGPPSRPNIPINTYIYELFNEDKRPGPVSEKNWGVLYTNGTAVFPLSFSGSS--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N++  VFC+A+  ASE KLQ G++WACG QG ANCS IQ GQPCY P+  +NHASYAY
Sbjct  354  MGNATT-VFCVAKDDASEGKLQDGLNWACG-QGQANCSVIQSGQPCYLPNNTKNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  208
            NDYYQR+ +VG TCDF GTAT T+ DPSY SCIFTGSSNSS   G +P  AFGP +P+G+
Sbjct  412  NDYYQRMHTVGATCDFGGTATITSNDPSYRSCIFTGSSNSSAREGLLPPGAFGPVSPLGE  471



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 142/189 (75%), Gaps = 4/189 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND GPPS+  +PI  Y+YELFNEDKRPG +SE++WG+FF NG++VYP++  G+S   +
Sbjct  297  VLNDLGPPSQPTIPIRTYVYELFNEDKRPGSISEKNWGLFFTNGTSVYPLSF-GTSDRVV  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N+S  GVFC+A+P A  + LQ G++WACG +G ANCSAIQ GQPCY P+ LQ+HASYAY
Sbjct  356  GNSSGVGVFCVAKPDADSSLLQSGLNWACG-EGQANCSAIQEGQPCYEPNNLQSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVGK  208
            NDY+ ++QS G TCDF  TA TTTVDPS+ SC+F GSS S+  G+ TP  AFGPT  +G 
Sbjct  415  NDYFHKMQSAGATCDFGRTAITTTVDPSHSSCVFMGSSGSNTSGLFTPPSAFGPTGLMGS  474

Query  207  GSMARAPDI  181
             SM + P I
Sbjct  475  SSMLQVPRI  483



>gb|KHG04722.1| hypothetical protein F383_29074 [Gossypium arboreum]
Length=495

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 145/181 (80%), Gaps = 7/181 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS   +P++ YIYELFNEDKR GPVSE++WG+ + NG+AV+P++L GSS  QI
Sbjct  296  VSNDSGPPSRPNIPMNTYIYELFNEDKRRGPVSEKNWGVLYTNGTAVFPLSLSGSS--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N++  VFC+A+  ASE+KLQ G++WACG QG ANCS IQ GQPCY P+ ++NHASYAY
Sbjct  354  MGNATT-VFCVAKDDASEDKLQDGLNWACG-QGQANCSVIQSGQPCYLPNNIKNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI---GGVPTPAFGPTAPVG  211
            NDYYQR+ +VG TCDFDGTAT TT DPSY SCIFTGSS++S    G +P  AFGP +P+G
Sbjct  412  NDYYQRMHTVGATCDFDGTATITTNDPSYRSCIFTGSSSNSSAREGLLPPGAFGPVSPLG  471

Query  210  K  208
            +
Sbjct  472  E  472



>ref|XP_010673492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 6/190 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  MPI+ YIYELFNED+R GPVSE++WG+FF NGS VYP++LGGS  G +
Sbjct  295  VLNNSGPPSQPTMPINTYIYELFNEDERRGPVSEKNWGLFFTNGSTVYPLSLGGS--GPM  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            + NS+  +FCIA+ GA+E+KL+ G++WACG  G+ANC+AIQ G PCY PDT +NHASYAY
Sbjct  353  SGNST-DLFCIAKSGANEDKLRNGLNWACG-DGHANCTAIQEGGPCYYPDTTENHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG-GVPTPAFGPTAP-VGK  208
            NDYYQR+ SVGGTCDFDGTATTT  DPSYGSC FTGS+NS+ G G    A+GP +P  G 
Sbjct  411  NDYYQRMSSVGGTCDFDGTATTTAADPSYGSCGFTGSANSTAGRGFSPTAYGPVSPFTGS  470

Query  207  GSMARAPDIG  178
             S    P+IG
Sbjct  471  KSSMLYPEIG  480



>ref|XP_010257592.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257595.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
Length=514

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 145/190 (76%), Gaps = 5/190 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G PS+  +PI  YIYELFNEDKRPGP+SE++WG+FF NG+ +YP++   SS    
Sbjct  313  VLNDSGSPSQPSLPIRTYIYELFNEDKRPGPLSEKNWGLFFTNGTPIYPLSF-SSSDRLT  371

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+S  G+FC+A+PGA  + LQ G++WACG QG ANCSAIQ GQPCY P+TLQ+HASYAY
Sbjct  372  ANSSGIGLFCVAKPGADVSSLQSGLNWACG-QGQANCSAIQEGQPCYDPNTLQDHASYAY  430

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP--AFGPTAPV-G  211
            NDY+ ++QS+GGTCDF GTATTT VDPS+GSC+F GSS S+  G  TP  A GPT  + G
Sbjct  431  NDYFHKMQSIGGTCDFSGTATTTAVDPSHGSCVFAGSSGSNTTGAITPSTALGPTTSLTG  490

Query  210  KGSMARAPDI  181
              SM +  ++
Sbjct  491  VSSMLQVSEV  500



>ref|XP_003524953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=496

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  + I+ YIYELFNEDKR GPVSE+SWGIF+ NGS VYP+N G S    +
Sbjct  296  VMNDSGPPSQPNIAINTYIYELFNEDKRNGPVSEKSWGIFYTNGSTVYPLNFGAS---DL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               +S+GVFC+A+ GA  +KLQ G+ WACG QG ANC+AIQPGQPCY P+ +++HASYAY
Sbjct  353  ITGNSSGVFCVAKDGADTDKLQSGLSWACG-QGGANCAAIQPGQPCYVPNNVKSHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVG  211
            NDYYQR  S GGTCDFDGTAT TT DPS  SCIF GSSNSS GG+  P  A GP+ P G
Sbjct  412  NDYYQRKHSSGGTCDFDGTATITTKDPSSSSCIFAGSSNSSTGGLSLPPMALGPSGPFG  470



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELFNED+RPGPVS ++WG+ F NGS+VYP++L  S++ QI
Sbjct  296  VLNDSGPPSQPKLPINTYIYELFNEDERPGPVSVKNWGVLFTNGSSVYPLSL--STSNQI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY P+T+ NHASYA+
Sbjct  354  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGQANCTPIQEGQRCYLPNTIANHASYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QSVGGTCDFD TA TT+VDPSYGSC FTGSSNSS IGG+   A  P++ VG
Sbjct  412  NDYYQKMQSVGGTCDFDDTAMTTSVDPSYGSCKFTGSSNSSTIGGLTPAAIAPSSAVG  469



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 144/178 (81%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELFNED+RPGPVS ++WG+ F NGS+VYP++L  S++ QI
Sbjct  296  VLNDSGPPSQPKLPINTYIYELFNEDERPGPVSGKNWGVLFTNGSSVYPLSL--STSNQI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY P+T+ NHASYA+
Sbjct  354  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGQANCTPIQKGQRCYLPNTIANHASYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QSVGGTCDFD TA TTTVDPSYGSC FTGSSNSS IGG+   A  P++ VG
Sbjct  412  NDYYQKMQSVGGTCDFDDTAMTTTVDPSYGSCKFTGSSNSSTIGGLTPAAIAPSSAVG  469



>ref|XP_003531243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN47972.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=496

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 138/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  + I+ YIYELFNEDKR GPVSE++WGIF+ NGS VYP++ G S   QI
Sbjct  296  VMNDSGPPSQPNIAINTYIYELFNEDKRNGPVSEKNWGIFYTNGSTVYPLSFGASD--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+ GA  +KLQ G+ WACG QG ANC+AIQPGQPCY P+ +++HASYAY
Sbjct  354  TGNSS-GVFCVAKDGADTDKLQSGLSWACG-QGGANCAAIQPGQPCYLPNNVKSHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVG  211
            NDYYQR  S GGTCDFDGTAT TT DPS  SCIF GSSNSS GG+  P  A GP+ P G
Sbjct  412  NDYYQRKHSSGGTCDFDGTATITTKDPSSSSCIFAGSSNSSTGGLSLPPTALGPSGPFG  470



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+   PI+ YIYELFNEDKR GPVSE++WG+ F NGS VYP+NLG S  G+ 
Sbjct  296  VLNNSGPPSQPNFPINTYIYELFNEDKRSGPVSEKNWGVLFTNGSTVYPLNLGTS--GRA  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSSA VFC+A+  A  +KLQ+G++WACG QG ANCSAIQPGQPCY PD+L NHASYAY
Sbjct  354  TGNSSA-VFCVAKSDADPDKLQEGLNWACG-QGQANCSAIQPGQPCYLPDSLVNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA  235
            N+YYQR++SVGGTCDFDGTAT T  DPS GSC+F GSSNSS  G+ +P+
Sbjct  412  NNYYQRMRSVGGTCDFDGTATQTDTDPSSGSCVFAGSSNSSGRGLVSPS  460



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 5/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKRPGPVSER+WG+F+PNGS VY ++LGGS   + 
Sbjct  296  VLNNSGPPSQPDIPINTYIYELYNEDKRPGPVSERNWGMFYPNGSMVYRLSLGGSDQAES  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N S   VFC+A+  A   KLQ G++WACG +G ANCSAIQPG+PCY PD L++HAS+AY
Sbjct  356  LNGSV--VFCVAKDDADPEKLQDGLNWACG-RGQANCSAIQPGRPCYLPDNLKSHASFAY  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVG  211
            NDYYQ++++ GG+CDFDGTATTTT DPSYG+C FTGS+N++   G  P  AFGP +P+G
Sbjct  413  NDYYQKMKNAGGSCDFDGTATTTTRDPSYGTCRFTGSANANATGGNFPPAAFGPVSPIG  471



>ref|XP_011048218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048220.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048221.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048222.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016027.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016029.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016033.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016034.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 141/189 (75%), Gaps = 9/189 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ ++PI+ YIYELFNEDKRPGPVSE++WG+FF NGSAVY  +L  S++ Q+
Sbjct  292  VLNDSGPPSQPQVPINTYIYELFNEDKRPGPVSEKNWGLFFTNGSAVYTFSL--STSNQV  349

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N+S   FC+A+P A   KLQ G+DWACG QG ANC AIQ GQPCY P+T QNHASYAY
Sbjct  350  TGNNSD--FCVAKPNADPGKLQAGLDWACG-QGGANCDAIQEGQPCYLPNTYQNHASYAY  406

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS----NSSIGGVPTPAFGPTAPV  214
            NDYYQ+ +SVG TCDFDGTA TTTVDPSYGSC FTGSS    NS+ G   T A GP  P 
Sbjct  407  NDYYQKKRSVGATCDFDGTAATTTVDPSYGSCKFTGSSTITPNSNGGFTTTVAPGPVTPQ  466

Query  213  GKGSMARAP  187
            G  +    P
Sbjct  467  GGSATVNLP  475



>ref|XP_002297638.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
 gb|EEE82443.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
Length=493

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 141/189 (75%), Gaps = 9/189 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELFNEDKRPGPVSE++WG+FF NGSAVY  +L  S++ QI
Sbjct  292  VLNDSGPPSQPKVPINTYIYELFNEDKRPGPVSEKNWGLFFTNGSAVYTFSL--STSNQI  349

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N+S   FC+A+P A   KLQ G+DWACG QG ANC AIQ G+PCY P+T QNHASYAY
Sbjct  350  TGNNSD--FCVAKPNADPGKLQAGLDWACG-QGGANCDAIQEGKPCYLPNTYQNHASYAY  406

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS----NSSIGGVPTPAFGPTAPV  214
            NDYY++ +SVG TCDFDGTA TTTVDPSYGSC FTGSS    NS+ G   T A GP  P 
Sbjct  407  NDYYKKKRSVGATCDFDGTAATTTVDPSYGSCKFTGSSTITPNSNGGFTTTVAPGPVTPQ  466

Query  213  GKGSMARAP  187
            G  +    P
Sbjct  467  GGSATVNLP  475



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 7/179 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+   PI+AYIYELFNEDKRPGPVSE++WG+ F NGS VYP+ LG S+    
Sbjct  296  VLNDSGPPSKPTFPINAYIYELFNEDKRPGPVSEKNWGVLFTNGSTVYPLTLGTST----  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               +S+G+FC+A+  A  +KL+ G++WACG QG A+C+ IQ GQ CY P+TL NHASYAY
Sbjct  352  PTGNSSGLFCVAKSEADPDKLEDGLNWACG-QGQADCTPIQQGQGCYLPNTLVNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGV-PTPAFGPTAPVG  211
            NDYYQR+QSVGGTCDFDGTA TTT+DPSYGSC F+GSSNSS IGG+ P  A  P+  VG
Sbjct  411  NDYYQRMQSVGGTCDFDGTAKTTTIDPSYGSCKFSGSSNSSTIGGLTPVSAIAPSTAVG  469



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+PI+ YIYELFNED+RPGPVSE++WG+F+ NGSAVYP++L  S+  QI
Sbjct  296  VLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY PDT+ NHASYA+
Sbjct  354  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGGANCTPIQKGQRCYLPDTIVNHASYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QS GGTCDFDGTA TTTVDPSYG+C F+GSSNSS   G+   A  P++PVG
Sbjct  412  NDYYQKMQSAGGTCDFDGTAMTTTVDPSYGACKFSGSSNSSAFTGLTPAAIAPSSPVG  469



>ref|XP_009364124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=493

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 6/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELFNEDKRPGPVSE++WG+ + NGSAVYP++L   S+ QI
Sbjct  296  VLNDSGPPSQPKLPINTYIYELFNEDKRPGPVSEKNWGVLYTNGSAVYPLSL---SSSQI  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ GI+WACG QG ANC+ IQ GQ CY PDT+ NHASYAY
Sbjct  353  TGNSS-GVFCMAKANADPDKLQDGINWACG-QGGANCTPIQRGQRCYLPDTIVNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA-FGPTAPVG  211
            NDYYQ+++S GGTCDFD TA  +TVDPSYG+C F+GSSNSS     TPA   P+  VG
Sbjct  411  NDYYQKMKSAGGTCDFDDTAIISTVDPSYGACKFSGSSNSSKFAGLTPASVAPSTAVG  468



>gb|AFK45712.1| unknown [Lotus japonicus]
Length=336

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  +PI+ YIYELFNEDKR GP+SE++WGIF+ NGSAVYP++   S+ GQ+
Sbjct  138  VMNDSGPPSQPSIPINTYIYELFNEDKRNGPISEKNWGIFYTNGSAVYPLSF--SAFGQV  195

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSSA +FC+A+ GA  ++LQ G+ WACG QG ANC+AIQ GQPCY P+ L++HASYAY
Sbjct  196  TGNSSA-IFCVAKDGADADELQTGLSWACG-QGGANCAAIQQGQPCYLPNDLKSHASYAY  253

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  211
            NDYYQ+  + GGTCDFDGTA  TT DPS+GSCIF+GSSN     +P  A GP++P G
Sbjct  254  NDYYQKKNNAGGTCDFDGTAEVTTQDPSHGSCIFSGSSNPGGVSLPPTALGPSSPFG  310



>ref|XP_010673491.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 143/190 (75%), Gaps = 5/190 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  MPI+ YIYELFNED+R GPVSE++WG+FF NGS+VYP++  GS  G +
Sbjct  295  VLNNSGPPSQPTMPINTYIYELFNEDERRGPVSEKNWGLFFTNGSSVYPLSFDGS--GPM  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            + N + G+FCIA+ GA E+KL+ G++WAC   G+ANC+AIQ G PCY PDT++NHASY Y
Sbjct  353  SANFT-GLFCIAKSGADEDKLRNGLNWACSAHGHANCTAIQEGGPCYYPDTIENHASYVY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG-GVPTPAFGPTAP-VGK  208
            NDYYQR+ S GGTCDF GTATTT  DPSYG C FTGS+NS+ G G    A+ P +P  G 
Sbjct  412  NDYYQRMSSFGGTCDFKGTATTTAADPSYGPCDFTGSANSTAGRGFSPTAYDPVSPFTGS  471

Query  207  GSMARAPDIG  178
             S    P+IG
Sbjct  472  KSSMLYPEIG  481



>ref|XP_008384395.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349413.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
Length=494

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELFNEDKRPGPVSE++WG+ + NGSAVYP++L  SS  QI
Sbjct  296  VLNDSGPPSQPKLPINTYIYELFNEDKRPGPVSEKNWGVLYTNGSAVYPLSLSDSS--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC A+  A  +KLQ GI+WACG QG ANC+ IQ GQ CY PDT+ NHASYAY
Sbjct  354  TGNSS-GVFCTAKANADPDKLQDGINWACG-QGGANCTPIQRGQRCYLPDTIVNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA-FGPTAPVG  211
            NDYYQ+++S GGTCDFD TA  +TVDPSYG+C F+GSSNSS     TPA   P+  VG
Sbjct  412  NDYYQKMKSAGGTCDFDDTAIISTVDPSYGACKFSGSSNSSKFTGLTPASVAPSTAVG  469



>emb|CDP16794.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 5/189 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS+  +PI+ YIYELFNEDKRPGP+SER+WGIFFPNGS VYPI+L  S     
Sbjct  299  VSNDSGPPSQPDIPINTYIYELFNEDKRPGPISERNWGIFFPNGSTVYPISLSSSVNVS-  357

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               +S+GVFCIA+  A   KLQ G+++ACG QG ANCSA+Q GQPCY PDTLQ+HASYAY
Sbjct  358  --TNSSGVFCIAKQDADSKKLQNGLNYACG-QGQANCSALQTGQPCYFPDTLQSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGV-PTPAFGPTAPVGKG  205
            NDYYQ++ + GGTCDFDGTATTT+ DPSYGSC FTGSS++S  G+ P PA GP  P  +G
Sbjct  415  NDYYQKMHTFGGTCDFDGTATTTSQDPSYGSCKFTGSSSTSGSGLFPPPALGPVGPSSQG  474

Query  204  SMARAPDIG  178
            S  +    G
Sbjct  475  SSVQVFSFG  483



>ref|XP_004502208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cicer arietinum]
Length=478

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELF+ED R GP+SER WG+F+ NGS+VYP++  GS   +I
Sbjct  278  VLNDSGPPSQPKIPINTYIYELFDEDMRKGPISERHWGLFYSNGSSVYPLSFTGSD--KI  335

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS   FC+A+ GA   K++ G+DWACG QG ANC+AIQ G+PC+ P+ +++HASYAY
Sbjct  336  FGNSSMS-FCVAKDGADAEKIEAGLDWACG-QGRANCAAIQAGRPCFFPNNVKSHASYAY  393

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  208
            NDYYQ++ S GGTCDFD TA  TT DPSYGSCI+ GSSN S   G +P+ A GP  PVG 
Sbjct  394  NDYYQKMHSAGGTCDFDDTAIITTEDPSYGSCIYAGSSNLSTGDGSLPSMALGPVGPVGV  453

Query  207  GSMARAPDI  181
            G   +  ++
Sbjct  454  GLKMQVSNL  462



>ref|XP_010044948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 ref|XP_010044949.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 gb|KCW87080.1| hypothetical protein EUGRSUZ_B03614 [Eucalyptus grandis]
Length=495

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+  +PI+ YIYELFNEDKRPGPVSE++WG+FF NG++VYP++LG S  G+I
Sbjct  296  VLNGSGPPSQSDVPINTYIYELFNEDKRPGPVSEKNWGVFFTNGTSVYPLSLGTS--GRI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS G+FC+A+  A  ++LQ G++WACG QG+ANC+AIQ GQPCYSP+T+ NHASYAY
Sbjct  354  TGNSS-GIFCVAKQDADSDRLQDGLNWACG-QGHANCAAIQEGQPCYSPNTVANHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  202
            NDYYQ++Q VGGTCDF GTA TTTVDPSYGSC FTGSSNSS       A  P +P+G GS
Sbjct  412  NDYYQKMQGVGGTCDFQGTAMTTTVDPSYGSCKFTGSSNSSSTVTTPVASAPFSPIGGGS  471



>ref|XP_004502207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cicer arietinum]
Length=506

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K+PI+ YIYELF+ED R GP+SER WG+F+ NGS+VYP++  GS   +I
Sbjct  306  VLNDSGPPSQPKIPINTYIYELFDEDMRKGPISERHWGLFYSNGSSVYPLSFTGSD--KI  363

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS   FC+A+ GA   K++ G+DWACG QG ANC+AIQ G+PC+ P+ +++HASYAY
Sbjct  364  FGNSSMS-FCVAKDGADAEKIEAGLDWACG-QGRANCAAIQAGRPCFFPNNVKSHASYAY  421

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  208
            NDYYQ++ S GGTCDFD TA  TT DPSYGSCI+ GSSN S   G +P+ A GP  PVG 
Sbjct  422  NDYYQKMHSAGGTCDFDDTAIITTEDPSYGSCIYAGSSNLSTGDGSLPSMALGPVGPVGV  481

Query  207  GSMARAPDI  181
            G   +  ++
Sbjct  482  GLKMQVSNL  490



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 139/178 (78%), Gaps = 6/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+  +P++ YIYEL+NEDKR GPVSER+WG+F+ NGSAVYP++L GS    +
Sbjct  296  VMNGSGPPSQPDIPVNTYIYELYNEDKRSGPVSERNWGMFYSNGSAVYPLSLSGSEPAAL  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N S GVFC+A+     +KLQ G++WACG QG ANC+AIQ GQPCY P+ L++HAS+AY
Sbjct  356  --NGSGGVFCMAREETDPDKLQDGLNWACG-QGRANCAAIQQGQPCYLPNNLKSHASFAY  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI---GGVPTPAFGPTAP  217
            NDYYQ+++SVGGTCDFDGTA TTT DPSYG CI+TGS+N++    G  P  AFGP +P
Sbjct  413  NDYYQKMRSVGGTCDFDGTAITTTRDPSYGKCIYTGSANANATGGGNFPPAAFGPVSP  470



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+PI+ YIYELFNED+RPGPVSE++WG+F+ NGSAVYP++L  S+  QI
Sbjct  271  VLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QI  328

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY PD++ NHASYA+
Sbjct  329  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGGANCTPIQKGQRCYLPDSIVNHASYAF  386

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QS GGTCDFDGTA TTTVDPS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  387  NDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  444



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+PI+ YIYELFNED+RPGPVSE++WG+F+ NGSAVYP++L  S+  QI
Sbjct  277  VLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QI  334

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY PD++ NHASYA+
Sbjct  335  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGGANCTPIQKGQRCYLPDSIVNHASYAF  392

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QS GGTCDFDGTA TTTVDPS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  393  NDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  450



>ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=436

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 148/185 (80%), Gaps = 6/185 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  +PI  YIYELFNEDKRPGPVSER+WG++F NG+AVY ++L  S++ +I
Sbjct  236  VLNDSGPPSQPTIPISTYIYELFNEDKRPGPVSERNWGLYFTNGTAVYSLSL--SASDRI  293

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS+ VFC+A+  A   KLQ+G++WACG QG ANC+AIQ G+PCY+P+ +QNHASYAY
Sbjct  294  TGNSSS-VFCVAKQNADSAKLQEGLNWACG-QGGANCTAIQEGRPCYAPNNIQNHASYAY  351

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVGK  208
            NDYYQ++ S GGTCDFDG+ATTTTVDPSYGSCIFTGSSNSS  G   P  AFGP +P G 
Sbjct  352  NDYYQKMHSAGGTCDFDGSATTTTVDPSYGSCIFTGSSNSSTSGGIFPPVAFGPISPQGG  411

Query  207  GSMAR  193
             +  R
Sbjct  412  STSLR  416



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+PI+ YIYELFNED+RPGPVSE++WG+F+ NGSAVYP++L  S+  QI
Sbjct  296  VLNGSGPPSQPKLPINTYIYELFNEDQRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+  A  +KLQ G++WACG QG ANC+ IQ GQ CY PD++ NHASYA+
Sbjct  354  TGNSS-GVFCVAKADADPDKLQDGLNWACG-QGGANCTPIQKGQRCYLPDSIVNHASYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ++QS GGTCDFDGTA TTTVDPS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  412  NDYYQKMQSAGGTCDFDGTAMTTTVDPSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  469



>gb|KHN12071.1| Glucan endo-1,3-beta-glucosidase 4, partial [Glycine soja]
Length=501

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 140/183 (77%), Gaps = 8/183 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+ I+ Y+YELFNEDKR GP+SER+WG+F+ NGS+VY ++    SA  +
Sbjct  299  VINGSGPPSQPKIAINTYLYELFNEDKRKGPISERNWGVFYANGSSVYSLSF---SASNM  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            +N +S G FC+A+  A  +KLQ G+ WACG QG ANC AIQPG+PCYSP+ ++NHASYAY
Sbjct  356  SNANSQGSFCVAKDDADTDKLQAGLSWACG-QGQANCIAIQPGRPCYSPNNVKNHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA----FGPTAPV  214
            NDYYQ++ + GGTCDFDGTATTTT DPSYGSCI+ GS+N+  GG  + +     GP +PV
Sbjct  415  NDYYQKMHNAGGTCDFDGTATTTTEDPSYGSCIYAGSANTRNGGRSSSSTALGLGPVSPV  474

Query  213  GKG  205
            G G
Sbjct  475  GAG  477



>ref|XP_006601114.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=498

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 140/183 (77%), Gaps = 8/183 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+ I+ Y+YELFNEDKR GP+SER+WG+F+ NGS+VY ++    SA  +
Sbjct  296  VINGSGPPSQPKIAINTYLYELFNEDKRKGPISERNWGVFYANGSSVYSLSF---SASNM  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            +N +S G FC+A+  A  +KLQ G+ WACG QG ANC AIQPG+PCYSP+ ++NHASYAY
Sbjct  353  SNANSQGSFCVAKDDADTDKLQAGLSWACG-QGQANCIAIQPGRPCYSPNNVKNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA----FGPTAPV  214
            NDYYQ++ + GGTCDFDGTATTTT DPSYGSCI+ GS+N+  GG  + +     GP +PV
Sbjct  412  NDYYQKMHNAGGTCDFDGTATTTTEDPSYGSCIYAGSANTRNGGRSSSSTALGLGPVSPV  471

Query  213  GKG  205
            G G
Sbjct  472  GAG  474



>ref|XP_006596127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN20600.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=501

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+ I+ Y+YELFNEDKR GP+SER+WG+F+ NGS+VY ++    SA  +
Sbjct  299  VLNGSGPPSQPKIAINTYLYELFNEDKRKGPISERNWGVFYANGSSVYSLSF---SAANM  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            +N +S G FC+A+  A  +KLQ G+ WACG QG ANC AIQPG+PCYSP+ +++HASYAY
Sbjct  356  SNANSLGSFCVAKDDADTDKLQAGLSWACG-QGQANCVAIQPGRPCYSPNNVKSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA----FGPTAPV  214
            NDY+Q++ + GGTCDFDGTAT TT DPSYGSCI+ GS+N+SIGG  + +     GP +P+
Sbjct  415  NDYFQKMHNAGGTCDFDGTATKTTEDPSYGSCIYAGSANASIGGRSSSSTALGLGPVSPI  474

Query  213  G  211
            G
Sbjct  475  G  475



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 141/179 (79%), Gaps = 5/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKR GPVSER+WGI FPNG++VYP++L G S    
Sbjct  296  VLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSNSAA  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N+SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPGQPCY P+ +++HAS+A+
Sbjct  356  LNDSS--MFCVAKADADDDKLIDGLNWACG-QGRANCAAIQPGQPCYLPNDVKSHASFAF  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVG  211
            NDYYQ+++S GGTCDFDGTA TTT DPSY +C +TGS  +NS+ G  P  A GP +P+G
Sbjct  413  NDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAYTGSLNANSTGGNFPPNALGPVSPLG  471



>gb|AFU52654.1| beta-1,3-glucanase 21 [Solanum tuberosum]
Length=443

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSNDTGPPS+ K+PI+ +IYE+FNEDKRPGP+SERSWG+F  NGS VY + LG S +   
Sbjct  298  VSNDTGPPSQPKIPINTFIYEMFNEDKRPGPISERSWGVFSTNGSDVYTLGLGSSDSISD  357

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             ++++   FC+A+PGA ENKLQ GI+WACG QG ANCSAIQ GQPCY PDT+QNHASYAY
Sbjct  358  NSSTA---FCVAKPGADENKLQDGINWACG-QGRANCSAIQSGQPCYFPDTIQNHASYAY  413

Query  381  NDYYQRVQSV  352
            NDYYQR+ S+
Sbjct  414  NDYYQRMHSL  423



>ref|XP_003601614.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES71865.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFF-PNGSAVYPINLGGSSAGQ  565
            V ND+GPPS+ KM I+ YIYELF+EDKR GP+SER WG+F+  NGS+VYP++   SS+ +
Sbjct  296  VLNDSGPPSQPKMAINTYIYELFDEDKRTGPISERHWGLFYTTNGSSVYPLSF--SSSNK  353

Query  564  IANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
            +  NSS   FC+A+ GA   K++ G+DWACG QG ANC+AIQ G+PCY P+ +++HASYA
Sbjct  354  VFGNSSKS-FCVAKDGADAEKMEAGLDWACG-QGRANCAAIQAGRPCYFPNDVKSHASYA  411

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG---VPTPAFGPTAP-  217
            YNDYYQ++ SVGGTCDFD TA  TT DPS+GSCI+ GSSN S GG     + AFGP +P 
Sbjct  412  YNDYYQKMNSVGGTCDFDDTAMITTEDPSHGSCIYAGSSNLSTGGDGSFSSIAFGPVSPN  471

Query  216  VGKG  205
            +G G
Sbjct  472  IGAG  475



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V+ND+GPPS+  +PI+ YIYELFNEDKR GP S R+WG+ F NG+AVY I L  S++  +
Sbjct  295  VANDSGPPSQPAIPINTYIYELFNEDKRVGPESGRNWGVLFTNGTAVYDIKL--STSESL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSSA VFCIA+ GA E  LQ G++WACGP G ANC  IQ GQPCY P+TLQNHASYAY
Sbjct  353  DANSSA-VFCIARSGADETSLQDGLNWACGP-GQANCGPIQQGQPCYIPNTLQNHASYAY  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG  253
            NDYYQ+++S GGTCDF GTATTTTVDPSYGSC FTGS NSS G
Sbjct  411  NDYYQKMRSSGGTCDFGGTATTTTVDPSYGSCRFTGSLNSSTG  453



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  MPI+ YIYEL++EDKR GPVSE++WGI FPNG++VYP++L G S    
Sbjct  296  VLNDSGPPSQPDMPINTYIYELYSEDKRTGPVSEKNWGILFPNGTSVYPLSLSGGSNSAS  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPG PCY P+ +++HAS+AY
Sbjct  356  VNGSS--MFCVAKADADDDKLVDGLNWACG-QGQANCAAIQPGHPCYLPNNVKSHASFAY  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG--SSNSSIGGVPTPAFGPTAPVG  211
            NDY+Q+++S GGTCDF GTA TTT DPSY +C +TG  S+N++ G  P  A GP +P+G
Sbjct  413  NDYFQKMKSAGGTCDFSGTAITTTRDPSYKTCAYTGSLSANATGGDFPPSALGPASPLG  471



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND GPPS+  +PI  Y+YELFNEDKRPG +SE++WG+FF NG++VYP++  G+S   +
Sbjct  297  VLNDLGPPSQPTIPIRTYVYELFNEDKRPGSISEKNWGLFFTNGTSVYPLSF-GTSDRVV  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N+S  GVFC+A+P A  + LQ G++WACG +G ANCSAIQ GQPCY P+ LQ+HASYAY
Sbjct  356  GNSSGVGVFCVAKPDADSSLLQSGLNWACG-EGQANCSAIQEGQPCYEPNNLQSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            NDY+ ++QS G TCDF  TA TTTVDPS+ SC+F GS
Sbjct  415  NDYFHKMQSAGATCDFGRTAITTTVDPSHSSCVFMGS  451



>ref|XP_004139073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
 gb|KGN66575.1| hypothetical protein Csa_1G630300 [Cucumis sativus]
Length=495

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 128/155 (83%), Gaps = 5/155 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS+  +PI+ YIYELFNEDKRPGP+SE++WGI FPNGSAVYP++   S +G+ 
Sbjct  295  VSNDSGPPSQPTIPINTYIYELFNEDKRPGPISEKNWGILFPNGSAVYPLS---SMSGRA  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS  V+C+A+ GA E+KLQ G++WACG QG ANC+AIQ G+PC+ P+ + +HASYAY
Sbjct  352  TANSSV-VYCVAKDGADEDKLQDGLNWACG-QGGANCAAIQQGRPCFLPNNITDHASYAY  409

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT  277
            NDYYQ+++  GGTCDFD TA  TTVDPS+GSCIFT
Sbjct  410  NDYYQKMRGAGGTCDFDSTAMLTTVDPSHGSCIFT  444



>ref|XP_003629715.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04191.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  +PI+ YIYELFNEDKR GPVSE++WGI + NGSAVYP++ GG+S    
Sbjct  296  VLNDSGPPSQPNIPINTYIYELFNEDKRNGPVSEKNWGIVYTNGSAVYPLSYGGASGQIT  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +S G+FC+A+ GA  +KLQ G+ WACG QG ANC+ IQ GQ CY P+ +++HASYAY
Sbjct  356  GSGNSTGIFCVAKDGADTDKLQNGLSWACG-QGGANCAPIQQGQRCYLPNNVKSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            NDYYQ+ Q VGGTCDFDGTA  T+ DPSYGSC F GSS +    +P  A GP++
Sbjct  415  NDYYQKNQGVGGTCDFDGTAEITSKDPSYGSCRFPGSSGAGGVSLPPTALGPSS  468



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL++EDKR GPVSE++WGI FPNG++VYP++L G +    
Sbjct  296  VLNNSGPPSQPGIPINTYIYELYSEDKRAGPVSEKNWGILFPNGTSVYPLSLSGGANSAS  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPG PCY PD +++HAS+AY
Sbjct  356  PNGSS--LFCVAKADAEDDKLVDGLNWACG-QGQANCAAIQPGHPCYLPDNIKSHASFAY  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVG  211
            NDYYQ+++S GGTCDF GTA TTT DPSY +C +TGS  +N++ G  P  A GP +P+G
Sbjct  413  NDYYQKMKSAGGTCDFSGTAITTTRDPSYKTCAYTGSLTANATGGNFPPTALGPVSPLG  471



>ref|XP_011087559.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Sesamum indicum]
Length=440

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 109/129 (84%), Gaps = 4/129 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS+  +PI+ YIYELFNEDKRPGPVSER+WG+ F NG+AVY ++L  S +   
Sbjct  295  VSNDSGPPSQPTIPINTYIYELFNEDKRPGPVSERNWGVLFTNGTAVYDVSLSDSDSLG-  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+S+A  FCIA+PGA E+ L+ G++WACGP G ANC+AIQ GQPCYSP+T+QNHASYAY
Sbjct  354  ANSSTA--FCIARPGADESSLRDGLNWACGP-GQANCAAIQKGQPCYSPNTVQNHASYAY  410

Query  381  NDYYQRVQS  355
            NDYYQ+++S
Sbjct  411  NDYYQKMRS  419



>gb|EYU27069.1| hypothetical protein MIMGU_mgv1a004989mg [Erythranthe guttata]
Length=501

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 137/190 (72%), Gaps = 6/190 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V+N++GPPS+   PIH YIYELFNEDKR G VSERSWG+ F NGS VY ++L   S   +
Sbjct  295  VANESGPPSQRSFPIHTYIYELFNEDKRGGDVSERSWGLVFANGSTVYDLSLSDGSEDDV  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              N S  VFCIA+ GA E+ L+ GI+WACGP G ANC  +Q G+ CY PDTLQNHAS+AY
Sbjct  355  --NGSVSVFCIARQGAEESGLRDGINWACGP-GRANCGPVQEGRACYMPDTLQNHASFAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG-VPTPAFGPTAPVGKG  205
            NDYYQ+++  GGTCDF GTA  T+VDPSYGSC FTGSSNSS  G  P+PAFGP  P    
Sbjct  412  NDYYQKMRGAGGTCDFGGTAVITSVDPSYGSCRFTGSSNSSTSGPFPSPAFGPVGPSSGS  471

Query  204  SMARAPDIGR  175
            S  R  DI R
Sbjct  472  S--RNVDIFR  479



>emb|CAN72077.1| hypothetical protein VITISV_020314 [Vitis vinifera]
Length=473

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL NEDKR GPVSER+WG+F  NG+AVYP  L  S++ Q 
Sbjct  296  VLNNSGPPSQPDIPINTYIYELLNEDKRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQA  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS  VFC+A+ GA  + L+KG++WACG Q   NC+AIQ GQPCYSP+T QNHASYAY
Sbjct  354  TGNSST-VFCVAKEGADSDDLEKGLNWACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            NDYYQ+++S GGTCDF GTATTTT DPSYGSCIF+GS
Sbjct  412  NDYYQKMRSGGGTCDFRGTATTTTADPSYGSCIFSGS  448



>ref|XP_008450301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis melo]
Length=495

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VSND+GPPS+  +PI+ Y+YELFNEDKRPGP+SE++WGI FPNGSAVYP++L    +G+ 
Sbjct  295  VSNDSGPPSQPTIPINTYLYELFNEDKRPGPISEKNWGILFPNGSAVYPLSL---MSGRA  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS  V+C+A+ GA E+KLQ G++WACG QG ANC+AIQ G+PC+ P+ + +HASYAY
Sbjct  352  TANSSE-VYCVAKDGADEDKLQDGLNWACG-QGGANCAAIQQGRPCFLPNNITDHASYAY  409

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPT-PAFGPT  223
            NDYYQ+++  GGTCDFDGTAT TTVDPS+GSCIFTGSSNSS GG  + PA GP+
Sbjct  410  NDYYQKMRGAGGTCDFDGTATLTTVDPSHGSCIFTGSSNSSGGGGFSPPALGPS  463



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKR GPVSER+WGI FPNG++VYP++L G S+   
Sbjct  260  VLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAA  319

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPGQPCY P+ +++HAS+A+
Sbjct  320  LNGSS--MFCVAKADADDDKLVDGLNWACG-QGRANCAAIQPGQPCYLPNDVKSHASFAF  376

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVGK  208
            NDYYQ+++S GGTCDFDGTA TTT DPSY +C +TGS  +N++ G  P  A GP +P+G 
Sbjct  377  NDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAYTGSLNANATNGNFPPDALGPASPLGG  436

Query  207  GSMAR  193
             + AR
Sbjct  437  NANAR  441



>gb|AFK37243.1| unknown [Medicago truncatula]
Length=498

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  +PI+ YIYELFNEDKR GPVSE++WGI + NGSAVYP++ GG+S    
Sbjct  296  VLNDSGPPSQPNIPINTYIYELFNEDKRNGPVSEKNWGIVYTNGSAVYPLSYGGASGQIT  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +S G+FC+A+ GA  +KLQ G+ WACG QG ANC+ IQ GQ CY P+ +++HAS+AY
Sbjct  356  GSGNSTGIFCVAKDGADTDKLQNGLSWACG-QGGANCAPIQQGQRCYLPNNVKSHASHAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            NDYYQ+ Q VGGTCDFDGTA  T+ DPSYGSC F GSS +    +P  A GP++
Sbjct  415  NDYYQKNQGVGGTCDFDGTAEITSKDPSYGSCRFPGSSGAGGVSLPPTALGPSS  468



>ref|XP_011025159.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025160.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025161.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025162.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 123/154 (80%), Gaps = 5/154 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+ K PI+ YIYE+FNEDKRPGPVSE++WG+FF NGS+VY  +L  S++ +I
Sbjct  292  VQNDSGPPSQPKFPINTYIYEMFNEDKRPGPVSEKNWGLFFTNGSSVYTFSL--STSNRI  349

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS   FC+A+P A   KLQ G++WACG QG ANCSAIQ GQPCY P+T QNHASYAY
Sbjct  350  TGNSSD--FCVAKPNADPGKLQVGLNWACG-QGGANCSAIQEGQPCYLPNTYQNHASYAY  406

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            NDYYQ++   G TCDFDGTATTTT +PSYGSC F
Sbjct  407  NDYYQKMHLAGATCDFDGTATTTTANPSYGSCKF  440



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKR GPVSER+WGI FPNG++VYP++L G S+   
Sbjct  296  VLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAA  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPGQPCY P+ +++HAS+A+
Sbjct  356  LNGSS--MFCVAKADADDDKLVDGLNWACG-QGRANCAAIQPGQPCYLPNDVKSHASFAF  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVGK  208
            NDYYQ+++S GGTCDFDGTA TTT DPSY +C +TGS  +N++ G  P  A GP +P+G 
Sbjct  413  NDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAYTGSLNANATNGNFPPDALGPASPLGG  472

Query  207  GSMAR  193
             + AR
Sbjct  473  NANAR  477



>ref|XP_010651370.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Vitis 
vinifera]
Length=431

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL NEDKR GPVSER+WG+F  NG+AVYP  L  S++ Q 
Sbjct  233  VLNNSGPPSQPDIPINTYIYELLNEDKRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQA  290

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS  VFC+A+ GA  + L+KG++WACG Q   NC+AIQ GQPCYSP+T QNHASYAY
Sbjct  291  TGNSST-VFCVAKEGADSDDLEKGLNWACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAY  348

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            NDYYQ+++S GGTCDF GTATTTT DPSYGSCIF
Sbjct  349  NDYYQKMRSGGGTCDFRGTATTTTADPSYGSCIF  382



>ref|XP_010651369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Vitis 
vinifera]
Length=494

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 4/154 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL NEDKR GPVSER+WG+F  NG+AVYP  L  S++ Q 
Sbjct  296  VLNNSGPPSQPDIPINTYIYELLNEDKRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQA  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS  VFC+A+ GA  + L+KG++WACG Q   NC+AIQ GQPCYSP+T QNHASYAY
Sbjct  354  TGNSST-VFCVAKEGADSDDLEKGLNWACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            NDYYQ+++S GGTCDF GTATTTT DPSYGSCIF
Sbjct  412  NDYYQKMRSGGGTCDFRGTATTTTADPSYGSCIF  445



>ref|XP_007161273.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
 gb|ESW33267.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
Length=503

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 142/184 (77%), Gaps = 8/184 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+ K+ ++ Y+YELFNEDKR GP+SE++WG+F+ NGS+VYP++    SA  +
Sbjct  299  VLNGSGPPSQPKIALNTYLYELFNEDKRKGPISEKNWGVFYANGSSVYPLSF---SASNL  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N +S G FC+A+  +  +KLQ G+ WACG QG ANC AIQPG+PCY P+ +++HASYAY
Sbjct  356  RNGNSLGSFCVAKDDSDTDKLQAGLSWACG-QGQANCVAIQPGRPCYYPNNVKSHASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAF----GPTAPV  214
            NDYYQ++ + GGTCDFDGTATTTT DPSYGSCI+ GS+NSSIGG  + +     GP +PV
Sbjct  415  NDYYQKMHNAGGTCDFDGTATTTTEDPSYGSCIYAGSANSSIGGRSSSSSAVGPGPVSPV  474

Query  213  GKGS  202
            G G+
Sbjct  475  GVGA  478



>ref|XP_004504325.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cicer arietinum]
Length=496

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPS+  +P++ YIYELFNED R GP+SE++WGI + NGS VYP++ G S    I
Sbjct  296  VLNGSGPPSQPNLPVNTYIYELFNEDNRNGPISEKNWGIVYTNGSTVYPLSYGASVP--I  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSSA VFC+A+ GA  +KLQ G+ WACG QG ANC+ IQ GQ CY P+ +++HASYAY
Sbjct  354  TGNSSASVFCVAKDGADTDKLQAGLSWACG-QGGANCAPIQSGQRCYLPNNVKSHASYAY  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            NDYYQ+    GGTCDFDGTA  T  DPSYGSC FTGSS +  +   PT A GPT+P G
Sbjct  413  NDYYQKNHGAGGTCDFDGTAEVTAKDPSYGSCKFTGSSGADGLSLPPTTAQGPTSPSG  470



>ref|XP_007159412.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 ref|XP_007159413.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31406.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31407.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
Length=492

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  + I+ YIYELFNEDKR GPVSE++WGIF+ NGS V+P++ G S   QI
Sbjct  296  VMNDSGPPSQPNIAINTYIYELFNEDKRNGPVSEKNWGIFYTNGSTVFPLSFGASD--QI  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSS GVFC+A+ GA  +KLQ G+ WACG QG ANC+AIQ GQPCY P+ +++HASYAY
Sbjct  354  TGNSS-GVFCVAKDGADTDKLQAGLSWACG-QGGANCAAIQQGQPCYLPNNVKSHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT-GSSNSSIGGVPTPAFGPTAP  217
            NDYYQ+  + GGTCDFDGTAT T+ DPS  SCIFT  S++S    +P  A GP++P
Sbjct  412  NDYYQKKHNGGGTCDFDGTATITSKDPSSSSCIFTGSSNSSGGLSIPPTALGPSSP  467



>gb|KDP42112.1| hypothetical protein JCGZ_01900 [Jatropha curcas]
Length=496

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 144/182 (79%), Gaps = 6/182 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+GPPS+  +PI+ YIYELFNEDKRPGPVSE++WGIFF NG++VY   L  S++ ++
Sbjct  296  VLNDSGPPSQPTIPINTYIYELFNEDKRPGPVSEKNWGIFFTNGTSVYTFRL--STSNRL  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
              NSSA VFC+A+  A   KL++G++WACG QG ANC+ IQ G PC++PDT QNHASYAY
Sbjct  354  TGNSSA-VFCVAKQNADPAKLKEGLNWACG-QGGANCTPIQQGHPCFAPDTYQNHASYAY  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSC-IFTGSSNSSIGGVPTP-AFGPTAPVGK  208
            NDYYQ+++  GGTCDFDGTATTTT+DPSYGSC     S++S+ GG+ +P AFGP +P G+
Sbjct  412  NDYYQKMRGAGGTCDFDGTATTTTIDPSYGSCTFTGSSNSSTSGGIFSPVAFGPISPQGE  471

Query  207  GS  202
             +
Sbjct  472  SA  473



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 134/180 (74%), Gaps = 12/180 (7%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINL--GGSSAG  568
            V N++GPPS   +PI+ YIYEL+NEDK  GPVSER+WGI FPNG++VYP+ L  G  SAG
Sbjct  293  VLNNSGPPSRPDIPINTYIYELYNEDKLSGPVSERNWGILFPNGTSVYPLGLTDGSESAG  352

Query  567  QIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASY  388
                   + +FC+A+  A E++L+ G++WACG QG ANC+ IQPGQ C+ P+ +++HAS+
Sbjct  353  -------STLFCVAKADAEEDELEGGLNWACG-QGGANCALIQPGQACFFPNDIKSHASF  404

Query  387  AYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPV  214
            AYNDYYQ+ +S GGTCDF GTA TTT DPSY +C +TGS  +N++ G  PT A GP +P+
Sbjct  405  AYNDYYQKKKSTGGTCDFSGTAITTTRDPSYKTCAYTGSPNANATGGNFPTTALGPVSPL  464



>ref|XP_010500722.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010500729.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  MPI+ YIYEL++EDKR GPVSE++WGI FPNG++VYP++L GSS    
Sbjct  296  VLNNSGPPSQPDMPINTYIYELYSEDKRSGPVSEKNWGILFPNGTSVYPLSLSGSSNSAS  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+    ++KL  G++WACG QG ANC+AIQPG PCY P+ +++HAS+A+
Sbjct  356  LNGSS--MFCVAKADVDDDKLVDGLNWACG-QGQANCAAIQPGHPCYLPNNVKSHASFAF  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG--SSNSSIGGVPTPAFGPTAPVG  211
            NDYYQ+++S GGTCDF GTA TTT DPSY +C +TG  S+N++ G  P  A GP +P+G
Sbjct  413  NDYYQKMKSAGGTCDFSGTAITTTRDPSYKTCAYTGSLSANATGGDFPPSALGPVSPLG  471



>ref|XP_010934539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934546.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934552.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
Length=492

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS    P++ YI+ELFNED RPGP+SE+SWG+FFPNG+ VY +     S    
Sbjct  296  VLNGSGTPSRPNAPVNTYIHELFNEDLRPGPISEKSWGVFFPNGTTVYSLRFEHLSDPNA  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    GVFCIA   A  N+L+KG+DWACG  G+ANCSAIQPGQPCY  D L   ASYAY
Sbjct  356  DSAGLVGVFCIANSSADVNELKKGLDWACG-AGSANCSAIQPGQPCYESDNLVVVASYAY  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  217
            NDYY R Q+ GGTC+F+ TA  TT DPS+GSCIF GS  SN++ G V   AF P +P
Sbjct  415  NDYYHRTQANGGTCNFNNTAMITTTDPSHGSCIFAGSSGSNNTSGDV---AFAPVSP  468



>ref|XP_009388453.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 118/177 (67%), Gaps = 1/177 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+    +  YIYELFNED RPGPVSE++WGIFF N +AVY ++ G  +  + 
Sbjct  264  VLNNSGTPSQPTTAVSTYIYELFNEDLRPGPVSEKNWGIFFSNETAVYSLSFGNQAVSKP  323

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
                  GVFC+A P A  N L+KG+DWACGP G ANC+AI PG+PCY    L   ASYAY
Sbjct  324  DPTGLVGVFCVANPSADSNALKKGLDWACGP-GEANCTAILPGEPCYDASNLVALASYAY  382

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  211
            NDYY R+++ GGTC F  TA  ++ +PS+GSCIF GSS  S     + AFGP+   G
Sbjct  383  NDYYHRMKASGGTCSFGNTAMISSTNPSHGSCIFAGSSGPSNSTDSSSAFGPSISYG  439



>ref|XP_009388452.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=494

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 118/177 (67%), Gaps = 1/177 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+    +  YIYELFNED RPGPVSE++WGIFF N +AVY ++ G  +  + 
Sbjct  295  VLNNSGTPSQPTTAVSTYIYELFNEDLRPGPVSEKNWGIFFSNETAVYSLSFGNQAVSKP  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
                  GVFC+A P A  N L+KG+DWACGP G ANC+AI PG+PCY    L   ASYAY
Sbjct  355  DPTGLVGVFCVANPSADSNALKKGLDWACGP-GEANCTAILPGEPCYDASNLVALASYAY  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  211
            NDYY R+++ GGTC F  TA  ++ +PS+GSCIF GSS  S     + AFGP+   G
Sbjct  414  NDYYHRMKASGGTCSFGNTAMISSTNPSHGSCIFAGSSGPSNSTDSSSAFGPSISYG  470



>ref|XP_009146477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
 ref|XP_009146478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
Length=502

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 136/180 (76%), Gaps = 4/180 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKR GP SE++WG+F+PNG++VYP+ L GS  G  
Sbjct  297  VLNNSGPPSKPDIPINTYIYELYNEDKRSGPESEKNWGMFYPNGTSVYPLGLSGSGGGGG  356

Query  561  ANNSSAG--VFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASY  388
             + +  G  +FC+A+  A ++KL+ G++WACG QG ANC  IQPGQ CY P+ +++HAS+
Sbjct  357  GSEALNGTTLFCVAKVDADDDKLEDGLNWACG-QGRANCGPIQPGQACYLPNDIKSHASF  415

Query  387  AYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  211
            AYNDYYQ+++ VGGTCDFDGTA TT  DPSY +C +TGS N++  GG   PA GP + VG
Sbjct  416  AYNDYYQKMKGVGGTCDFDGTAITTPRDPSYRTCAYTGSPNANGTGGNFPPALGPASQVG  475



>ref|XP_008789143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS   +P++ YI+ELFNED RPGP+SE++WG+FFPNG+ VY +     S    
Sbjct  290  VLNGSGTPSRPTLPVNTYIHELFNEDLRPGPISEKNWGVFFPNGTTVYSLTFEHLSDPSA  349

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             ++   G+FC+A   A  N++++G+DWACG  G+ANCSAIQPGQPCY  D L + ASYAY
Sbjct  350  DSSGLVGLFCVANSSADLNEVKEGLDWACGA-GSANCSAIQPGQPCYESDNLVDVASYAY  408

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  202
            NDYY R Q+ GGTC+F+ TA  TT DPS+GSCIF   S+ S       AF P +P    +
Sbjct  409  NDYYHRTQANGGTCNFNNTAMITTTDPSHGSCIF-AGSSGSNSTGGGTAFAPVSPSSGAT  467

Query  201  MAR  193
            M +
Sbjct  468  MLQ  470



>ref|XP_008789151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS   +P++ YI+ELFNED RPGP+SE++WG+FFPNG+ VY +     S    
Sbjct  290  VLNGSGTPSRPTLPVNTYIHELFNEDLRPGPISEKNWGVFFPNGTTVYSLTFEHLSDPSA  349

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             ++   G+FC+A   A  N++++G+DWACG  G+ANCSAIQPGQPCY  D L + ASYAY
Sbjct  350  DSSGLVGLFCVANSSADLNEVKEGLDWACGA-GSANCSAIQPGQPCYESDNLVDVASYAY  408

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            NDYY R Q+ GGTC+F+ TA  TT DPS+GSCIF G
Sbjct  409  NDYYHRTQANGGTCNFNNTAMITTTDPSHGSCIFAG  444



>gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y +    SS    
Sbjct  319  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKTWGVLSTKGSAIYRL----SSLSSR  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               SS+ V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  375  VTGSSSFVYCVAKVGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNILNHASYAY  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  220
            NDYYQ++Q  GG+C+FDGTAT T  +PS GSCI+TGS N S G       P+   GP++
Sbjct  434  NDYYQKMQLNGGSCNFDGTATLTDTNPSRGSCIYTGSVNPSGGNGASPPTPSLTLGPSS  492



>dbj|BAH57260.1| AT3G13560 [Arabidopsis thaliana]
Length=452

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++GPPS+  +PI+ YIYEL+NEDKR GPVSER+WGI FPNG++VYP++L G S+   
Sbjct  296  VLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAA  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             N SS  +FC+A+  A ++KL  G++WACG QG ANC+AIQPGQPCY P+ +++HAS+A+
Sbjct  356  LNGSS--MFCVAKADADDDKLVDGLNWACG-QGRANCAAIQPGQPCYLPNDVKSHASFAF  412

Query  381  NDYYQRVQS  355
            NDYYQ+++S
Sbjct  413  NDYYQKMKS  421



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y +    S + ++
Sbjct  319  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKNWGVLSTKGSAIYRL---SSLSSRV  375

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            A +SS  V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  376  AGSSSV-VYCVAKDGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNIVNHASYAY  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  220
            NDYYQ++Q  GGTC+FDGTAT T  +PS GSC++TGS N S G       P+   GP++
Sbjct  434  NDYYQKMQLNGGTCNFDGTATLTNTNPSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  492



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y +    S + ++
Sbjct  316  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKNWGVLSTKGSAIYRL---SSLSSRV  372

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            A +SS  V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  373  AGSSSV-VYCVAKDGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNIVNHASYAY  430

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  220
            NDYYQ++Q  GGTC+FDGTAT T  +PS GSC++TGS N S G       P+   GP++
Sbjct  431  NDYYQKMQLNGGTCNFDGTATLTNTNPSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  489



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 130/179 (73%), Gaps = 10/179 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y ++   S + ++
Sbjct  292  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKNWGVLSTKGSAIYRLS---SLSSRV  348

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            A +SS  V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  349  AGSSSV-VYCVAKDGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNIVNHASYAY  406

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  220
            NDYYQ++Q  GGTC+FDGTAT T  +PS GSC++TGS N S G       P+   GP++
Sbjct  407  NDYYQKMQLNGGTCNFDGTATLTNTNPSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  465



>ref|XP_009413316.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS+    + AY++ELFNED RPGPVSE++WGIF  NG+AVY +  G  +    
Sbjct  295  VLNGSGTPSQPTTSVSAYVHELFNEDVRPGPVSEKNWGIFASNGTAVYSLKFGHLAESSA  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    GVFC+A   A  N L+KG+DWACGP G+ANC+AIQ GQPCY  D L   ASYAY
Sbjct  355  ESTGLVGVFCVANSSADSNALKKGLDWACGP-GSANCTAIQQGQPCYEADNLVAIASYAY  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            NDYY R Q+ GG+C+F  TA  TT DPS+GSCIF
Sbjct  414  NDYYHRTQASGGSCNFGNTAMITTTDPSHGSCIF  447



>ref|XP_004142250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
Length=535

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y +    SS    
Sbjct  319  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKTWGVLSTKGSAIYRL----SSLSSR  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               SS+ V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  375  VTGSSSFVYCVAKVGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNILNHASYAY  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            NDYYQ++Q  GG+C+FDGTAT T  +PS GSCI+TG
Sbjct  434  NDYYQKMQLNGGSCNFDGTATLTDTNPSRGSCIYTG  469



>ref|XP_009406533.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS+  + +  Y+ ELFNED RPGPVSE++WGI+ PNG+A+Y +  G  +    
Sbjct  323  VLNGSGTPSQPTISVSTYVLELFNEDLRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNA  382

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    GVFC+A      N L+KG+DWACGP G+ANC+AIQPGQ CY  D L    SYA+
Sbjct  383  DSTGLVGVFCVANSSVDSNALKKGLDWACGP-GSANCTAIQPGQACYEADNLVALTSYAF  441

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            NDYY R Q+ GGTC+F  TA  TT DPS+GSCIF+G
Sbjct  442  NDYYHRTQATGGTCNFGNTAMITTTDPSHGSCIFSG  477



>ref|XP_004162024.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4-like [Cucumis sativus]
Length=623

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +GPPSE   P++ YIYELF+ED++P P+S+++WG+    GSA+Y +    SS    
Sbjct  407  VLNGSGPPSEPTKPVNTYIYELFSEDQKPEPMSQKTWGVLSTKGSAIYRL----SSLSSR  462

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
               SS+ V+C+A+ GA   KLQ G++WACG QG ANCSAIQPGQPC+ PD + NHASYAY
Sbjct  463  VTGSSSFVYCVAKVGADPGKLQNGLNWACG-QGGANCSAIQPGQPCFLPDNILNHASYAY  521

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            NDYYQ++Q  GG+C+FDGTAT T  +PS GSCI+TG
Sbjct  522  NDYYQKMQLNGGSCNFDGTATLTDTNPSRGSCIYTG  557



>ref|XP_006858991.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
 gb|ERN20458.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
Length=506

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 116/146 (79%), Gaps = 8/146 (5%)
 Frame = -1

Query  699  IHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSA-----GVF  535
            +  ++YE+F+ED RPGP+SE+S G+ +PN +A+YP+ LG  S G +A N S+     G++
Sbjct  310  VSVFVYEMFDEDLRPGPMSEKSLGVIYPNLTAIYPLQLG--SGGALAANPSSALGVSGLY  367

Query  534  CIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  355
            C+A PGA    L+ G+DWACGP G ANC+A+Q GQPCY+P+TL+NHASYAYNDYYQR  S
Sbjct  368  CVATPGADALALKTGLDWACGP-GLANCTALQEGQPCYNPNTLENHASYAYNDYYQRSSS  426

Query  354  VggtcdfdgtattttvDPSYGSCIFT  277
             GGTC+F+GTATTT++DPSYG+C+FT
Sbjct  427  SGGTCNFNGTATTTSIDPSYGTCVFT  452



>ref|XP_010236492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brachypodium distachyon]
Length=501

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS+ K  +  Y++ELF+ED+R GPVSE++WGI F N SAVY +     +A   
Sbjct  304  VLNSSGTPSQPKNQVSTYLFELFSEDRRTGPVSEQNWGIMFTNASAVYSLAFEDVAANNT  363

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  G+FC+A   AS + L++ +DWACGP G+ANCSAIQPGQPCY  D +   ASYA+
Sbjct  364  DSPALRGMFCVANSSASHSALKQSLDWACGP-GSANCSAIQPGQPCYKSDDIVAVASYAF  422

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            NDYY R Q+ GGTC+F+GTAT ++ DPS+GSCIF GS+
Sbjct  423  NDYYHRTQTSGGTCNFNGTATISSTDPSHGSCIFLGST  460



>ref|NP_001149308.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
 gb|ACG34964.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
Length=494

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       YI+ELFNED R GPVSE++WGI FPN + +Y ++    +    
Sbjct  295  VLNNSGTPSQPNNQSSTYIFELFNEDNRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIP  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  GVFC+A   AS + L+  +DWACGP G+ANCSA+QPGQPCY+ D +   ASYA+
Sbjct  355  ESPALRGVFCVANSSASHSALKHSLDWACGP-GSANCSAVQPGQPCYASDDIAAVASYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS--NSSIGGVPTPAFGPTAP  217
            NDYY R QS GGTC+F+GTA  T+ DPS+GSCIF+GS+  N S GG    A GP +P
Sbjct  414  NDYYHRTQSSGGTCNFNGTAMITSTDPSHGSCIFSGSTGANGSNGGT---ASGPVSP  467



>gb|ACF87545.1| unknown [Zea mays]
Length=432

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       YI+ELFNED R GPVSE++WGI FPN + +Y ++    +    
Sbjct  233  VLNNSGTPSQPNNQPSTYIFELFNEDNRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIP  292

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  GVFC+A   AS + L+  +DWACGP G+ANCSA+QPGQPCY+ D +   ASYA+
Sbjct  293  ESPALRGVFCVANSSASHSALKHSLDWACGP-GSANCSAVQPGQPCYASDDIVAVASYAF  351

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  217
            NDYY R QS GGTC+F+GTA  T+ DPS+GSCIF+GS  +N S GG    A GP +P
Sbjct  352  NDYYHRTQSSGGTCNFNGTAMITSTDPSHGSCIFSGSAGANGSNGGT---ASGPVSP  405



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYELFNED RPG VSE++WG+F+P G  VY ++L  SSAG +
Sbjct  293  VLNNTGTPKHPGVPVSTYIYELFNEDLRPGLVSEKNWGLFYPTGVPVYTLHL--SSAGAV  350

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ G+DWACGP G  +CS +  GQPCY PD +  HA+YA
Sbjct  351  LANDTTNQTFCVAKDGADRKLLQAGLDWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYA  409

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF---TGSSNSSIGG  250
            +N YYQ++    GTCDF G A  TT +PS+ SCIF   TGS+ SS+ G
Sbjct  410  FNAYYQKMGKSPGTCDFKGVAIITTTNPSHSSCIFPGSTGSNGSSVNG  457



>ref|XP_008452394.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Cucumis 
melo]
Length=467

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYELFNED RPG VSE++WG+F+P G  VY ++L  SSAG +
Sbjct  260  VLNNTGTPKHPGVPVSTYIYELFNEDLRPGLVSEKNWGLFYPTGVPVYTLHL--SSAGAV  317

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ G+DWACGP G  +CS +  GQPCY PD +  HA+YA
Sbjct  318  LANDTTNQTFCVAKDGADRKLLQAGLDWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYA  376

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF---TGSSNSSIGG  250
            +N YYQ++    GTCDF G A  TT +PS+ SCIF   TGS+ SS+ G
Sbjct  377  FNAYYQKMGKSPGTCDFKGVAIITTTNPSHSSCIFPGSTGSNGSSVNG  424



>ref|XP_004173668.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like, partial [Cucumis 
sativus]
Length=392

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYEL+NED RPG VSE++WG+F+P G  VY ++L  SSAG +
Sbjct  185  VLNNTGTPKHPGVPVSTYIYELYNEDLRPGLVSEKNWGLFYPTGMPVYTLHL--SSAGAV  242

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ G+DWACGP G  +CS +  GQPCY PD +  HA+YA
Sbjct  243  LANDTTNQTFCVAKDGADRKLLQAGLDWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYA  301

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            +N YYQ++    GTCDF G A  TT +PS+ SCIF GS+ S+   V + +  P++
Sbjct  302  FNAYYQKMGKSSGTCDFKGVAIITTTNPSHSSCIFPGSTGSNGSLVNSTSLAPSS  356



>tpg|DAA63295.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63296.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=494

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       YI+ELFNED R GPVSE++WGI FPN + +Y ++    +    
Sbjct  295  VLNNSGTPSQPNNQPSTYIFELFNEDNRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIP  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  GVFC+A   AS + L+  +DWACGP G+ANCSA+QPGQPCY+ D +   ASYA+
Sbjct  355  ESPALRGVFCVANSSASHSALKHSLDWACGP-GSANCSAVQPGQPCYASDDIVAVASYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  217
            NDYY R QS GGTC+F+GTA  T+ DPS+GSCIF+GS  +N S GG    A GP +P
Sbjct  414  NDYYHRTQSSGGTCNFNGTAMITSTDPSHGSCIFSGSAGANGSNGGT---ASGPVSP  467



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYEL+NED RPG VSE++WG+F+P G  VY ++L  SSAG +
Sbjct  293  VLNNTGTPKHPGVPVSTYIYELYNEDLRPGLVSEKNWGLFYPTGMPVYTLHL--SSAGAV  350

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ G+DWACGP G  +CS +  GQPCY PD +  HA+YA
Sbjct  351  LANDTTNQTFCVAKDGADRKLLQAGLDWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYA  409

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            +N YYQ++    GTCDF G A  TT +PS+ SCIF GS+ S+   V + +  P++
Sbjct  410  FNAYYQKMGKSSGTCDFKGVAIITTTNPSHSSCIFPGSTGSNGSLVNSTSLAPSS  464



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 112/181 (62%), Gaps = 5/181 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    I  YI+ LFNE+++PG  SER+WG+F+P+ +++Y ++L G     +
Sbjct  323  VINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDRTSIYSLDLTGRGNVDV  382

Query  561  AN----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
                   SS G +C+A   ASE  LQ  +DWACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  383  ITGGNMTSSNGTWCVASTNASELDLQNALDWACGP-GNVDCSAIQPSQPCYQPDTLVSHA  441

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPV  214
            SYA+N YYQ+  +    C F GT   TT DPSY +CI+  S   S G   T A  P+   
Sbjct  442  SYAFNSYYQQNGATDVACSFGGTGVRTTKDPSYDNCIYATSRKLSRGNSTTSAVVPSRAQ  501

Query  213  G  211
            G
Sbjct  502  G  502



>ref|NP_001131285.1| putative O-Glycosyl hydrolase superfamily protein isoform 1 precursor 
[Zea mays]
 gb|ACF79625.1| unknown [Zea mays]
 gb|ACL53366.1| unknown [Zea mays]
 tpg|DAA41198.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA41199.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=492

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       YI+ELFNED R GPVSE++WGI FPN + +Y ++    +    
Sbjct  295  VLNNSGTPSQPNNQSSTYIFELFNEDNRSGPVSEQNWGIMFPNATTIYSLSFEDVATTIP  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  GVFC+A P A  + L+  +DWACGP G+ANCSAIQPG+PCY+ D +   ASYA+
Sbjct  355  ESPALRGVFCVANPSAPHSALKHSLDWACGP-GSANCSAIQPGKPCYASDDIVAVASYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAP  217
            NDYY R QS GGTC+F+GTA  T+ DPS+GSC+F GS+ ++ GG    A GP +P
Sbjct  414  NDYYHRTQSSGGTCNFNGTAMITSTDPSHGSCVFAGSTGAN-GGT---ASGPVSP  464



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 109/178 (61%), Gaps = 5/178 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    I  YI+ LFNE+++PG  SER+WG+F+P+ +++Y ++L G     +
Sbjct  293  VINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDQTSIYSLDLTGRGNVDV  352

Query  561  AN----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
                   SS G +C+A   ASE  LQ  +DWACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  353  ITGANITSSNGTWCVASSNASELDLQNALDWACGP-GNVDCSAIQPSQPCYQPDTLLSHA  411

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    C F GT    T DPSY  C++  S   S G    PA   +A
Sbjct  412  SYAFNSYYQQNGATDVACSFGGTGVKITKDPSYDKCVYATSGKLSSGNSTAPAVSSSA  469



>ref|NP_001060087.2| Os07g0577300 [Oryza sativa Japonica Group]
 dbj|BAH01358.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22001.2| Os07g0577300 [Oryza sativa Japonica Group]
Length=498

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +    +  +I+ELFNED R GPVSE++WGI FPN + VY +     +    
Sbjct  301  VLNNSGTPGQPNNQVSTFIFELFNEDLRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNT  360

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    G FC+A   A  + L++ +DWACGP G+ANCSAIQPGQPCY  D +   ASYA+
Sbjct  361  DSPVLRGTFCVANSSAPHSALKQSLDWACGP-GSANCSAIQPGQPCYKSDDIVAVASYAF  419

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  217
            NDYY R ++ GGTC+F+ TA  T+ DPS+GSCIF GS  SN S GG    A GP +P
Sbjct  420  NDYYHRTRASGGTCNFNSTAMVTSTDPSHGSCIFAGSTGSNGSNGGA---ASGPVSP  473



>gb|EEE67465.1| hypothetical protein OsJ_24859 [Oryza sativa Japonica Group]
Length=555

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +    +  +I+ELFNED R GPVSE++WGI FPN + VY +     +    
Sbjct  358  VLNNSGTPGQPNNQVSTFIFELFNEDLRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNT  417

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    G FC+A   A  + L++ +DWACGP G+ANCSAIQPGQPCY  D +   ASYA+
Sbjct  418  DSPVLRGTFCVANSSAPHSALKQSLDWACGP-GSANCSAIQPGQPCYKSDDIVAVASYAF  476

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  217
            NDYY R ++ GGTC+F+ TA  T+ DPS+GSCIF GS  SN S GG    A GP +P
Sbjct  477  NDYYHRTRASGGTCNFNSTAMVTSTDPSHGSCIFAGSTGSNGSNGGA---ASGPVSP  530



>ref|XP_002460914.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
 gb|EER97435.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
Length=494

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 2/175 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       YI+ELFNED R GPVSE++WGI FPN + +Y ++    +    
Sbjct  295  VLNNSGTPSQPNNQSSTYIFELFNEDNRSGPVSEQNWGIMFPNATTIYSLSFEDVATTIP  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  GVFC+A   A  + L+  +DWACGP G+ANCSAIQPGQPCY+ D +   +SYA+
Sbjct  355  ESPALRGVFCVANSSAPHSALKHSLDWACGP-GSANCSAIQPGQPCYASDDIVAVSSYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAP  217
            NDYY R QS GGTC+F+GTA  T+ DPS+GSCIF GS+ +S G     A GP +P
Sbjct  414  NDYYHRTQSSGGTCNFNGTAMITSTDPSHGSCIFAGSTGAS-GSKGGTASGPASP  467



>ref|XP_009406531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=524

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS+  + +  Y+ ELFNED RPGPVSE++WGI+ PNG+A+Y +  G  +    
Sbjct  323  VLNGSGTPSQPTISVSTYVLELFNEDLRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNA  382

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    GVFC+A      N L+KG+DWACGP G+ANC+AIQPGQ CY  D L    SYA+
Sbjct  383  DSTGLVGVFCVANSSVDSNALKKGLDWACGP-GSANCTAIQPGQACYEADNLVALTSYAF  441

Query  381  NDYYQRVQS  355
            NDYY R Q+
Sbjct  442  NDYYHRTQA  450



>ref|XP_009406534.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406535.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=496

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N +G PS+  + +  Y+ ELFNED RPGPVSE++WGI+ PNG+A+Y +  G  +    
Sbjct  295  VLNGSGTPSQPTISVSTYVLELFNEDLRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNA  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    GVFC+A      N L+KG+DWACGP G+ANC+AIQPGQ CY  D L    SYA+
Sbjct  355  DSTGLVGVFCVANSSVDSNALKKGLDWACGP-GSANCTAIQPGQACYEADNLVALTSYAF  413

Query  381  NDYYQRVQS  355
            NDYY R Q+
Sbjct  414  NDYYHRTQA  422



>ref|NP_565269.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 sp|Q9ZU91.2|E133_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 3; AltName: Full=(1->3)-beta-glucan 
endohydrolase 3; Short=(1->3)-beta-glucanase 
3; AltName: Full=Beta-1,3-endoglucanase 3; Short=Beta-1,3-glucanase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12708.2| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM62724.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC05475.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=501

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F+ NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+       LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDRKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTSALAPSA  465



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPGP SE++WG+F+ NG  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGPASEKNWGLFYANGVPVYILHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CSA+  GQPCY PD +  H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSAMLQGQPCYEPDNVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+QR+    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  411  NAYFQRMAKSPGTCDFKGVATITTTDPSHGSCIFPGSA  448



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGP+SE++WG+F+ NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTTYIYELYNEDTRPGPISEKNWGLFYTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTTALAPSA  465



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  294  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA +  LQ  +DWACGP G  +CSA+  GQPCY PD + +H++YA+
Sbjct  353  ANDTTNQTFCVAKDGADKKMLQAALDWACGP-GKVDCSALLQGQPCYEPDNVISHSTYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ++    GTCDF G AT TT DPS+GSCIF GS
Sbjct  412  NAYYQQMAKAPGTCDFKGVATITTTDPSHGSCIFPGS  448



>gb|EMS53703.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=477

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+       Y++ELFNED+R GPVSE++WGI F N SAVY +     +    
Sbjct  295  VLNNSGTPSQPNNQASTYLFELFNEDRRAGPVSEQNWGIMFTNASAVYSLTFEDVATNNT  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  G+FC+A   A+ + L++ +DW CGP G+ANCSAIQPGQ CY  D +   ASYA+
Sbjct  355  DSPALRGMFCVANSSAAHSALKQSLDWVCGP-GSANCSAIQPGQQCYKADDIVAVASYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            NDYY R Q+ GGTC+F+GTAT ++ DPS+GSC+F GS+
Sbjct  414  NDYYHRTQASGGTCNFNGTATISSTDPSHGSCVFAGST  451



>ref|XP_010502143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=501

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      + AYIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTAYIYELYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NSYYQKMGKALGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  276  VINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFHTNGTPVYTLRLAGAGA-IL  334

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  335  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGEACYEPDDVVAHSTYAF  393

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  394  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTTALAPSA  448



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  +IYEL+NED +PGPVSE++WG+F  NG+ +Y + L GS A  +
Sbjct  301  VLNKTGTPKHPGLAVSTFIYELYNEDTKPGPVSEKNWGLFDANGTPIYILRLTGSGA-VL  359

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC  + GA    LQ  +DWACGP G  +CSA+  GQPCY PD +  HA+YA+
Sbjct  360  ANDTTNQTFCTMKDGADPKMLQAALDWACGP-GKVDCSALLQGQPCYEPDDVAAHATYAF  418

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            + YY ++     +CDF+G AT TT DPS+GSCIF GS   N S+  +  P+   T+
Sbjct  419  DTYYHQMGMTSASCDFNGVATITTTDPSHGSCIFPGSLGKNGSMANITAPSLNSTS  474



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  309  VINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFHTNGTPVYTLRLAGAGA-IL  367

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  368  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGEACYEPDDVVAHSTYAF  426

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  427  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTTALAPSA  481



>ref|XP_008802448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Phoenix dactylifera]
Length=500

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V+N TG P    +P+  YIYEL++ED+RPG +SER+WG+F  NG  VY ++L GS    +
Sbjct  296  VTNSTGTPKHPGIPVPTYIYELYDEDQRPGVLSERNWGLFDANGMPVYTLHLTGSGV-LL  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  GA    LQ  +DWACGP G  +C+ +  G+PCY PDT++ HA+YA+
Sbjct  355  ANDTTNQTYCIATEGADAKLLQAALDWACGP-GKVDCNVLMQGRPCYDPDTVEAHATYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N+YY  +    GTC+F+G AT TT DPS+G CIF+GS
Sbjct  414  NEYYHGMGMASGTCNFNGVATITTTDPSHGDCIFSGS  450



>gb|EMT28432.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=695

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+    +  Y++ELFNED+R GPVSE++WGI F N SAVY +     +    
Sbjct  295  VLNNSGTPSQPDNQVSTYLFELFNEDRRAGPVSEQNWGIMFTNASAVYSLTFEDVATNNT  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  G+FC+A   A+ + L++ +DW CGP G+ANCSAIQPGQ CY  D +   ASYA+
Sbjct  355  DSPALRGMFCVANSSATHSALKQSLDWVCGP-GSANCSAIQPGQQCYKADDIVAVASYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            NDYY R Q+ GGTC+F+GTAT ++ DPS+GSC+F GS
Sbjct  414  NDYYHRTQASGGTCNFNGTATISSTDPSHGSCVFAGS  450



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  +G  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNADGVPVYTLHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ G+ +  LQ G+DWACGP G  +CS +  GQPCY PD +  HA+YA+
Sbjct  352  ANDTTNQTFCVAKEGSDKKMLQAGLDWACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N Y+QR+    GTCDF G AT TT DPS+GSCIF GS
Sbjct  411  NAYFQRMAKAPGTCDFKGVATVTTTDPSHGSCIFPGS  447



>ref|XP_002456331.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
 gb|EES01451.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Length=497

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 7/182 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G     +
Sbjct  295  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDV  354

Query  561  ---ANNSSA-GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
               AN +SA G +CIA   ASE  LQ  ++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  355  MTGANITSANGTWCIASANASETDLQNALNWACGP-GNVDCSAIQPSQPCYQPDTLASHA  413

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    CDF G    TT DPSY +C++  + N  S++     PA   + 
Sbjct  414  SYAFNSYYQQNGANVVACDFSGAGIRTTKDPSYDTCVYLAAGNKMSTMNSTSLPAQSNSG  473

Query  219  PV  214
            PV
Sbjct  474  PV  475



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  273  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VL  331

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA +  LQ  +DWACGP G  +CSA+  GQPCY PD + +H+ YA+
Sbjct  332  ANDTTNQTFCVAKDGADKKMLQAALDWACGP-GKVDCSALLQGQPCYEPDNVISHSMYAF  390

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ++    GTCDF G AT TT DPS+GSCIF GS
Sbjct  391  NAYYQQMAKAPGTCDFKGVATITTTDPSHGSCIFPGS  427



>ref|XP_008806478.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
1-like [Phoenix dactylifera]
Length=524

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++   AYIYELFNED RPGPVSE +WG+F+ NG+ VY +++ G S G +
Sbjct  313  VLDRSGTPLHPEVTSSAYIYELFNEDLRPGPVSEGNWGLFYGNGTPVYVLHVSG-SGGFL  371

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  GA    LQ  +DWACGP G ANCS IQPG+ CY P+ +++HASYA+
Sbjct  372  ANDTTNRTYCVAAEGAEGKALQAALDWACGP-GRANCSEIQPGESCYDPNNVRSHASYAF  430

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+   + G+C F G A  TT DPS+G CIF GS
Sbjct  431  DSYYQKEGKLAGSCYFQGVAMVTTTDPSHGDCIFPGS  467



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 7/182 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G     +
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDV  353

Query  561  ---ANNSSA-GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
               AN +SA G +CIA   ASE  LQ  ++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  354  MTGANITSANGTWCIASTNASETDLQNALNWACGP-GNVDCSAIQPSQPCYQPDTLASHA  412

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    CDF G    TT DPSY +C++  + N  S+      PA   + 
Sbjct  413  SYAFNSYYQQNGANVVACDFGGAGIRTTKDPSYDTCVYLAAGNKMSTTNSTSLPARSDSG  472

Query  219  PV  214
            PV
Sbjct  473  PV  474



>ref|XP_011070588.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=499

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            + N+TG P    + +  YIYEL+NED RPGP+SE++WG+F  NG  VY ++L GS    +
Sbjct  294  ILNNTGTPKHPGIAVSTYIYELYNEDLRPGPISEKNWGLFDANGVPVYILHLTGSGT-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A+ GA +  LQ  +DWACGP G  +CS +  GQPCY PDT+  HASYA+
Sbjct  353  ANDTTNQTYCVAREGADKKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDTVVAHASYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YY R+    GTC+F+G AT TT DPS+GSCIF GS
Sbjct  412  DAYYHRMVMGDGTCNFNGVATITTTDPSHGSCIFPGS  448



>ref|XP_010527795.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Tarenaya hassleriana]
Length=499

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  Y+YEL+NED RPGPVSE++WG+F+ NG+ VY + L G+    +
Sbjct  293  VLNNTGTPKHPGIAVSTYLYELYNEDSRPGPVSEQNWGLFYSNGTPVYELRLAGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+    +  LQ  +DWACGP G  +CS +  G+PCY PD++  H+SYA+
Sbjct  352  ANDTTNQTFCVAKESVDKKMLQAALDWACGP-GKVDCSPLLQGEPCYVPDSVVAHSSYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N YYQ++    G+CDF G AT T+ DPS+GSC+F GSS
Sbjct  411  NAYYQKMAKSPGSCDFKGVATVTSTDPSHGSCVFPGSS  448



>ref|XP_010513892.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=497

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTTYIYELYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NSYYQKMGKALGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_010424935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Camelina sativa]
Length=501

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTTYIYELYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NSYYQKMGKALGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_009390355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYEL++ED RPG  SE+ WG+F  NG   Y ++L GS    +
Sbjct  295  VLNNTGTPKHPGVPVPTYIYELYDEDLRPGATSEKFWGLFDVNGVPAYTLHLTGSGT-LL  353

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ G+DWACGP G  +CSA+  G+PCY PDT+++HASYA+
Sbjct  354  ANDTTNQTFCVAREGADTKMLQAGLDWACGP-GKVDCSALMQGKPCYDPDTVESHASYAF  412

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N+YY  +    GTC F G A  TT DPS+ SC+F+GS
Sbjct  413  NEYYHGMGMASGTCYFSGVAAITTTDPSHESCLFSGS  449



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGPVSE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVTTYIYELYNEDSRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+    +  LQ  +DWACGP G  +CSA+  G+ CY PD +  H++YA+
Sbjct  352  ANDTTNQTFCIAKEKVDKKMLQAALDWACGP-GKVDCSALMQGESCYEPDDVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGN-NTTALAPSA  465



>ref|XP_004969893.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=496

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 116/181 (64%), Gaps = 7/181 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G     +
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDV  353

Query  561  ---ANNSSA-GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
               AN +SA G +CIA   ASE  LQ  ++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  354  MTGANITSANGTWCIASANASETDLQNALNWACGP-GNVDCSAIQPSQPCYQPDTLASHA  412

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    CDF G    TT DPSY +C++   GS  S++     PA   ++
Sbjct  413  SYAFNSYYQQNGANVVACDFGGAGIRTTKDPSYDTCVYLAAGSKMSTMNSTSLPARSGSS  472

Query  219  P  217
            P
Sbjct  473  P  473



>ref|XP_010267108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P +    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  A  I
Sbjct  297  VINDTGTPGKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYSLDFSGRGAVDI  356

Query  561  AN---NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHAS  391
                  SS G +CIA   ASE  LQ  +DWACGP GN +CSAIQP Q CY PDTL +HAS
Sbjct  357  TQANITSSNGTWCIASSTASELDLQNALDWACGP-GNVDCSAIQPSQACYQPDTLLSHAS  415

Query  390  YAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-TGSSNSS  259
            YA+N YYQ+  +    C F GT   T  +PSY +C++ T  SN+S
Sbjct  416  YAFNSYYQQTGATDVACSFGGTGVKTNKNPSYDNCLYMTFGSNTS  460



>ref|XP_010267790.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nelumbo nucifera]
Length=495

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYEL+NED  PGP+SE++WG+F  NG  VY ++L GS    +
Sbjct  292  VLNNTGTPKHSGVPVSTYIYELYNEDLSPGPLSEKNWGLFDANGIPVYILHLTGSGM-VL  350

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA+  A    +Q  +DWACGP G  +CS +  GQPCY PDT+  HA+YA+
Sbjct  351  ANDTTNQTYCIARDSADPKMVQAALDWACGP-GKVDCSPLLQGQPCYEPDTVNAHATYAF  409

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGG  250
            N YY +++   GTC F+G AT TT DPS+GSCIF GS   N +I G
Sbjct  410  NAYYHQMEMASGTCYFNGVATITTTDPSHGSCIFLGSGGKNGTING  455



>gb|AAK85402.2| beta-1,3-glucanase [Camellia sinensis]
Length=495

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG  +Y ++L GS +  +
Sbjct  292  VLNKTGTPKHPGISVSTYIYELYNEDMKPGPLSEKNWGLFDANGVPIYILHLTGSGS-VL  350

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  NCSA+  GQPCY PDT+  HA+YA+
Sbjct  351  ANDTANQTYCTAKDGADAKMLQAALDWACGP-GKVNCSALLQGQPCYEPDTVAAHATYAF  409

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ++    GTCDF+G AT TT +P++GSC+F GS
Sbjct  410  DTYYQQMGKASGTCDFNGVATITTTNPTHGSCVFPGS  446



>ref|XP_006378440.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56237.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=481

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPGPVSE++WG+F  NG  VY ++L G+    +
Sbjct  276  VLNNTGTPKHPGIVVSTYIYELYNEDSRPGPVSEKNWGLFDANGMPVYTLHLTGAGT-LL  334

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  335  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAF  393

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  394  NAYFQKMAKSPGTCDFKGVATITTSDPSHGSCIFPGSA  431



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G      
Sbjct  291  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDI  350

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G I N  + G +C+A   ASE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  351  MTGGNITN--ANGTWCVASANASETDLQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLAS  407

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTPAFGP  226
            HASYA+N YYQ+  +    CDF GT   TT DPSY +C++   GS  S+      P    
Sbjct  408  HASYAFNSYYQQNGANDVACDFGGTGMRTTKDPSYDTCVYMAAGSKMSTTNSSALPVLNG  467

Query  225  TAP  217
            ++P
Sbjct  468  SSP  470



>ref|XP_002314794.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|EEF00965.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=498

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPGPVSE++WG+F  NG  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPGIVVSTYIYELYNEDSRPGPVSEKNWGLFDANGMPVYTLHLTGAGT-LL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  411  NAYFQKMAKSPGTCDFKGVATITTSDPSHGSCIFPGSA  448



>gb|EYU41109.1| hypothetical protein MIMGU_mgv1a005128mg [Erythranthe guttata]
Length=496

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPGPVSE++WG+F  NG  VY ++L GS    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGPVSEKNWGLFDSNGVPVYTLHLTGSGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A+ GA    LQ  +DWACGP G  +CS++  GQ CY PDT+ +HASYA+
Sbjct  352  ANDTTNQTYCVAREGADRKMLQAALDWACGP-GKVDCSSLLQGQACYEPDTVVSHASYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YY+R+    GTCDF+G AT TT D S+GSCIF GS
Sbjct  411  DAYYRRMGMADGTCDFNGVATITTTDQSHGSCIFPGS  447



>ref|XP_008221445.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Prunus mume]
Length=513

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  308  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VL  366

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA +  LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA 
Sbjct  367  ANDTTNQTFCVAKEGADQKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAV  425

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N Y+QR+    GTCDF G AT TT DPS+G+CIF GS
Sbjct  426  NAYFQRMAKSPGTCDFKGVATVTTTDPSHGTCIFPGS  462



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  +IYEL+NED +PGP+SE++WG+F  NG+ +Y + L GS A  +
Sbjct  301  VLNKTGTPKHPGLAVSTFIYELYNEDMKPGPISEKNWGLFDANGTPIYILRLTGSGA-VL  359

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            +N+++   FCI + GA    LQ  +DWACGP G  +CSA+  G+PCY PD +  HA+YA+
Sbjct  360  SNDTTNQTFCITKDGADPKMLQAALDWACGP-GKVDCSALLQGEPCYEPDNVIAHATYAF  418

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            + YY ++      CDF+G A  TT DPS+GSCIF GS   N ++  +  P+   T+
Sbjct  419  DTYYHKMGKTPAACDFNGVAAITTTDPSHGSCIFPGSLGKNGTLVNITAPSLNSTS  474



>dbj|BAJ89950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+    +  Y++ELFNED R G VS  SWGI F N SAVY +     +    
Sbjct  301  VLNNSGTPSQPNNQVSTYLFELFNEDLRSGSVSGESWGIMFSNASAVYSLAFEDVATTST  360

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  G+FC+A   A  + L++ +DWACGP G+ANCSAIQPGQPCY PD +   ASYA+
Sbjct  361  DSPALHGMFCVANSSAPHSALKQSLDWACGP-GSANCSAIQPGQPCYKPDDIVAVASYAF  419

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            NDYY R Q+ GGTC+F+ TAT ++ DPS+GSC F GS+
Sbjct  420  NDYYHRTQASGGTCNFNSTATISSTDPSHGSCKFAGST  457



>ref|XP_007225735.1| hypothetical protein PRUPE_ppa005356mg [Prunus persica]
 gb|EMJ26934.1| hypothetical protein PRUPE_ppa005356mg [Prunus persica]
Length=465

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  260  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VL  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA +  LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA 
Sbjct  319  ANDTTNQTFCVAKEGADQKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAV  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N Y+QR+    GTCDF G AT TT DPS+G+CIF GS
Sbjct  378  NAYFQRMAKSPGTCDFKGVATVTTTDPSHGTCIFPGS  414



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 108/173 (62%), Gaps = 5/173 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y I+  G     I
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDI  353

Query  561  AN--NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASY  388
                N S G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +HASY
Sbjct  354  MTGGNRSNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVSHASY  412

Query  387  AYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTPA  235
            A+N YYQ+  +    C F G    TT DPSY +C++   GS  S+     TPA
Sbjct  413  AFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVYMAAGSKISTKNSTATPA  465



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 107/165 (65%), Gaps = 5/165 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++L G  A  I
Sbjct  295  VVNDTGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYSVDLTGRGAVDI  354

Query  561  AN---NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHAS  391
                  SS G +CIA   ASE  LQ  +DW CGP GN +CSAIQP Q CY PDTL +HAS
Sbjct  355  TEANITSSNGTWCIASSTASELDLQNALDWTCGP-GNVDCSAIQPSQACYQPDTLVSHAS  413

Query  390  YAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-TGSSNSS  259
            +A+N YYQ+  +    C F GT   T  +PSY +C++ T  SN+S
Sbjct  414  FAFNSYYQQNGATDVACSFGGTGVKTNKNPSYDNCLYMTFGSNTS  458



>ref|XP_002312452.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89819.2| glucan endo-1 family protein [Populus trichocarpa]
Length=465

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   K+ +  YIYEL+NED RPG +SE++WG+F  NG  VY ++L G+    +
Sbjct  260  VLNNTGTPKHPKIAVSTYIYELYNEDLRPGAISEKNWGLFDANGMPVYTLHLTGAGT-VL  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  319  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSYLLQGQPCYEPDNVVAHSTYAF  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  378  NAYFQKMAKSPGTCDFKGVATITTTDPSHGSCIFPGSA  415



>ref|XP_010546762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Tarenaya hassleriana]
Length=517

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   +M    YIYELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  315  VFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEANWGLFYGNSTPVYLLHVSGSGTF-L  373

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  374  ANDTTNQTYCIAMDGVDSKTLQAALDWACGP-GRANCSEIQPGESCYQPNNVKNHASYAF  432

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+ +   G+CDF G A  TT DPS+GSCIF GS
Sbjct  433  DSYYQKERKAPGSCDFKGVAMITTTDPSHGSCIFLGS  469



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 115/176 (65%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P+   + +  YIYEL+NED +PGPVSE++WG+F  NG  +Y ++L G+    +
Sbjct  301  VLNKTGTPNHPGIAVSTYIYELYNEDLKPGPVSEKNWGLFNANGEPIYILHLTGAGL-VL  359

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  NCSAI  G+PCY PD +  HA+YA+
Sbjct  360  ANDTTNQTYCTAKEGADPKMLQAALDWACGP-GKVNCSAILQGEPCYEPDNVIAHATYAF  418

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTA  220
            N YY R+    GTCDF+G A  TT +PS+G+C+F GS+   + IG +  P+   T+
Sbjct  419  NSYYSRMGKAPGTCDFNGVAAITTTNPSHGTCLFPGSTGKINGIGNITAPSMNSTS  474



>ref|XP_008460530.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Cucumis 
melo]
Length=463

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + I  YIYEL+NED +PGP+SER+WG+F  NG  VY + L GS    +
Sbjct  260  VLNKTGTPKHPGIAISTYIYELYNEDLKPGPISERNWGLFDANGKPVYILRLTGSGL-VL  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ G     LQ  +DWACGP G  +CSA+  GQPCY PD +  HA+YA+
Sbjct  319  ANDTTNQTYCAAKEGVDPRMLQAALDWACGP-GRVDCSALLQGQPCYEPDNVMAHATYAF  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            N YY ++    G+CDF+G A  TT +PS+GSC F+GS   N ++  +  P+   T
Sbjct  378  NTYYLQMGKASGSCDFNGVAAVTTTNPSHGSCSFSGSVGRNGTMANITAPSMNST  432



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + I  YIYEL+NED +PGP+SER+WG+F  NG  VY + L GS    +
Sbjct  278  VLNKTGTPKHPGIAISTYIYELYNEDLKPGPISERNWGLFDANGKPVYILRLTGSGL-VL  336

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ G     LQ  +DWACGP G  +CSA+  GQPCY PD +  HA+YA+
Sbjct  337  ANDTTNQTYCAAKEGVDPRMLQAALDWACGP-GRVDCSALLQGQPCYEPDNVMAHATYAF  395

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            N YY ++    G+CDF+G A  TT +PS+GSC F+GS   N ++  +  P+   T
Sbjct  396  NTYYLQMGKASGSCDFNGVAAVTTTNPSHGSCSFSGSVGRNGTMANITAPSMNST  450



>ref|XP_008672637.1| PREDICTED: uncharacterized protein LOC100278152 isoform X1 [Zea 
mays]
Length=653

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 7/182 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G     +
Sbjct  451  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDV  510

Query  561  ---ANNSSA-GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
               AN +SA G +CIA   ASE  LQ  ++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  511  MTGANITSANGTWCIASTNASETDLQNALNWACGP-GNVDCSAIQPSQPCYQPDTLASHA  569

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    CDF G    TT DPSY +C++  + N  S+      PA   + 
Sbjct  570  SYAFNSYYQQNGANVVACDFGGAGIRTTKDPSYDTCVYLAAGNKMSTTNSTSLPARSDSG  629

Query  219  PV  214
            PV
Sbjct  630  PV  631



>ref|XP_009129217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brassica rapa]
 emb|CDY09427.1| BnaA02g25830D [Brassica napus]
Length=497

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGP+SE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVATYIYELYNEDTRPGPLSEKNWGLFHTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+    +  LQ  +DWACGP G  +CS +  G+ CY PD +  H+SYA+
Sbjct  352  ANDTTNQTFCVAKEKVDKKMLQAALDWACGP-GKVDCSELMQGEACYEPDDVAAHSSYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT T+ DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NAYYQKMGKASGSCDFKGVATVTSTDPSRGTCVFPGSAKSNQTLGH-NTTALAPSA  465



>gb|EEC82319.1| hypothetical protein OsI_26597 [Oryza sativa Indica Group]
Length=521

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +    +  +I+ELFNED R GPVSE++WGI FPN + VY +     +    
Sbjct  324  VLNNSGTPGQPNNQVSTFIFELFNEDLRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNT  383

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             +    G FC+A   A  + L++ +DWACGP G+ANCSAIQPGQPCY  D +   ASYA+
Sbjct  384  DSPVLRGTFCVANSSAPHSALKQSLDWACGP-GSANCSAIQPGQPCYKSDDIVAVASYAF  442

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            NDYY R ++ GGTC+F+ TA  T+ DPS+GSCIF
Sbjct  443  NDYYHRTRASGGTCNFNSTAMVTSTDPSHGSCIF  476



>ref|XP_008775304.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Phoenix dactylifera]
Length=497

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    +P+  Y+YEL++ED+RPG +SER+WG+F  NG  VY ++L GS    +
Sbjct  293  VLNSTGTPKHPGVPVPTYVYELYDEDQRPGALSERNWGLFDANGLPVYTLHLTGSGV-LL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA+ GA    LQ  +DWACGP G  +CS +  GQPCY PDT++ HA+YA+
Sbjct  352  ANDTTNQTYCIARDGADAKMLQAALDWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YY+ +    GTC F+G AT TT DPS+G+CIF GS
Sbjct  411  SAYYRGMGMASGTCYFNGVATVTTTDPSHGACIFPGS  447



>ref|XP_009382992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL++ED RPG  SE+ WG+F  NG   Y ++L GS    +
Sbjct  376  VINSTGTPKHPGVSVPTYIYELYDEDLRPGVTSEKFWGLFDANGVPAYTLHLTGSGM-LL  434

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S+  FC+A+ GA E  LQ GIDWACGP G  +CS +  G+PCY PDT++ HASYA+
Sbjct  435  ANDTSSQTFCVAKEGADEKLLQAGIDWACGP-GKVDCSLLTQGKPCYDPDTVEAHASYAF  493

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N+YY  +    GTC F G A  TT DPS+ SC+F+GS
Sbjct  494  NEYYHGMGMAVGTCHFSGVAAITTTDPSHDSCLFSGS  530



>emb|CDY48807.1| BnaC02g34070D [Brassica napus]
Length=497

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED RPGP+SE++WG+F  NG+ VY + L G+ A  +
Sbjct  293  VINKTGTPKHPGTAVATYIYELYNEDTRPGPLSEKNWGLFHTNGTPVYTLRLAGAGA-IL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+    +  LQ  +DWACGP G  +CS +  G+ CY PD +  H+SYA+
Sbjct  352  ANDTTNQTFCVAKEKVDKKMLQAALDWACGP-GKVDCSDLMQGEACYEPDDVVAHSSYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            N YYQ++    G+CDF G AT TT DPS G+C+F GS  SN ++G   T A  P+A
Sbjct  411  NAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNRTLGH-NTTALAPSA  465



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  299  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFDANGLPVYTLHLTGAGT-VL  357

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA+
Sbjct  358  ANDTTNQTFCVAKDGADRKMLQAALDWACGP-GKVDCSPMLQGQPCYEPDNVVTHATYAF  416

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N YYQ++    GTCDF G AT TT DPS+GSCI  GS+
Sbjct  417  NAYYQKMAKSPGTCDFKGVATITTTDPSHGSCIVPGSA  454



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG+ +Y ++L  S A  +
Sbjct  294  VFNKTGTPKHPGIAVSTYIYELYNEDMKPGPLSEKNWGLFDANGTPIYILHLTESGA-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S   FCIA+ GA    LQ  +DWACGP G   CS +  GQPCY PD +  HA+YA+
Sbjct  353  ANDTSNNTFCIAKDGADPKMLQAALDWACGP-GKVECSPLLQGQPCYEPDNVIAHANYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY ++      CDF+G AT +T DPS+GSC+F GS   N ++G    P+   T
Sbjct  412  DTYYHKMGKTPDACDFNGVATISTSDPSHGSCLFPGSVGKNGTLGNFTAPSMNST  466



>gb|EMS49856.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=494

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y I+  G     I
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDI  353

Query  561  AN--NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASY  388
                N S G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +HASY
Sbjct  354  MTGGNRSNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVSHASY  412

Query  387  AYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTP  238
            A+N YYQ+  +    C F G    TT DPSY +C++   GS  S+     TP
Sbjct  413  AFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVYMAAGSKISTKNSTATP  464



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG+ VY + L  S A  +
Sbjct  293  VFNKTGTPKHPGIAVSTYIYELYNEDTKPGPISEKNWGLFDSNGAPVYILRLTESGA-LL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S   FCIA+ GA    LQ  +DWACGP G   CS +  GQPCY PD +  HA+YA+
Sbjct  352  ANDTSNQTFCIAKDGADPKMLQAALDWACGP-GKVECSPLLQGQPCYEPDNVIAHANYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY ++      CDF+G AT +T DPS+GSC+F GS   N ++G    P+   T
Sbjct  411  DTYYHKMGKTPDACDFNGVATISTSDPSHGSCLFPGSLGKNGTLGNFTAPSMNST  465



>ref|XP_008799775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Phoenix 
dactylifera]
Length=526

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 110/180 (61%), Gaps = 9/180 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    I  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++L G   G +
Sbjct  323  VINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDRTSVYSLDLTGR--GNV  380

Query  561  -----AN-NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
                 AN  SS G +C+A   ASE  LQ  ++WACG  GN +CSAIQP QPCY PDTL +
Sbjct  381  DGITGANITSSNGTWCVASSNASELDLQNALNWACG-SGNVDCSAIQPSQPCYQPDTLAS  439

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            HASYA+N YYQ+  +    C F G    T  DPSY +CI+  S   S G   T A    A
Sbjct  440  HASYAFNSYYQQNGATDVACSFGGAGLRTRKDPSYENCIYATSGKLSSGNSTTSAVSSRA  499



>emb|CBI16509.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = -1

Query  660  RPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGIDW  481
            R GPVSER+WG+F  NG+AVYP  L  S++ Q   NSS  VFC+A+ GA  + L+KG++W
Sbjct  179  RSGPVSERNWGVFLTNGTAVYP--LSWSTSLQATGNSST-VFCVAKEGADSDDLEKGLNW  235

Query  480  ACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvDP  301
            ACG Q   NC+AIQ GQPCYSP+T QNHASYAYNDYYQ+++S GGTCDF GTATTTT DP
Sbjct  236  ACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAYNDYYQKMRSGGGTCDFRGTATTTTADP  294

Query  300  SYGSCIF  280
            SYGSCIF
Sbjct  295  SYGSCIF  301



>gb|EAZ13481.1| hypothetical protein OsJ_03397 [Oryza sativa Japonica Group]
Length=474

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G      
Sbjct  291  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDI  350

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G I N  + G +C+A   ASE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  351  MTGGNITN--ANGTWCVASANASETDLQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLAS  407

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            HASYA+N YYQ+  +    CDF GT   TT DPSY +C++  +
Sbjct  408  HASYAFNSYYQQNGANDVACDFGGTGVRTTKDPSYDTCVYMAA  450



>gb|EEC71452.1| hypothetical protein OsI_03677 [Oryza sativa Indica Group]
Length=493

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G      
Sbjct  291  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDI  350

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G I N  + G +C+A   ASE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  351  MTGGNITN--ANGTWCVASANASETDLQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLAS  407

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            HASYA+N YYQ+  +    CDF GT   TT DPSY +C++  +
Sbjct  408  HASYAFNSYYQQNGANDVACDFGGTGVRTTKDPSYDTCVYMAA  450



>ref|NP_001044198.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAD86947.1| putative elicitor inducible beta-1,3-glucanase NtEIG-E76 [Oryza 
sativa Japonica Group]
 dbj|BAF06112.1| Os01g0739700 [Oryza sativa Japonica Group]
 dbj|BAG88936.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G      
Sbjct  291  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDI  350

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G I N  + G +C+A   ASE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  351  MTGGNITN--ANGTWCVASANASETDLQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLAS  407

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            HASYA+N YYQ+  +    CDF GT   TT DPSY +C++  +
Sbjct  408  HASYAFNSYYQQNGANDVACDFGGTGVRTTKDPSYDTCVYMAA  450



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  +IYEL+NED +PGPVSE++WG+F  NG+ +Y + L GS A  +
Sbjct  302  VLNKTGTPKRPGLAVSTFIYELYNEDTKPGPVSEKNWGLFDANGTPIYILRLTGSGA-VL  360

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC A+ G     LQ  +DWACGP G  +CS +  G+PCY PD + +HA+YA+
Sbjct  361  ANDTTNQTFCTAKDGTDTKMLQAALDWACGP-GKVDCSPLLQGEPCYEPDNVISHATYAF  419

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            + YY ++     +CDF+G A  TT DPS+GSC+F GS   N ++  +  P+   T+
Sbjct  420  DTYYHQMGKTSASCDFNGVAAITTTDPSHGSCVFPGSLGKNGTLVNITAPSLNSTS  475



>ref|XP_010100650.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
 gb|EXC44994.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
Length=467

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  260  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFDANGEPVYILHLTGAGT-VL  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  319  ANDTTNQTFCVAKDGADRKMLQAALDWACGP-GKVDCSPLLQGQPCYQPDNVVAHSTYAF  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  378  NAYFQKMTKSPGTCDFKGVATITTTDPSHGSCIFPGSA  415



>ref|XP_006658732.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Oryza brachyantha]
Length=457

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G PS+    +  YI+ELFNED R GPVSE++WGI FPN + VY I     +   I
Sbjct  305  VLNNSGTPSQPNNQVSTYIFELFNEDLRSGPVSEKNWGIMFPNATTVYSITFEDMATANI  364

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
             + +  G FC+A   A  + L++ +DWACGP G+ANCSAIQPG+PCY  D +   ASYA+
Sbjct  365  DSPALRGTFCVANSSAPHSALKQSLDWACGP-GSANCSAIQPGKPCYKSDDIVAVASYAF  423

Query  381  NDYYQRVQS  355
            NDYY R Q+
Sbjct  424  NDYYHRTQA  432



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG+ +Y ++L  S A  +
Sbjct  301  VFNKTGTPKHPGIAVSTYIYELYNEDMKPGPLSEKNWGLFDANGTPIYILHLTESGA-VL  359

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S   FCIA+ GA    LQ  +DWACGP G   CS +  GQPCY PD +  HA+YA+
Sbjct  360  ANDTSNNTFCIAKDGADPKMLQAALDWACGP-GKVECSPLLQGQPCYEPDNVIAHANYAF  418

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY ++      CDF+G AT +T DPS+GSC+F GS   N ++G    P+   T
Sbjct  419  DTYYHKMGKTPDACDFNGVATISTSDPSHGSCLFPGSVGKNGTLGNFTAPSMNST  473



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P+   + +  YIYEL+NED +PGPVSE++WG+F  NG  +Y ++L G+    +
Sbjct  279  VLNKTGTPNHPGIAVSTYIYELYNEDLKPGPVSEKNWGLFNANGEPIYILHLTGAGL-VL  337

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  NCSAI  G+PCY PD +  HA+YA+
Sbjct  338  ANDTTNQTYCTAKEGADPKMLQAALDWACGP-GKVNCSAILQGEPCYEPDNVIAHATYAF  396

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTA  220
            N YY R+    GTCDF+G A  TT +PS+G+C+F GS+   +  G +  P+   T+
Sbjct  397  NSYYSRMGKAPGTCDFNGVAAITTTNPSHGTCLFPGSTGKINGFGNITAPSMNSTS  452



>ref|XP_010052861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76987.1| hypothetical protein EUGRSUZ_D01339 [Eucalyptus grandis]
Length=527

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 105/161 (65%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   ++    YIYELFNED R  P+SE +WG+F+ N +AVY +++ GS  G +
Sbjct  313  VLDRTGTPLHPELTSSVYIYELFNEDLRSPPMSEANWGLFYGNSTAVYLLHVSGS-GGFL  371

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA        LQ  +DWACG QG ANCS IQPG+ CY P  ++NHASYA+
Sbjct  372  ANDTTNQTYCIAMDNVDSRTLQTALDWACG-QGQANCSEIQPGEDCYQPSNVKNHASYAF  430

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+     G+CDF G A  TT DPS+GSCIF GS   S
Sbjct  431  DSYYQKEGKAAGSCDFKGVAMITTTDPSHGSCIFPGSKKVS  471



>ref|XP_004295275.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=534

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   +     YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS    +
Sbjct  323  VFDRSGTPLHPETTSSVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGTF-L  381

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA  G     LQ  +DWACGP G ANC+ IQPG+ CYSP+ ++NHASYA+
Sbjct  382  ANDTTNQTFCIAMDGVDAKSLQAALDWACGP-GRANCTEIQPGENCYSPNNVKNHASYAF  440

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+     G+CDF G AT TT DPS GSCIF GS  +S
Sbjct  441  DSYYQKQGKAAGSCDFKGVATITTTDPSKGSCIFPGSKQAS  481



>ref|XP_002531922.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30466.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=508

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGPVSE++WG+F  NG  VY ++L GS    +
Sbjct  304  VLNKTGTPKHPGIAVSTYIYELYNEDTKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VL  362

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC A+ GA    LQ  +DWACGP G  +CSA+  G+ CY PD +  HA+YA+
Sbjct  363  ANDTTNQTFCTAKEGADPKMLQAALDWACGP-GKVDCSALLQGESCYEPDNVIAHATYAF  421

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS---NSSIGGVPTPAFGPTA  220
            + YY ++    GTCDF+G A+ TT +PS+G+CIF+GSS   N S+  +  P+   T+
Sbjct  422  DSYYHQMGKAPGTCDFNGVASITTTNPSHGTCIFSGSSGKINGSLVNITAPSMNSTS  478



>ref|XP_011021801.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Populus euphratica]
Length=465

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   ++ +  YIYEL+NED RPGPVSE++WG+F  +G  VY ++L G+    +
Sbjct  260  VLNNTGTPKHPRIVVSTYIYELYNEDLRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LL  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  319  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAF  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+ SCIF GS+
Sbjct  378  NAYFQKMAKSPGTCDFKGAATITTSDPSHDSCIFPGSA  415



>ref|XP_011459999.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=535

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   +     YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS    +
Sbjct  324  VFDRSGTPLHPETTSSVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGTF-L  382

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA  G     LQ  +DWACGP G ANC+ IQPG+ CYSP+ ++NHASYA+
Sbjct  383  ANDTTNQTFCIAMDGVDAKSLQAALDWACGP-GRANCTEIQPGENCYSPNNVKNHASYAF  441

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+     G+CDF G AT TT DPS GSCIF GS  +S
Sbjct  442  DSYYQKQGKAAGSCDFKGVATITTTDPSKGSCIFPGSKQAS  482



>gb|KHN00662.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=483

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED R GPVSE +WG+F+ NG+ VY ++L  S     
Sbjct  280  VLNNSGTPKQPGIAVSTYIYELYNEDLRSGPVSENNWGLFYANGAPVYTLHLTNSGT-VF  338

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQPCY P+++ +HA+YA 
Sbjct  339  ANDTTNQTFCVAKSNADTKMLQAALDWACGP-GKVDCSPLLQGQPCYEPNSVASHATYAI  397

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF GS   ++  V   A  P+
Sbjct  398  NAYYQQMAKSAGTCDFKGVASVTTTNPSHGSCIFPGSGGKNVTSVNGTALAPS  450



>ref|XP_011021799.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Populus euphratica]
Length=499

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   ++ +  YIYEL+NED RPGPVSE++WG+F  +G  VY ++L G+    +
Sbjct  294  VLNNTGTPKHPRIVVSTYIYELYNEDLRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  353  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+ SCIF GS+
Sbjct  412  NAYFQKMAKSPGTCDFKGAATITTSDPSHDSCIFPGSA  449



>ref|XP_011021800.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Populus euphratica]
Length=498

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   ++ +  YIYEL+NED RPGPVSE++WG+F  +G  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPRIVVSTYIYELYNEDLRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+ SCIF GS+
Sbjct  411  NAYFQKMAKSPGTCDFKGAATITTSDPSHDSCIFPGSA  448



>ref|XP_008795501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Phoenix dactylifera]
Length=502

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 5/167 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    I  YI+ LFNE+++PG  SER+WG+F+P+ +++Y ++L G     +
Sbjct  299  VINDTGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDQTSIYTLDLTGRGNVDV  358

Query  561  AN----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
                  +SS G +C+A   ASE  LQ  ++WACG  GN +CSAIQP QPCY PDTL +HA
Sbjct  359  TTGANISSSNGTWCVASSNASELDLQNALNWACGA-GNVDCSAIQPSQPCYQPDTLLSHA  417

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG  253
            S+A+N YYQ+  +    C F GT   TT +PSY  CI+  S   S G
Sbjct  418  SFAFNSYYQQNGATDVACSFGGTGVKTTKNPSYDKCIYATSGKMSSG  464



>ref|XP_003518194.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=496

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED R GPVSE +WG+F+ NG+ VY ++L  S     
Sbjct  293  VLNNSGTPKQPGIAVSTYIYELYNEDLRSGPVSENNWGLFYANGAPVYTLHLTNSGT-VF  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQPCY P+++ +HA+YA 
Sbjct  352  ANDTTNQTFCVAKSNADTKMLQAALDWACGP-GKVDCSPLLQGQPCYEPNSVASHATYAI  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF GS   ++  V   A  P+
Sbjct  411  NAYYQQMAKSAGTCDFKGVASVTTTNPSHGSCIFPGSGGKNVTSVNGTALAPS  463



>ref|XP_011023912.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Populus 
euphratica]
Length=498

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   K+ +  YIYEL+NED RPG +SE++WG+F  +G  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPKIAVSTYIYELYNEDLRPGALSEKNWGLFDADGMPVYTLHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVDCSYLLQGQPCYEPDNVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  411  NAYFQKMAKSPGTCDFKGVATITTTDPSHGSCIFPGSA  448



>gb|KDP38099.1| hypothetical protein JCGZ_04742 [Jatropha curcas]
Length=498

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPGPVSE++WG+F  NG  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDIRPGPVSEKNWGLFDSNGVPVYILHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPC  PD +  H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GRVDCSILLQGQPCNEPDNVVAHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N Y+QR+    GTCDF G AT TT DPS+GSCIF GS+
Sbjct  411  NAYFQRMAKSPGTCDFKGVATITTTDPSHGSCIFPGSA  448



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED+RPG VSE++WG+F  NG  +Y ++L G+    +
Sbjct  294  VLNNTGTPKHPGVAVSTYIYELYNEDQRPGSVSEKNWGLFDANGVPIYILHLTGAGT-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+ + GA +  LQ  +DWACGP G  +CS +  GQ CY PD +  HA+YA+
Sbjct  353  ANDTTNQTFCVGKDGADKKMLQAALDWACGP-GKVDCSLLLQGQACYEPDNVVAHATYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ++    GTCDF G AT TT +PS+GSCIF GS
Sbjct  412  NAYYQKMGKALGTCDFKGVATVTTTNPSHGSCIFPGS  448



>gb|EMT15518.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=530

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y I+  G     I
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDI  353

Query  561  AN--NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASY  388
                N S G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +HASY
Sbjct  354  MTGGNRSNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVSHASY  412

Query  387  AYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            A+N YYQ+  +    C F G    TT DPSY +C++  +
Sbjct  413  AFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVYMAA  451



>gb|AET05176.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=480

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 107/179 (60%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P++L   +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  A  +
Sbjct  261  VINNTGTPAKLGQELDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGAVDM  320

Query  561  -----ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
                    S+   +CIA   ASE  LQ  +DWACGP GN +C+A+QP QPC+ PD L +H
Sbjct  321  TTAANVTRSNRTTWCIASSKASEIDLQNALDWACGP-GNVDCTAVQPSQPCFEPDNLASH  379

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            ASY +N YYQ+  +    C F GT      DPSY +CI+    N+   G  T A   T+
Sbjct  380  ASYVFNSYYQQNGASDVACSFGGTGVKIDKDPSYDNCIYMRDGNNKTSGGNTRAMSSTS  438



>ref|XP_009388881.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=512

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 2/164 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V +  G P   +     YIYELF+ED RPGP SE SWG+F+ NG+ VY +++ G + G +
Sbjct  303  VLDRAGTPLRPEATPSVYIYELFDEDLRPGPASEASWGLFYGNGTPVYLLHVSG-AGGFL  361

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  GA    LQ  +DWACGP G ANCS IQPG+ CY+P+ +  HASYA+
Sbjct  362  ANDTTNRTYCVAAEGADRRGLQAALDWACGP-GRANCSEIQPGESCYAPNDVTGHASYAF  420

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGG  250
            + YYQ+     G+C F G A  TT DPS+G CIF GS   ++ G
Sbjct  421  DSYYQKEGKAAGSCYFQGVAMVTTTDPSHGDCIFPGSKQMNVSG  464



>gb|AAO42272.1| unknown protein [Arabidopsis thaliana]
Length=332

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   +M    YIYELFNED R  PVSE SWG+F+ N + VY +++ GS    +
Sbjct  135  VFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-L  193

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G +NCS IQPG+ CY P+ ++ HAS+A+
Sbjct  194  ANDTTNQTYCIAMDGVDAKTLQAALDWACGP-GRSNCSEIQPGESCYQPNNVKGHASFAF  252

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ+     G+CDF G A  TT DPS+GSCIF GS
Sbjct  253  NSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGS  289



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + + AYIYEL+NED RPGP+SE++WG+F  NG  +Y + L G S   +
Sbjct  293  VLNKTGTPKHPGIAVSAYIYELYNEDTRPGPLSEKNWGLFDGNGVPIYILRLTG-SGSVL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+  A    LQ  +DWACGP G  +CS +  GQPCY PDT+  HA+YA+
Sbjct  352  ANDTTNQTYCAAKDSADSKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDTVSAHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSN  265
            + YYQ+       CDF+G A  TT +PS+GSC+F GSS+
Sbjct  411  DAYYQKNGKAPLACDFNGVAAITTTNPSHGSCLFLGSSD  449



>ref|XP_006853717.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
 gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 18/192 (9%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P +    I  YI+ LFNE+++PG  SER+WG+F+P  ++VY ++  G   G +
Sbjct  282  VINDTGTPLKPGEEIDVYIFSLFNENRKPGLDSERNWGVFYPGQTSVYNLDFSGREGGLV  341

Query  561  ANNSSA---GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHAS  391
             N S+    G +CIA P ASE  L+  +DWACG  GN +CSAIQP Q C+ PDTL +HAS
Sbjct  342  VNVSAGGGNGSWCIASPNASERDLKNALDWACG-SGNVDCSAIQPSQACFQPDTLASHAS  400

Query  390  YAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS-------------SNSSIGG  250
            YA+N YYQ+  +    CDF GT   TT +PSY +C++  +             S+S+I  
Sbjct  401  YAFNSYYQQNGASTIACDFGGTGMITTKNPSYDNCLYQSTGGYPASNSTAATQSSSAISY  460

Query  249  VPTPAFGPTAPV  214
             PTP FG  A +
Sbjct  461  APTP-FGIWALI  471



>dbj|BAJ85556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y ++  G     I
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSVDWTGRGNVDI  353

Query  561  AN----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
                   SS G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  354  MTGGNLTSSNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVSHA  412

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTPAFGPTA  220
            SYA+N YYQ+  +    C F G    TT DPSY +C++   GS  S+     +PA   ++
Sbjct  413  SYAFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCLYMAAGSKISTKNSTTSPARSGSS  472

Query  219  P  217
            P
Sbjct  473  P  473



>emb|CDY31214.1| BnaC08g15090D [Brassica napus]
Length=522

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   ++    YIYELFNEDKR  PVSE SWG+F+ N + VY +++ GS A  +
Sbjct  321  VFDRTGTPLRPEVTPSVYIYELFNEDKRAKPVSEASWGLFYGNTTPVYLLHVSGSGAF-L  379

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++ HAS+A+
Sbjct  380  ANDTTNKTYCVAMDGVDVKTLQAALDWACGP-GRANCSEIQPGESCYQPNNVKGHASFAF  438

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ+     G+CDF G A  TT DPS+GSCIF GS
Sbjct  439  NSYYQQEGRASGSCDFKGVAMITTTDPSHGSCIFPGS  475



>ref|XP_009397186.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = -1

Query  693  AYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGA  514
             YIYELF+ED RPGP+SE  WG+F+ NG+  Y +N+ G + G +AN+++   +C+A   A
Sbjct  348  VYIYELFDEDLRPGPLSEAHWGLFYGNGTPAYLLNVAG-AGGFLANDTTNRTYCVAAEEA  406

Query  513  SENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdf  334
                LQ  +DWACGP G ANCS IQPG+ CY P+ +++HASYA++ YYQ      G+C F
Sbjct  407  DRRSLQAALDWACGP-GRANCSEIQPGESCYQPNDVRSHASYAFDSYYQMQGKAAGSCFF  465

Query  333  dgtattttvDPSYGSCIFTGSSNSSIGGVPT-------PAFGPTAPVGKGSM  199
             G A  TT DPS+G CIF GS   S  G  T           PT+ +GKG +
Sbjct  466  QGVAMITTTDPSHGKCIFPGSKQRSATGAGTNKAESSKAVVSPTSRLGKGRL  517



>ref|XP_009359235.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Pyrus x bretschneideri]
Length=540

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++  + YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS +  +
Sbjct  326  VLDRSGTPLHPEITSNVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-L  384

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G ANCS IQPG+ CYSP+ +++HASYA+
Sbjct  385  ANDTTNQTYCIAMDGMDGKSLQAALDWACGP-GRANCSEIQPGEDCYSPNNVKSHASYAF  443

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+     G+CDF G AT TT DPS+GSCIF GS   S
Sbjct  444  DSYYQKQGRAAGSCDFQGVATITTTDPSHGSCIFPGSKKVS  484



>gb|KJB30776.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=497

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG  SE++WG+F  NG  VY ++L G+     
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSDSEKNWGLFDANGIPVYTLHLTGADT-VF  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+ GA    LQ  +DWACGP G  +CS +  G PCY PD + +H++YA+
Sbjct  352  ANDTTNKTFCIAKRGADPKMLQAALDWACGP-GKVDCSPLLLGHPCYEPDNVASHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N YYQR+    GTCDF G AT TT DPS+GSCIF GSS
Sbjct  411  NAYYQRMAKSPGTCDFKGVATITTSDPSHGSCIFPGSS  448



>ref|XP_006584862.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Glycine max]
Length=477

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 115/189 (61%), Gaps = 4/189 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED R GPVSE++WG+F+ NG  VY ++L G  AG I
Sbjct  275  VLNNTGTPKHPGIAVSTYIYELYNEDLRSGPVSEKNWGLFYANGEPVYTLHLTG--AGII  332

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+ +  A    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA
Sbjct  333  FANDTTNQTFCVTKSNADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYA  391

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKG  205
            +N YYQ++    G+CDF G AT TT DPS+GSCIF GS           +  P+     G
Sbjct  392  FNAYYQKMDKSPGSCDFKGVATVTTTDPSHGSCIFPGSHGRKGTRTNGTSLAPSNSTSSG  451

Query  204  SMARAPDIG  178
             +++  D G
Sbjct  452  CLSQYHDNG  460



>ref|XP_006584863.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Glycine max]
Length=462

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 115/189 (61%), Gaps = 4/189 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED R GPVSE++WG+F+ NG  VY ++L G  AG I
Sbjct  260  VLNNTGTPKHPGIAVSTYIYELYNEDLRSGPVSEKNWGLFYANGEPVYTLHLTG--AGII  317

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+ +  A    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA
Sbjct  318  FANDTTNQTFCVTKSNADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYA  376

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKG  205
            +N YYQ++    G+CDF G AT TT DPS+GSCIF GS           +  P+     G
Sbjct  377  FNAYYQKMDKSPGSCDFKGVATVTTTDPSHGSCIFPGSHGRKGTRTNGTSLAPSNSTSSG  436

Query  204  SMARAPDIG  178
             +++  D G
Sbjct  437  CLSQYHDNG  445



>gb|EYU30694.1| hypothetical protein MIMGU_mgv1a005031mg [Erythranthe guttata]
Length=500

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 112/178 (63%), Gaps = 17/178 (10%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P++    I  YI+ LFNE+++PG  SER+WG+FFP+ ++VY ++  G S G  
Sbjct  295  VINNTGTPAKPGEEIDTYIFSLFNENRKPGLESERNWGLFFPDQTSVYNLDFTGRSGGGA  354

Query  561  ANNSSAGVF---------CIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDT  409
             + ++ G F         C+A   ASE+ L+ G+DWACGP GN +CSAIQP QPC+ PD+
Sbjct  355  VDTTAGGNFTGGLNNGTWCVASNNASESDLRNGLDWACGP-GNVDCSAIQPSQPCFEPDS  413

Query  408  LQNHASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-------TGSSNSSI  256
            L +HASYA+N YYQ+  +    C F G    T  +PSY +C++       T ++N++I
Sbjct  414  LASHASYAFNSYYQQNGATDIACTFGGAGFRTNKNPSYDNCMYMVFGTNKTAAANATI  471



>gb|KJB30775.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=465

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG  SE++WG+F  NG  VY ++L G+     
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSDSEKNWGLFDANGIPVYTLHLTGADT-VF  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA+ GA    LQ  +DWACGP G  +CS +  G PCY PD + +H++YA+
Sbjct  352  ANDTTNKTFCIAKRGADPKMLQAALDWACGP-GKVDCSPLLLGHPCYEPDNVASHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSS  268
            N YYQR+    GTCDF G AT TT DPS+GSCIF GSS
Sbjct  411  NAYYQRMAKSPGTCDFKGVATITTSDPSHGSCIFPGSS  448



>ref|XP_003532507.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=499

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED R GPVSE++WG+F+ NG  VY ++L G  AG I
Sbjct  297  VLNNTGTPKHPGIAVSTYIYELYNEDLRSGPVSEKNWGLFYANGEPVYTLHLTG--AGII  354

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+ +  A    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA
Sbjct  355  FANDTTNQTFCVTKSNADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYA  413

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            +N YYQ++    G+CDF G AT TT DPS+GSCIF GS
Sbjct  414  FNAYYQKMDKSPGSCDFKGVATVTTTDPSHGSCIFPGS  451



>ref|XP_010923875.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like isoform X1 
[Elaeis guineensis]
Length=524

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            + + +G P   ++    YIYELFNED  PGPVSE +WG+F+ NG+ VY +++ G S G +
Sbjct  313  ILDRSGTPLHPEVTSSVYIYELFNEDLSPGPVSEGNWGLFYGNGTPVYLLHVAG-SGGFL  371

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  GA    LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  372  ANDTTNRTYCVAAEGADGKALQAALDWACGP-GRANCSEIQPGESCYEPNNVRNHASYAF  430

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+     G+C F G A  TT DPS+G CIF GS
Sbjct  431  DSYYQKEGKGAGSCYFQGVAMVTTTDPSHGDCIFPGS  467



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG  VY ++L GS +  +
Sbjct  293  VLNQTGTPKHPGIGVSTYIYELYNEDNKPGPLSEKNWGLFDANGDPVYILHLTGSGS-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA+
Sbjct  352  ANDTTNQTYCTARDGADPKMLQAALDWACGP-GKVDCSGLLQGQPCYEPDNVIAHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY +++     C+F+G A  TT DPS+GSCIF GS   N ++  +  P+   T
Sbjct  411  DTYYHQMRKDPAACNFNGVAAITTSDPSHGSCIFPGSLGKNGTMANITAPSLNST  465



>ref|XP_007026106.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY28728.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=523

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  316  VLDHSGTPLHPEITSSVYIYELFNEDLRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-L  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CI   G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  375  ANDTTNQTYCITMDGVDSKTLQAALDWACGP-GRANCSEIQPGEDCYQPNNVKNHASYAF  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+   V G+CDF G A  TT DPS+GSC+F GS   S
Sbjct  434  DSYYQKEGRVSGSCDFKGVAMITTTDPSHGSCVFPGSKKVS  474



>ref|XP_006482110.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Citrus sinensis]
 gb|KDO50803.1| hypothetical protein CISIN_1g010931mg [Citrus sinensis]
Length=497

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG  VY ++L GS +  +
Sbjct  293  VLNQTGTPKHPGIGVSTYIYELYNEDNKPGPLSEKNWGLFDANGDPVYILHLTGSGS-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA+
Sbjct  352  ANDTTNQTYCTARDGADPKMLQAALDWACGP-GKVDCSGLLQGQPCYQPDNVIAHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY +++     C+F+G A  TT DPS+GSCIF GS   N ++  +  P+   T
Sbjct  411  DTYYHQMRKDPAACNFNGVAAITTSDPSHGSCIFPGSLGKNGTMANITAPSLNST  465



>ref|XP_009110702.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Brassica rapa]
 emb|CDY21013.1| BnaA08g25120D [Brassica napus]
Length=519

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   ++    YIYELFNEDKR  PVSE SWG+F+ N + VY +++ GS A  +
Sbjct  318  VFDRTGTPLRPEVTPSVYIYELFNEDKRAPPVSEASWGLFYGNTTPVYLLHVSGSGAF-L  376

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++ HAS+A+
Sbjct  377  ANDTTNKTYCVAMDGVDVKTLQAALDWACGP-GRANCSEIQPGESCYQPNNVKGHASFAF  435

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ+     G+CDF G A  TT DPS+GSCIF GS
Sbjct  436  NSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGS  472



>ref|XP_009394832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 106/167 (63%), Gaps = 5/167 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND G P++    I  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G     I
Sbjct  297  VINDAGTPAKPGEEIDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYSLDWTGRGNVDI  356

Query  561  AN----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
                   SS G +C+A   AS+  LQ  ++WACG  GN +CSAIQP QPCY PDTL +HA
Sbjct  357  VTGANITSSNGTWCVASSNASDADLQNALNWACG-SGNVDCSAIQPSQPCYQPDTLASHA  415

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIG  253
            SYA+N YYQ+  +    C+F GT   TT DPSY +C++T SS    G
Sbjct  416  SYAFNGYYQQNGATDVACNFGGTGLKTTKDPSYDACVYTTSSKMGTG  462



>ref|XP_010271297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Nelumbo nucifera]
Length=495

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG +SE++WG+F  NG  +Y ++L  S    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDMRPGSLSEKNWGLFDANGVPIYILHLTDSGM-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A+ GA E  LQ  +DWACGP G  +CS +  GQPCY PDT+  HA+YA+
Sbjct  352  ANDTTNQTYCVARDGADEKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDTVNAHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YY ++    GTC F+G A+ TT DPS+GSC F GS
Sbjct  411  NTYYHQMGMASGTCYFNGVASVTTSDPSHGSCKFHGS  447



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGPVSE++WG+F  NG  VY ++L GS    +
Sbjct  287  VLNKTGTPKHPGIAVSTYIYELYNEDLKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VL  345

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  +CSA+  G+PCY PD +  HA+YA+
Sbjct  346  ANDTTNQTYCTAKQGADPKMLQAALDWACGP-GKVDCSAMLQGEPCYQPDNVIAHATYAF  404

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF---TGSSNSSIGGVPTPAFGPTA  220
            N YY ++    GTCDF+G A  TT +PS+G+C+F   TG  N ++  +  P+   T+
Sbjct  405  NSYYNQMGKAPGTCDFNGVAAITTTNPSHGTCVFPGSTGRMNGTMVNITAPSMNSTS  461



>ref|XP_010049602.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Eucalyptus grandis]
 gb|KCW82303.1| hypothetical protein EUGRSUZ_C03710 [Eucalyptus grandis]
Length=500

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 108/167 (65%), Gaps = 7/167 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  +  +
Sbjct  293  VINDTGTPAKPGEALDVYIFSLFNENRKPGLDSERNWGLFYPDETSVYNLDFTGRGSVDV  352

Query  561  ---ANNSSAG--VFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
               AN +S+    +CIA   ASE +LQKG+DWACG  GN +CSAIQP QPCY PDTL +H
Sbjct  353  ITGANITSSNGTTWCIASANASEIELQKGLDWACG-SGNVDCSAIQPSQPCYEPDTLVSH  411

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-TGSSNSS  259
            AS+A+N YYQ+  +    C F G       +PSY  C++ T  SN +
Sbjct  412  ASFAFNGYYQQNGATDVACSFGGAGLKVDKNPSYDKCLYMTAGSNKT  458



>ref|XP_008365635.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Malus domestica]
Length=597

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS +  +
Sbjct  383  VLDRSGTPLHPEITSDVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-L  441

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G ANCS IQPG+ CYSP+ +++HASYA+
Sbjct  442  ANDTTNQTYCIAMDGMDGKSLQAALDWACGP-GRANCSEIQPGEDCYSPNNVKSHASYAF  500

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ+     G+CDF+G AT TT DPS+GSCIF GS   S
Sbjct  501  DSYYQKQGRAAGSCDFNGVATITTTDPSHGSCIFPGSKKVS  541



>ref|XP_007151812.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
 gb|ESW23806.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
Length=495

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + I +YIYEL+NED R GPVSE +WG+F+ NG+ VY ++L  ++AG +
Sbjct  292  VLNNSGTPKQPGIAISSYIYELYNEDLRTGPVSENNWGLFYANGAPVYTLHL--TNAGTV  349

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+  A    LQ  +DWACGP G  +CS++  GQPCY P+ +  HA+YA
Sbjct  350  FANDTTNQTFCVAKSNADTKLLQAALDWACGP-GKVDCSSLLQGQPCYDPNNVAAHATYA  408

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS---SNSSIGG  250
             N YYQ++    GTCDF G A+ TT +PS+GSCIF GS   + SSI G
Sbjct  409  INAYYQQMAKSAGTCDFKGVASVTTTNPSHGSCIFPGSYGKNGSSING  456



>ref|XP_010108988.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
 gb|EXC20628.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
Length=497

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  +IYEL+NEDK+PGPVSE++WG+F  NG  +Y ++L   S   +
Sbjct  293  VLNKTGTPKRPGLAVSTFIYELYNEDKKPGPVSEKNWGLFDVNGVPIYIMHL-TDSGNVL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A  GA +  LQ  +DWACGP G  +CS +  GQPCY PD + +HA++A+
Sbjct  352  ANDTTNQTYCAAMEGADKKMLQAALDWACGP-GRVDCSPLLQGQPCYEPDNVASHATFAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF---TGSSNSSIGGVPTPAFGPTAPVG  211
            + YY ++      CDF+G AT TT DPS+GSC+F    G + S++  V  P    T+   
Sbjct  411  DAYYHKMGKAADACDFNGVATITTTDPSHGSCVFLESLGKNGSTLANVTAPTLNSTSLDS  470

Query  210  KGSMARA  190
              S  R+
Sbjct  471  SASDFRS  477



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 ref|XP_004155734.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + I  YIYEL+NED +PGP+SE++WG+F  NG  VY + L GS    +
Sbjct  300  VLNKTGTPKHPGIAISTYIYELYNEDLKPGPISEKNWGLFDANGKPVYILRLTGSGL-VL  358

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ G     LQ  +DWACGP G  +CSA+  GQPCY PD +  HA+YA+
Sbjct  359  ANDTTNQTYCAAKEGVDPRMLQAALDWACGP-GRVDCSALLQGQPCYEPDNVMAHATYAF  417

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            N YY ++    G+CDF+G A  TT +PS+GSC F+GS   N ++  +  P+   T
Sbjct  418  NTYYLQMGKGSGSCDFNGVAAVTTTNPSHGSCSFSGSVGRNGTMANITAPSMNST  472



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED + GP+SE++WG+F  NG+ +Y ++L  S A  +
Sbjct  294  VFNKTGTPKHPGIDVSTYIYELYNEDMKSGPLSEKNWGLFDANGTPIYILHLTESGA-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S   FCIA+ GA    LQ  +DWACGP G   CS +  GQPCY PD +  HA+YA+
Sbjct  353  ANDTSNNTFCIAKDGADPKMLQAALDWACGP-GKVECSPLLQGQPCYEPDNVIAHANYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPT  223
            + YY ++      CDF+G AT +T DPS+GSC+F GS   N ++G    P+   T
Sbjct  412  DTYYHKMGKTPDACDFNGVATISTSDPSHGSCLFPGSVGKNGTLGNFTAPSMNST  466



>gb|KJB57756.1| hypothetical protein B456_009G179400 [Gossypium raimondii]
Length=522

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 104/161 (65%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  316  VLDRSGTPLHPEITSSVYIYELFNEDLRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-L  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  375  ANDTTNQTFCIAMDGVDSKTLQTALDWACGP-GRANCSEIQPGESCYQPNNVKNHASYAF  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ      G+CDF G A  TT DPS+GSC+F GS   S
Sbjct  434  DSYYQMEGKASGSCDFKGVAMITTTDPSHGSCVFPGSKMVS  474



>ref|XP_006451337.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 ref|XP_006475345.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Citrus sinensis]
 gb|ESR64577.1| hypothetical protein CICLE_v10008080mg [Citrus clementina]
 gb|KDO55851.1| hypothetical protein CISIN_1g010782mg [Citrus sinensis]
Length=501

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 104/179 (58%), Gaps = 7/179 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G     +
Sbjct  293  VINDSGTPAKRGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYNLDFSGKGVVDM  352

Query  561  AN------NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             +      N +   +CIA   ASE  LQ  +DWACGP GN +CSAIQP QPCY PDTL +
Sbjct  353  TDSNVTSLNGTTTTWCIASTKASEADLQNALDWACGP-GNVDCSAIQPSQPCYEPDTLLS  411

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            HAS+A N YYQ+  +    C F G       +PSY +C++  +  +      T A   T
Sbjct  412  HASFAINSYYQQNGATDIACSFGGNGVKVDKNPSYDNCVYMTAGANKTAATNTTAISST  470



>ref|XP_007032975.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03901.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
Length=498

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + I  YIYEL+NED +PGP+SE++WG+F  NG  VY + L GS +  +
Sbjct  294  VLNKTGTPKRPGIAISTYIYELYNEDMKPGPISEKNWGLFDANGDPVYILRLTGSGS-LL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C  + GA    LQ  +DWACGP G  +CS +  G+PCY PD +  HA+YA+
Sbjct  353  ANDTTNQTYCTVKEGADPKMLQAALDWACGP-GKVDCSPLLQGKPCYEPDNVIAHATYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            + YY R+      CDF+G A  TT DPS+GSCIF GS   N ++  +  P+   T+
Sbjct  412  DTYYHRMGKTSDACDFNGVADITTTDPSHGSCIFPGSLGRNGTMVNITAPSMNSTS  467



>ref|XP_007045239.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY01071.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=498

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P   ++ +  YIYEL+NED RPG VSE++WG+F  NG  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPRIAVSTYIYELYNEDLRPGSVSEKNWGLFDANGIPVYILHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA    LQ  +DWACGP G   CS +  G PCY PD + +H++YA+
Sbjct  352  ANDTTNQTFCVAKEGADPKMLQAALDWACGP-GKVECSPLLQGHPCYEPDNVVSHSTYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N Y+Q++    GTCDF G AT TT DPS+GSCIF GS
Sbjct  411  NAYFQQMAKSPGTCDFKGVATITTTDPSHGSCIFPGS  447



>ref|XP_010926119.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Elaeis guineensis]
Length=501

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL++ED+RPG VSER+WG+F  NG  VY ++L GS    +
Sbjct  296  VLNSTGTPKHPGIAVPTYIYELYDEDQRPGAVSERNWGLFDANGVPVYTLHLTGSGV-LL  354

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA+ GA    LQ  +DWACGP G  +CS +  GQPCY PDT++ HA+YA+
Sbjct  355  ANDTTNQTYCIAKEGADAKLLQAALDWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAF  413

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YY  +    GTC F+G AT TT DPS+G C F GS
Sbjct  414  NAYYHGMGMGSGTCYFNGVATITTTDPSHGDCTFPGS  450



>ref|NP_001144992.1| uncharacterized protein LOC100278152 precursor [Zea mays]
 gb|ACG44298.1| hypothetical protein [Zea mays]
Length=477

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+FFP+ S++Y ++  G     +
Sbjct  294  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDV  353

Query  561  ---ANNSSA-GVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
               AN +SA G +CIA   ASE  LQ  ++WACGP GN +CSAIQP QPCY PDTL +HA
Sbjct  354  MTGANITSANGTWCIASTNASETDLQNALNWACGP-GNVDCSAIQPSQPCYQPDTLTSHA  412

Query  393  SYAYNDYYQR  364
            SYA+N YYQ+
Sbjct  413  SYAFNSYYQQ  422



>ref|XP_006828511.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    +P+  YIYEL+NED RPGP+SE++WG+F  +GS VY ++L  S    +
Sbjct  322  VLNNTGTPKHPGVPVSTYIYELYNEDARPGPMSEKNWGLFNADGSPVYTLHLTDSGV-VL  380

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A  GA +  LQ  +DWACGP G  +C+ +  GQPCY PD +++HASYA+
Sbjct  381  ANDTTNQTYCVAISGADKKLLQAALDWACGP-GKVDCTPLLQGQPCYDPDNVESHASYAF  439

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVGK  208
            + YY ++    GTCDF G AT TT DPS+ SC F GS   N + G + + A    A  G 
Sbjct  440  DTYYHKMGMAVGTCDFKGVATVTTTDPSHDSCSFPGSGGKNGTFGNITSLAPSTNATAGS  499

Query  207  GS  202
             +
Sbjct  500  AA  501



>ref|XP_003558472.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brachypodium distachyon]
Length=498

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQ-  565
            V N TG P    + +  YIYEL++ED RPG  SE+ WG+F  NGS  Y ++L GS  GQ 
Sbjct  296  VMNVTGTPKHPGVAVPTYIYELYDEDTRPGTTSEKYWGLFDMNGSPAYALHLTGS--GQL  353

Query  564  IANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
            +AN+++   FC+A+ GA E  LQ  +DWACGP G  +CS +  G  CY PDT+Q+HA+YA
Sbjct  354  LANDTTNNTFCVARDGADEKMLQAALDWACGP-GKVDCSVLTQGHACYEPDTVQDHATYA  412

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI  256
            +N YY  +    G+C F G A  TT DPS+GSC++ G + S++
Sbjct  413  FNAYYHGIGMGSGSCYFSGVAVVTTTDPSHGSCVYGGKNGSAL  455



>gb|KHG03844.1| hypothetical protein F383_07460 [Gossypium arboreum]
Length=522

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 104/161 (65%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  316  VLDRSGTPLHPEITSSVYIYELFNEDLRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-L  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  375  ANDTTNQTFCIAMDGIDSKTLQTALDWACGP-GRANCSEIQPGESCYQPNNVKNHASYAF  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            + YYQ      G+CDF G A  TT DPS+GSC+F GS   S
Sbjct  434  DSYYQMEGKASGSCDFKGVAMITTTDPSHGSCVFPGSKMVS  474



>ref|XP_006599427.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X4 
[Glycine max]
Length=424

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED + GPVSE +WG+F+ +G+ VY ++L  S     
Sbjct  221  VLNNSGTPKQPGIAVSTYIYELYNEDLKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VF  279

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQ CY P+++ +HA+YA 
Sbjct  280  ANDTTNQTFCVAKSNADSKMLQAALDWACGP-GKVDCSPLLQGQSCYEPNSVASHATYAI  338

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF+GS   ++  V   A  P+
Sbjct  339  NSYYQQMAKSAGTCDFKGVASITTTNPSHGSCIFSGSGGKNVTSVNGTALAPS  391



>gb|KJB15378.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=465

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 110/158 (70%), Gaps = 4/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RP P+SE++WG+F  NG+ VY ++L  ++AG +
Sbjct  260  VINNTGTPKHPGITVSTYIYELYNEDLRPSPLSEKNWGLFDANGTPVYILHL--TAAGTV  317

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD + +H++YA
Sbjct  318  FANDTTNQTFCVAKDGADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVSHSTYA  376

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            +N Y+Q++    GTCDF G AT +T DPS+GSCIF GS
Sbjct  377  FNAYFQQMGKSTGTCDFKGVATISTTDPSHGSCIFPGS  414



>ref|NP_001184967.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|O65399.3|E131_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 1; AltName: Full=(1->3)-beta-glucan 
endohydrolase 1; Short=(1->3)-beta-glucanase 
1; AltName: Full=Beta-1,3-endoglucanase 1; Short=Beta-1,3-glucanase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28791.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=511

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   +M    YIYELFNED R  PVSE SWG+F+ N + VY +++ GS    +
Sbjct  314  VFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-L  372

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G +NCS IQPG+ CY P+ ++ HAS+A+
Sbjct  373  ANDTTNQTYCIAMDGVDAKTLQAALDWACGP-GRSNCSEIQPGESCYQPNNVKGHASFAF  431

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ+     G+CDF G A  TT DPS+GSCIF GS
Sbjct  432  NSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGS  468



>ref|XP_008224690.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Prunus mume]
Length=546

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   +     YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS +  +
Sbjct  332  VFDRSGTPLHPETTSSVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-L  390

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G +NCS IQPGQ CYSP+ +++HASYA+
Sbjct  391  ANDTTNQTYCIAMDGVDSKILQAALDWACGP-GRSNCSEIQPGQDCYSPNNVKSHASYAF  449

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+     G+CDF G AT TT DPS+GSCIF GS
Sbjct  450  DSYYQKEGRAAGSCDFKGVATITTTDPSHGSCIFPGS  486



>ref|XP_007211541.1| hypothetical protein PRUPE_ppa003984mg [Prunus persica]
 gb|EMJ12740.1| hypothetical protein PRUPE_ppa003984mg [Prunus persica]
Length=536

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   +     YIYELFNED R  PVSE +WG+F+ N SAVY +++ GS +  +
Sbjct  322  VFDRSGTPLHPETTSSVYIYELFNEDLRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-L  380

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G +NCS IQPGQ CYSP+ +++HASYA+
Sbjct  381  ANDTTNQTYCIAMDGVDSKILQAALDWACGP-GRSNCSEIQPGQDCYSPNNVKSHASYAF  439

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+     G+CDF G AT TT DPS+GSCIF GS
Sbjct  440  DSYYQKEGRAAGSCDFKGVATITTTDPSHGSCIFPGS  476



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 110/158 (70%), Gaps = 4/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RP P+SE++WG+F  NG+ VY ++L  ++AG +
Sbjct  293  VINNTGTPKHPGITVSTYIYELYNEDLRPSPLSEKNWGLFDANGTPVYILHL--TAAGTV  350

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+ GA    LQ  +DWACGP G  +CS +  GQPCY PD + +H++YA
Sbjct  351  FANDTTNQTFCVAKDGADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVSHSTYA  409

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            +N Y+Q++    GTCDF G AT +T DPS+GSCIF GS
Sbjct  410  FNAYFQQMGKSTGTCDFKGVATISTTDPSHGSCIFPGS  447



>gb|KHG17836.1| hypothetical protein F383_07126 [Gossypium arboreum]
Length=519

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGP+SE++WG+F  NG  +Y + L   S   +
Sbjct  282  VMNKTGTPKRPGIAVSTYIYELYNEDLKPGPISEKNWGLFDANGDPIYILRL-TDSGSLL  340

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  +CS++  G+PCY PD +  HA+YA+
Sbjct  341  ANDTTNQTYCTAKEGADPKMLQAALDWACGP-GKVDCSSLLQGKPCYEPDNVIAHATYAF  399

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTPAFGPTA  220
            + YY R+      CDF+G A  TT DPS+GSCIF GS   N ++  +  P+   T+
Sbjct  400  DTYYHRMGKTSDACDFNGVADITTTDPSHGSCIFPGSLGRNGTMVNITAPSMNSTS  455



>ref|XP_008242470.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Prunus 
mume]
Length=491

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 10/191 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  +  +
Sbjct  287  VINDTGTPAKPGERLDIYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKGSADV  346

Query  561  ---ANNSSAGV--FCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
               AN +S+ V  +CIA   ASE  LQ  +DWACGP GN +C+AIQP QPC+ PD    H
Sbjct  347  ITQANVTSSNVTTWCIASSKASELDLQNALDWACGP-GNVDCTAIQPSQPCFEPDNTVAH  405

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-TGSSNSSIGGVPTPAFGPTA  220
            AS+A+N+YYQ+  +    C F GT      +PSY +CI+ T  SN ++    T A   T+
Sbjct  406  ASFAFNNYYQQNGATDVACSFGGTGIKVDKNPSYDNCIYMTAGSNKTVAS-NTTAISSTS  464

Query  219  PVGKGSMARAP  187
             +   +M R P
Sbjct  465  SI--ATMNRVP  473



>ref|XP_008242469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Prunus 
mume]
Length=497

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 10/191 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  +  +
Sbjct  293  VINDTGTPAKPGERLDIYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKGSADV  352

Query  561  ---ANNSSAGV--FCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
               AN +S+ V  +CIA   ASE  LQ  +DWACGP GN +C+AIQP QPC+ PD    H
Sbjct  353  ITQANVTSSNVTTWCIASSKASELDLQNALDWACGP-GNVDCTAIQPSQPCFEPDNTVAH  411

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF-TGSSNSSIGGVPTPAFGPTA  220
            AS+A+N+YYQ+  +    C F GT      +PSY +CI+ T  SN ++    T A   T+
Sbjct  412  ASFAFNNYYQQNGATDVACSFGGTGIKVDKNPSYDNCIYMTAGSNKTVAS-NTTAISSTS  470

Query  219  PVGKGSMARAP  187
             +   +M R P
Sbjct  471  SI--ATMNRVP  479



>ref|XP_010232285.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Brachypodium 
distachyon]
Length=497

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 107/174 (61%), Gaps = 9/174 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y ++  G      
Sbjct  296  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSLDWSGRGNVDI  355

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G + N  S G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  356  MTGGNLTN--SNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVS  412

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTP  238
            HASYA+N YYQ+  +    C F G    TT DPSY +C++  +   S     TP
Sbjct  413  HASYAFNSYYQQNGANDVACGFGGAGVRTTKDPSYDTCVYMAAGKMSTMNSTTP  466



>ref|XP_006657748.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Oryza brachyantha]
Length=534

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            VS+  G P         YIYELFNED RPGPVSE +WG+F  NG+ VY +++ G + G +
Sbjct  319  VSDKPGTPMRPGAQASVYIYELFNEDLRPGPVSEANWGLFHGNGTPVYLLHVSG-TGGVL  377

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA   A E  +Q  +DWACGP G  +C+AIQPGQ CY P+ +++HASYA+
Sbjct  378  ANDTTDRTFCIASDDADEKAVQAAMDWACGP-GRTDCTAIQPGQGCYEPNDVRSHASYAF  436

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ      G+C F G    TT DPS+ SCIF GS
Sbjct  437  DSYYQLQGKAAGSCYFQGVGMVTTTDPSHDSCIFPGS  473



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NED +PGPVSE++WG+F  NG  VY ++L GS    +
Sbjct  301  VLNKTGTPKHPGIAVSTYIYELYNEDLKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VL  359

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C A+ GA    LQ  +DWACGP G  +CSA+  G+PCY PD +  HA+YA+
Sbjct  360  ANDTTNQTYCTAKQGADPKMLQAALDWACGP-GKVDCSAMLQGEPCYQPDNVIAHATYAF  418

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIF---TGSSNSSIGGVPTPAFGPTA  220
            N YY ++    GTCDF+G A  TT +PS+G+C+F   TG  N +   +  P+   T+
Sbjct  419  NSYYNQMGKAPGTCDFNGVAAITTTNPSHGTCVFPGSTGRMNGTTVNITAPSMNSTS  475



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG VSE++WG+F  +G  VY ++L G+    +
Sbjct  293  VLNNTGTPKHPGIAVSTYIYELYNEDLRPGSVSEKNWGLFNADGVPVYTLHLTGAGT-VL  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+ GA +  LQ  +DWACGP G  +CS +  GQPCY P+ +  HA+YA+
Sbjct  352  ANDTTNQTFCVAREGADKKMLQAALDWACGP-GKVDCSPLLQGQPCYEPNNVLTHATYAF  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N Y+Q +    GTCDF G AT TT DPS+G+CIF GS
Sbjct  411  NAYFQLMAKSPGTCDFKGVATVTTTDPSHGTCIFPGS  447



>ref|NP_001150141.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
 gb|ACG38014.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
Length=501

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P   ++ +  YIYEL++ED RPG  SE+ WG+F  NG   Y ++L GS    +
Sbjct  297  VMNSTGTPKHPRVAVPTYIYELYDEDTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGV-LL  355

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+AQ GA    LQ  +DWACGP G  +CS +  GQPCY PDT++ HA+YA+
Sbjct  356  ANDTTNQTYCVAQEGADPKMLQAALDWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAF  414

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSI  256
            N YY  +    GT  F G A  TT DPS+GSC++ G + +S+
Sbjct  415  NAYYHGMGMGSGTFYFSGVAVVTTTDPSHGSCVYGGKNGTSL  456



>ref|XP_006580439.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=494

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  +IYEL+NED R GPVSE++WG+F+ NG  VY ++L G+     
Sbjct  292  VLNNTGTPKHPGIAVSTFIYELYNEDLRSGPVSEKNWGLFYANGEPVYTLHLTGAGI-LF  350

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+ +  A    LQ  +DWACGP G  +CS +  GQPCY PD +  H++YA+
Sbjct  351  ANDTTNQTFCVTKSNADPKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYAF  409

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ++    G+CDF G AT TT DPS+GSCIF GS
Sbjct  410  NAYYQKMDKSPGSCDFKGVATVTTTDPSHGSCIFPGS  446



>ref|XP_007160409.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32403.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=498

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED R GP SE++WG+F+ NG  VY ++L G  AG I
Sbjct  295  VLNNTGTPKHPGIAVSTYIYELYNEDLRSGPFSEKNWGLFYANGEPVYTLHLTG--AGNI  352

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQ CY PD + +H++YA
Sbjct  353  FANDTTNQTFCVAKSNADPKMLQAALDWACGP-GKVDCSPLLQGQTCYEPDNVVSHSTYA  411

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            +N YYQ++    G+CDF G A+ TT DPS+GSCIF GS
Sbjct  412  FNAYYQKMDKSPGSCDFKGVASITTTDPSHGSCIFPGS  449



>gb|KHG26459.1| hypothetical protein F383_04538 [Gossypium arboreum]
Length=488

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 99/158 (63%), Gaps = 5/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ +++Y ++  G     +
Sbjct  277  VLNDTGTPTKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDM  336

Query  561  ANNSSAG----VFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
             N++        +CIA   ASE  LQ  IDWACGP GN +CSAIQP QPC+ PD L +HA
Sbjct  337  TNSTDGSKNGTTWCIASSKASEADLQNAIDWACGP-GNVDCSAIQPSQPCFEPDNLASHA  395

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            S+A+N YYQ+  +    C F G       DPSY +CI+
Sbjct  396  SFAFNSYYQQNGASDVACSFGGKGVKVDKDPSYDNCIY  433



>gb|KHN32747.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=463

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED + GPVSE +WG+F+ +G+ VY ++L  S     
Sbjct  260  VLNNSGTPKQPGIAVSTYIYELYNEDLKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VF  318

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQ CY P+++ +HA+YA 
Sbjct  319  ANDTTNQTFCVAKSNADSKMLQAALDWACGP-GKVDCSPLLQGQSCYEPNSVASHATYAI  377

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF+GS   ++  V   A  P+
Sbjct  378  NSYYQQMAKSAGTCDFKGVASITTTNPSHGSCIFSGSGGKNVTSVNGTALAPS  430



>ref|XP_011078239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Sesamum 
indicum]
Length=494

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 7/163 (4%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    I  Y++ LFNE+++PG  SER+WG+FFP+ ++VY ++  G     +
Sbjct  293  VINDTGTPAKPGEEIDVYLFSLFNENRKPGLESERNWGLFFPDQTSVYNLDFTGKGVVDM  352

Query  561  ANN------SSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
              N      S+   +CIA P AS+  L+ G+DWAC   GN +CSAIQP QPC+ PD L +
Sbjct  353  TMNATNITGSNGTTWCIASPTASDADLKNGLDWACS-SGNVDCSAIQPSQPCFEPDNLAS  411

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            HASYA+N YYQ+  +    C F G    T  +PSY SC++  S
Sbjct  412  HASYAFNSYYQQNGATDIACSFGGAGVRTNKNPSYDSCLYVMS  454



>gb|KJB57757.1| hypothetical protein B456_009G179400 [Gossypium raimondii]
Length=471

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 2/156 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  316  VLDRSGTPLHPEITSSVYIYELFNEDLRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-L  374

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FCIA  G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  375  ANDTTNQTFCIAMDGVDSKTLQTALDWACGP-GRANCSEIQPGESCYQPNNVKNHASYAF  433

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            + YYQ      G+CDF G A  TT DPS+GSC+F G
Sbjct  434  DSYYQMEGKASGSCDFKGVAMITTTDPSHGSCVFPG  469



>ref|XP_006855931.1| hypothetical protein AMTR_s00037p00209440 [Amborella trichopoda]
 gb|ERN17398.1| hypothetical protein AMTR_s00037p00209440 [Amborella trichopoda]
Length=478

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   ++    YIYELFNED RP PVSE +WG+F+ NG+ VY +++ G+    +
Sbjct  303  VLDRSGTPKHPEITSSVYIYELFNEDLRPLPVSEMNWGLFYGNGTPVYLLHVSGTGVF-M  361

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A   A +  LQ  +DWACGP G+ NC+ IQPG+ CY P+ +++HASYA+
Sbjct  362  ANDTTNRTFCVAVEDADKKMLQAALDWACGP-GHTNCTEIQPGEVCYDPNNVKSHASYAF  420

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTG  274
            + YYQ+   VGG+CDF+G AT TT DPS+ SCIF G
Sbjct  421  DSYYQKEGKVGGSCDFNGVATVTTTDPSHASCIFPG  456



>gb|KFK43454.1| hypothetical protein AALP_AA1G127200 [Arabis alpina]
Length=511

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            + + TG P   +M    YIYELFNED R  PVSE SWG+F+ N + VY +++ GS    +
Sbjct  312  IFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-L  370

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CI   G     LQ  +DWACGP G ANCS IQPG+ CY P+ ++ HAS+A+
Sbjct  371  ANDTTNQTYCIVMDGVDAKTLQAALDWACGP-GRANCSEIQPGESCYQPNNVKGHASFAF  429

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YYQ+     G+CDF G A  TT DPS+GSCIF GS
Sbjct  430  NSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGS  466



>gb|AES70967.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=491

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 2/169 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  YIYEL+NEDK+PG +SE++WG+F  NG  VY + L GS A  +
Sbjct  294  VLNKTGTPKLPGIGVSTYIYELYNEDKQPGALSEKNWGLFDSNGVPVYVLQLTGSGA-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++    +C+A+ GA    LQ GIDWACGP G  +CS +  G+PCY PD +  HA+YA+
Sbjct  353  ANDTKGETYCVAKDGADPKMLQAGIDWACGP-GKVDCSPLLQGKPCYDPDNVVAHANYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPA  235
            + YY ++     +C+F+  AT +T DPS+GSCIF GS   S    P P+
Sbjct  412  DAYYHKMGKSTESCNFNDMATISTSDPSHGSCIFPGSLGFSNAPAPAPS  460



>ref|XP_006599425.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Glycine max]
Length=446

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED + GPVSE +WG+F+ +G+ VY ++L  S     
Sbjct  243  VLNNSGTPKQPGIAVSTYIYELYNEDLKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VF  301

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQ CY P+++ +HA+YA 
Sbjct  302  ANDTTNQTFCVAKSNADSKMLQAALDWACGP-GKVDCSPLLQGQSCYEPNSVASHATYAI  360

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF+GS   ++  V   A  P+
Sbjct  361  NSYYQQMAKSAGTCDFKGVASITTTNPSHGSCIFSGSGGKNVTSVNGTALAPS  413



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 107/170 (63%), Gaps = 4/170 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P      +  YIYEL+NED +PG +SE++WG+F  NG  +Y ++L GS A  +
Sbjct  294  VFNKTGTPKHPGTAVSTYIYELYNEDTKPGVLSEKNWGLFDANGVPIYILHLTGSGA-VL  352

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN++S   FC+A+ GA    +Q  +DWACGP G   C  +  GQPCY PD +  HA+YA+
Sbjct  353  ANDTSNQTFCVAKDGADPKMIQAALDWACGP-GKVECDLLLQGQPCYEPDNVIAHANYAF  411

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS--SNSSIGGVPTP  238
            + YY ++ +   +CDF G AT TT DPS+GSCIF GS   NS+ G    P
Sbjct  412  DSYYHKMGNTPDSCDFKGVATITTSDPSHGSCIFPGSLGKNSTFGNFTAP  461



>ref|XP_006649652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Oryza brachyantha]
Length=525

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N TG P    + +  +IYEL++ED RPG  SE+ WG+F  NG   Y ++L GS    +
Sbjct  319  VMNTTGTPKHPGVAVPTFIYELYDEDTRPGSASEKYWGLFNMNGVPAYTLHLTGSGV-LL  377

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A+ GA E  LQ  +DWACGP G  +CSA+  GQPCY PDT+Q H++YA+
Sbjct  378  ANDTTNQTYCVAREGADEKMLQAALDWACGP-GKVDCSALMQGQPCYDPDTVQAHSTYAF  436

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            N YY  +    GTC F G A  TT DPS+GSC+++GS
Sbjct  437  NAYYHGMGMGSGTCYFSGVAVITTTDPSHGSCVYSGS  473



>gb|KJB65051.1| hypothetical protein B456_010G078300 [Gossypium raimondii]
Length=506

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 110/192 (57%), Gaps = 11/192 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    +  YI+ LFNE+++PGP SER+WG+F+P+ ++VY ++  G+    +
Sbjct  293  VINDSGTPAKPGEELDVYIFSLFNENRKPGPESERNWGLFYPDQTSVYNLDFTGNGIVDV  352

Query  561  AN-----NSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
             N     NS+   +CIA   ASE  LQ  +DWACGP GN +CS IQP QPC+ PD   +H
Sbjct  353  TNSGNGTNSNVTTWCIASSKASEADLQNALDWACGP-GNVDCSPIQPSQPCFEPDNTLSH  411

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAP  217
            AS+A+N YYQ+  +    C F G       DPSY +CI+  +      G+   A      
Sbjct  412  ASFAFNSYYQQNGATDVACSFGGNGVKVDKDPSYDNCIYVTTK-----GINKTATSNMTS  466

Query  216  VGKGSMARAPDI  181
            +   S +R  ++
Sbjct  467  IASTSSSRRTEV  478



>gb|KJB27172.1| hypothetical protein B456_004G282300 [Gossypium raimondii]
Length=504

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 99/158 (63%), Gaps = 5/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V NDTG P++    +  YI+ LFNE+++PG  SER+WG+F+P+ +++Y ++  G     +
Sbjct  293  VLNDTGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDM  352

Query  561  ANNSSAG----VFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHA  394
             N++        +CIA   ASE  LQ  IDWACGP GN +CSAIQP QPC+ PD L +HA
Sbjct  353  TNSTDGSKNGTTWCIASSKASEADLQNAIDWACGP-GNVDCSAIQPSQPCFEPDNLVSHA  411

Query  393  SYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIF  280
            S+A+N YYQ+  +    C F G       DPSY +CI+
Sbjct  412  SFAFNSYYQQNGASDVACSFGGKGVKVDKDPSYDNCIY  449



>gb|KEH40581.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=498

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P + K+ +  YIYEL+NED R GP SE +WG+F+ NG+ VY ++L G  AG +
Sbjct  294  VLNNTGTPKQPKVTVSTYIYELYNEDLRSGPASESNWGLFYANGAPVYTLHLTG--AGTV  351

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+A+  A    +Q  +DWACGP G  +CS +  GQPC  PD +  HA+YA
Sbjct  352  FANDTTNQTFCVAKSNADSKMIQAALDWACGP-GKVDCSPLLHGQPCSEPDNVVAHATYA  410

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            +N YYQ++    G+CDF G A+ TT +PS+GSC F GS
Sbjct  411  FNAYYQKMDKSPGSCDFKGVASVTTTNPSHGSCRFAGS  448



>ref|XP_003548935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=496

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 2/173 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P +  + +  YIYEL+NED + GPVSE +WG+F+ +G+ VY ++L  S     
Sbjct  293  VLNNSGTPKQPGIAVSTYIYELYNEDLKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VF  351

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   FC+A+  A    LQ  +DWACGP G  +CS +  GQ CY P+++ +HA+YA 
Sbjct  352  ANDTTNQTFCVAKSNADSKMLQAALDWACGP-GKVDCSPLLQGQSCYEPNSVASHATYAI  410

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPT  223
            N YYQ++    GTCDF G A+ TT +PS+GSCIF+GS   ++  V   A  P+
Sbjct  411  NSYYQQMAKSAGTCDFKGVASITTTNPSHGSCIFSGSGGKNVTSVNGTALAPS  463



>ref|XP_007012990.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY30609.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=430

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 111/189 (59%), Gaps = 10/189 (5%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V ND+G P++    +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G  A  +
Sbjct  218  VINDSGTPAKPGEELDVYIFSLFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDM  277

Query  561  ANN-----SSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
             N+     S+   +CIA   ASE+ LQ  +DWACG  GN +CSAIQP QPC+ PD L +H
Sbjct  278  TNSGNGTKSNGTTWCIASSKASESDLQNALDWACG-SGNVDCSAIQPSQPCFEPDNLVSH  336

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAP  217
            AS+A+N YYQ+  +    C F G       DPSY +CI+     ++ G   T A   TA 
Sbjct  337  ASFAFNSYYQQNGASDVACSFGGNGVKVDKDPSYDNCIYL----TTRGINKTAASNTTAM  392

Query  216  VGKGSMARA  190
                S  RA
Sbjct  393  ANTSSSTRA  401



>ref|XP_008384081.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
1 [Malus domestica]
Length=540

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + +G P   +     Y+YELFNED R  PVSE +WG+F+ N SAVY +++ GS +  +
Sbjct  326  VLDRSGTPLHPETTSSVYVYELFNEDVRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-L  384

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CIA  G     LQ  +DWACGP G ANCS IQPG+ CYSP+ +++HASYA+
Sbjct  385  ANDTTNQTYCIAMDGVDGKSLQAALDWACGP-GLANCSEIQPGEDCYSPNNVKSHASYAF  443

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSS  259
            N Y+Q+     G+CDF G AT TT DPS+GSC+F GS  +S
Sbjct  444  NSYFQKQGRAAGSCDFKGVATITTTDPSHGSCMFPGSKKAS  484



>ref|XP_003569762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 111/183 (61%), Gaps = 11/183 (6%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGS-----  577
            V ND+G P++    I  YI+ LFNE+++PG  SER+WG+F P+ S++Y ++  G      
Sbjct  296  VVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSLDWSGRGNVDI  355

Query  576  -SAGQIANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQN  400
             + G + N  S G +C+A    SE  LQ G++WACGP GN +CSAIQP QPCY PDTL +
Sbjct  356  MTGGNLTN--SNGTWCVASTNVSETALQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLVS  412

Query  399  HASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFT--GSSNSSIGGVPTPAFGP  226
            HASYA+N YYQ+  +    C F G    TT DPSY +C++   GS  S++     P    
Sbjct  413  HASYAFNSYYQQNGANDVACGFGGAGVRTTKDPSYDTCVYMAAGSKMSTMNSTTPPGRSS  472

Query  225  TAP  217
            + P
Sbjct  473  SGP  475



>ref|XP_011009861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Populus euphratica]
Length=499

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 107/179 (60%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N++G P++L   +  YI+ LFNE+++PG  SER+WG+F+P+ ++VY ++  G     +
Sbjct  294  VINNSGTPAKLGEELDVYIFSLFNENRKPGMESERNWGLFYPDQTSVYSLDFSGKGVLDV  353

Query  561  ANNSSAGVF-----CIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNH  397
              N S   F     CIA   AS+  LQ  +DWACG  GN +CSAIQP QPC+ PDTL +H
Sbjct  354  PANKSLTSFNGTTWCIASNNASQLDLQNALDWACG-SGNVDCSAIQPSQPCFEPDTLVSH  412

Query  396  ASYAYNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  220
            ASYA+N YYQ+  +    C F GT      DPSY +C++  + ++      T A   T+
Sbjct  413  ASYAFNSYYQQNGASDVACSFGGTGVKVNKDPSYDNCMYMITGSNKTAASNTTAIASTS  471



>ref|XP_009397776.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -1

Query  702  PIH------AYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAG  541
            P+H       YIYELF+ED RPGP SE SWG+F  NG+  Y + + G+  G +AN+++  
Sbjct  309  PLHPEATPSVYIYELFDEDLRPGPASEASWGLFHGNGTPAYLLRVAGT-GGLLANDTTDR  367

Query  540  VFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRV  361
             +C+A        LQ  +DWACGP G ANCS IQPGQ CY+P+ L++HASYA++ YYQ+ 
Sbjct  368  TYCVAAEVTDRRTLQAALDWACGP-GLANCSEIQPGQSCYAPNNLRSHASYAFDSYYQKE  426

Query  360  QSVggtcdfdgtattttvDPSYGSCIFTGSS--NSSIGGV  247
                G+C F G A  TT DPS+G CIF GS   N ++ G+
Sbjct  427  GKAAGSCYFQGVAMVTTTDPSHGDCIFPGSKRMNVTVAGM  466



>ref|XP_004503372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=501

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 113/184 (61%), Gaps = 4/184 (2%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  +IYEL+NED R G VSE++WG+F+ +G  VY ++L G  AG I
Sbjct  297  VLNNTGTPKHPGIAVSTFIYELYNEDLRSGEVSEKNWGLFYADGEPVYTLHLAG--AGVI  354

Query  561  -ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYA  385
             AN+++   FC+ +  A    LQ  +DWACGP G  +CS +  GQPCY PD +  HA+YA
Sbjct  355  FANDTTNQTFCVTKSNADTKMLQAALDWACGP-GKVDCSPLLQGQPCYEPDNVVAHAAYA  413

Query  384  YNDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKG  205
            +N YYQ++    GTCDF G A  TT DPS+GSC+F GS   +   +   +  P+     G
Sbjct  414  FNAYYQKMAKSPGTCDFKGVAVITTTDPSHGSCVFPGSHGKNRTRINGTSLAPSNSTSSG  473

Query  204  SMAR  193
             +++
Sbjct  474  CLSQ  477



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V N+TG P    + +  YIYEL+NED RPG +SE++WG+F  NG  VY ++L GS    +
Sbjct  302  VLNNTGTPKHPGIALSTYIYELYNEDLRPGSISEKNWGLFNANGVPVYILHLTGSGT-VL  360

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +C+A+ GA +  LQ  +DWACGP G  +C+ +  G PCY PDT+  HASYA+
Sbjct  361  ANDTTNQTYCVAKEGADKKLLQAALDWACGP-GKVDCNPLMQGNPCYDPDTVVAHASYAF  419

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YY ++    GTCDF+G AT TT DPS+ SCIF GS
Sbjct  420  DAYYHKMGMTDGTCDFNGVATVTTSDPSHNSCIFPGS  456



>ref|XP_011046950.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Populus euphratica]
Length=528

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  741  VSNDTGPPSELKMPIHAYIYELFNEDKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI  562
            V + TG P   ++    Y+YELFNED R  PVSE +WG+F+ N + VY +++ GS    +
Sbjct  315  VLDRTGTPLHPEITSSVYLYELFNEDLRSPPVSEANWGLFYANATPVYLLHVSGSGTF-L  373

Query  561  ANNSSAGVFCIAQPGASENKLQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAY  382
            AN+++   +CI   G     LQ  +DW CGP G ANCS IQPG+ CY P+ ++NHASYA+
Sbjct  374  ANDTTNQTYCIVMDGVDSKTLQAALDWVCGP-GRANCSEIQPGENCYQPNNVKNHASYAF  432

Query  381  NDYYQRVQSVggtcdfdgtattttvDPSYGSCIFTGS  271
            + YYQ+     G+CDF G A TTT DPS+GSCIF GS
Sbjct  433  DSYYQKEGRASGSCDFKGIAMTTTTDPSHGSCIFPGS  469



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210