BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039K18

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   1e-76   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   1e-76   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   248   1e-76   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   248   1e-76   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   248   1e-76   Citrus sinensis [apfelsine]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             247   2e-76   Citrus clementina [clementine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             247   2e-76   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             247   3e-76   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    246   4e-76   
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    245   1e-75   Vitis vinifera
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    245   1e-75   Vitis vinifera
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          244   2e-75   Eucalyptus grandis [rose gum]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                245   3e-75   Morus notabilis
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   244   3e-75   Citrus sinensis [apfelsine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         243   9e-75   Ricinus communis
ref|NP_001242098.1|  uncharacterized protein LOC100813881               243   1e-74   
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    242   1e-74   
ref|NP_001240201.1|  uncharacterized protein LOC100809066               242   2e-74   Glycine max [soybeans]
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    242   2e-74   
gb|ACU18529.1|  unknown                                                 242   2e-74   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    242   2e-74   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             239   2e-74   
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    241   5e-74   Glycine max [soybeans]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    239   9e-74   Populus euphratica
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    242   1e-73   Glycine max [soybeans]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    242   1e-73   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     240   1e-73   Glycine soja [wild soybean]
emb|CDP19777.1|  unnamed protein product                                239   1e-73   Coffea canephora [robusta coffee]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         239   2e-73   Jatropha curcas
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    239   2e-73   Nicotiana tomentosiformis
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               234   2e-73   Gossypium arboreum [tree cotton]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    239   2e-73   Gossypium raimondii
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    238   3e-73   
gb|KJB79998.1|  hypothetical protein B456_013G076800                    238   3e-73   Gossypium raimondii
gb|KJB80000.1|  hypothetical protein B456_013G076800                    238   4e-73   Gossypium raimondii
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               239   5e-73   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     239   5e-73   Glycine soja [wild soybean]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    236   7e-73   Gossypium raimondii
gb|KJB80005.1|  hypothetical protein B456_013G076900                    237   1e-72   Gossypium raimondii
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             237   1e-72   Phaseolus vulgaris [French bean]
gb|KJB79995.1|  hypothetical protein B456_013G076600                    237   1e-72   Gossypium raimondii
gb|KJB80004.1|  hypothetical protein B456_013G076900                    236   2e-72   Gossypium raimondii
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             237   2e-72   Phaseolus vulgaris [French bean]
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          236   2e-72   Populus euphratica
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    236   3e-72   Populus euphratica
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             235   3e-72   
gb|AFK43607.1|  unknown                                                 231   3e-72   Lotus japonicus
ref|XP_002516727.1|  uv excision repair protein rad23, putative         236   3e-72   Ricinus communis
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    234   3e-72   Populus euphratica
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          236   3e-72   Sesamum indicum [beniseed]
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    236   3e-72   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           236   3e-72   Populus trichocarpa [western balsam poplar]
emb|CDP02781.1|  unnamed protein product                                235   5e-72   Coffea canephora [robusta coffee]
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             236   5e-72   
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    236   5e-72   Cicer arietinum [garbanzo]
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    235   5e-72   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    235   6e-72   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    235   6e-72   Populus euphratica
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          235   1e-71   
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               234   1e-71   Prunus mume [ume]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             234   2e-71   Prunus persica
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          234   2e-71   Tarenaya hassleriana [spider flower]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   234   3e-71   Citrus sinensis [apfelsine]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    236   3e-71   
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          233   3e-71   Sesamum indicum [beniseed]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               233   4e-71   Pyrus x bretschneideri [bai li]
gb|EPS71284.1|  hypothetical protein M569_03474                         233   4e-71   Genlisea aurea
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               234   4e-71   Solanum lycopersicum
gb|KEH44233.1|  RAD23 UV excision repair family protein                 233   4e-71   Medicago truncatula
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    233   4e-71   Nicotiana sylvestris
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   234   4e-71   Citrus sinensis [apfelsine]
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                233   4e-71   Erythranthe guttata [common monkey flower]
gb|ABD96960.1|  hypothetical protein                                    234   5e-71   Tarenaya spinosa
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          233   5e-71   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          234   6e-71   
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    233   8e-71   Populus euphratica
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    232   8e-71   Nicotiana sylvestris
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             233   8e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    233   8e-71   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           232   9e-71   
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    232   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    232   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    232   1e-70   Populus euphratica
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    232   1e-70   Populus euphratica
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    232   1e-70   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    232   2e-70   Fragaria vesca subsp. vesca
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    231   2e-70   Populus euphratica
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             232   3e-70   
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             231   3e-70   Prunus persica
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          232   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             231   3e-70   Prunus persica
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          231   4e-70   Solanum tuberosum [potatoes]
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          224   5e-70   Nicotiana tomentosiformis
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          231   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          230   6e-70   
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               231   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               229   8e-70   Vitis vinifera
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               229   8e-70   
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          229   9e-70   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          229   1e-69   Citrus sinensis [apfelsine]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                234   1e-69   
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               229   1e-69   Nicotiana sylvestris
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  228   2e-69   Citrus sinensis [apfelsine]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    229   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             228   2e-69   Citrus clementina [clementine]
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             228   4e-69   Capsella rubella
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             228   6e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             229   6e-69   Capsella rubella
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    227   8e-69   Camelina sativa [gold-of-pleasure]
ref|NP_198663.1|  ubiquitin receptor RAD23d                             226   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             226   1e-68   
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    227   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             226   1e-68   
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          226   2e-68   Amborella trichopoda
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             226   3e-68   Eutrema salsugineum [saltwater cress]
dbj|BAC76393.1|  RAD23-like protein                                     224   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    225   5e-68   Nicotiana tomentosiformis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    225   6e-68   Nicotiana sylvestris
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                226   7e-68   Erythranthe guttata [common monkey flower]
gb|AAK59766.1|  unknown protein                                         224   7e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186903.1|  UV excision repair protein RAD23C                     225   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  225   9e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67404.1|  BnaA07g14440D                                          224   9e-68   
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               224   1e-67   Brassica rapa
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    224   1e-67   Nicotiana sylvestris
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    223   1e-67   Nicotiana tomentosiformis
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    224   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY58121.1|  BnaCnng32650D                                          224   1e-67   Brassica napus [oilseed rape]
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          224   1e-67   Phoenix dactylifera
gb|ABB02636.1|  RAD23-like                                              223   2e-67   Solanum tuberosum [potatoes]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    224   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    224   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   3e-67   Elaeis guineensis
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    222   4e-67   
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    222   4e-67   
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   4e-67   Elaeis guineensis
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   5e-67   Phoenix dactylifera
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    222   5e-67   Solanum lycopersicum
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    222   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    222   5e-67   Solanum lycopersicum
emb|CDY01661.1|  BnaC04g30910D                                          222   5e-67   
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   6e-67   Phoenix dactylifera
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               222   6e-67   Brassica rapa
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    222   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   7e-67   Nelumbo nucifera [Indian lotus]
emb|CDX74522.1|  BnaA04g08670D                                          222   7e-67   
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    223   8e-67   Arabis alpina [alpine rockcress]
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   1e-66   Phoenix dactylifera
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    223   1e-66   Arabis alpina [alpine rockcress]
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    223   1e-66   
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    223   1e-66   Phoenix dactylifera
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    223   1e-66   
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    221   1e-66   Solanum lycopersicum
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        221   1e-66   Nicotiana tabacum [American tobacco]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               221   2e-66   Solanum tuberosum [potatoes]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    221   2e-66   Arabis alpina [alpine rockcress]
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          220   3e-66   Elaeis guineensis
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          220   4e-66   Elaeis guineensis
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          217   8e-65   Pyrus x bretschneideri [bai li]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    216   9e-65   Tarenaya hassleriana [spider flower]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    216   9e-65   Tarenaya hassleriana [spider flower]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       218   1e-64   Cucumis sativus [cucumbers]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          218   1e-64   Cucumis melo [Oriental melon]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                216   1e-64   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                216   1e-64   Erythranthe guttata [common monkey flower]
emb|CDX74251.1|  BnaA03g27960D                                          216   1e-64   
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          215   2e-64   
emb|CDX91998.1|  BnaC03g33000D                                          216   2e-64   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               216   2e-64   Brassica rapa
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               216   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   3e-64   
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          213   2e-63   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          213   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    211   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    212   5e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    211   5e-63   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA72741.1|  RAD23, isoform I                                       212   5e-63   Daucus carota [carrots]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          212   5e-63   
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    211   7e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    212   7e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    211   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    209   2e-61   Elaeis guineensis
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    209   2e-61   Elaeis guineensis
gb|ACN40029.1|  unknown                                                 207   4e-61   Picea sitchensis
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   2e-60   
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    204   3e-60   Cicer arietinum [garbanzo]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 204   6e-60   Medicago truncatula
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          199   4e-58   Fragaria vesca subsp. vesca
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          198   2e-57   Oryza brachyantha
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                197   4e-57   
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    196   2e-56   Setaria italica
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    195   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    195   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   3e-56   Eucalyptus grandis [rose gum]
dbj|BAJ98767.1|  predicted protein                                      195   3e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ00429.1|  hypothetical protein OsI_22453                          195   3e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   3e-56   Eucalyptus grandis [rose gum]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          195   3e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001057334.1|  Os06g0264300                                       195   4e-56   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    194   4e-56   
gb|KJB69954.1|  hypothetical protein B456_011G053200                    192   4e-56   Gossypium raimondii
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               193   4e-56   Gossypium arboreum [tree cotton]
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         193   5e-56   Jatropha curcas
gb|ABK24371.1|  unknown                                                 193   9e-56   Picea sitchensis
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            191   1e-55   
gb|KJB69952.1|  hypothetical protein B456_011G053200                    192   1e-55   Gossypium raimondii
gb|EMS61794.1|  putative DNA repair protein RAD23                       194   1e-55   Triticum urartu
gb|ACH72675.1|  RAD23                                                   193   1e-55   Pinus sylvestris var. mongolica
gb|EMT27109.1|  Putative DNA repair protein RAD23                       194   1e-55   
ref|NP_001061854.1|  Os08g0430200                                       193   1e-55   
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          192   2e-55   Citrus sinensis [apfelsine]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          193   2e-55   Brachypodium distachyon [annual false brome]
gb|ACG32894.1|  DNA repair protein RAD23                                192   2e-55   Zea mays [maize]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    192   3e-55   Gossypium raimondii
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          191   3e-55   Amborella trichopoda
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               192   3e-55   Vitis vinifera
emb|CBI25247.3|  unnamed protein product                                192   3e-55   Vitis vinifera
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   4e-55   Nicotiana sylvestris
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    190   7e-55   Nicotiana tomentosiformis
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    190   7e-55   Nicotiana tomentosiformis
ref|XP_002303970.1|  DNA repair protein RAD23                           190   7e-55   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          190   9e-55   Populus euphratica
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          190   1e-54   Nelumbo nucifera [Indian lotus]
gb|AFK37577.1|  unknown                                                 190   1e-54   Lotus japonicus
gb|KJB34921.1|  hypothetical protein B456_006G091100                    188   1e-54   Gossypium raimondii
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             190   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   2e-54   Nicotiana sylvestris
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   2e-54   Nicotiana sylvestris
ref|NP_001149140.1|  LOC100282762                                       190   3e-54   Zea mays [maize]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               189   3e-54   Gossypium arboreum [tree cotton]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    189   5e-54   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    189   5e-54   Brachypodium distachyon [annual false brome]
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             188   7e-54   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               188   7e-54   Fragaria vesca subsp. vesca
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          188   8e-54   Populus euphratica
ref|XP_002299163.1|  DNA repair protein RAD23                           187   8e-54   
ref|NP_001266655.1|  DNA repair protein RAD23                           189   8e-54   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               189   8e-54   Zea mays [maize]
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               187   1e-53   
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    187   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          187   2e-53   Solanum tuberosum [potatoes]
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    186   3e-53   Nicotiana sylvestris
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    186   3e-53   Nicotiana sylvestris
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               186   3e-53   Nicotiana tomentosiformis
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          186   6e-53   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          185   6e-53   Sesamum indicum [beniseed]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          185   7e-53   Pyrus x bretschneideri [bai li]
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          185   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             185   9e-53   Prunus persica
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    183   1e-52   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          185   1e-52   Prunus mume [ume]
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    184   2e-52   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      182   9e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    182   9e-52   Cucumis sativus [cucumbers]
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   1e-51   Cucumis melo [Oriental melon]
gb|AEA86337.1|  putative DNA repair protein                             176   1e-51   Solanum nigrum
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       182   1e-51   Brachypodium distachyon [annual false brome]
emb|CDO98260.1|  unnamed protein product                                182   2e-51   Coffea canephora [robusta coffee]
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    182   2e-51   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             181   3e-51   Phaseolus vulgaris [French bean]
ref|NP_001063134.1|  Os09g0407200                                       181   3e-51   
ref|XP_001763027.1|  predicted protein                                  181   3e-51   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               181   4e-51   Gossypium arboreum [tree cotton]
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              180   5e-51   
ref|NP_850982.1|  ubiquitin receptor RAD23b                             180   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             180   7e-51   Arabidopsis lyrata subsp. lyrata
ref|NP_565216.2|  ubiquitin receptor RAD23b                             180   8e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ABG89119.1|  Rad23-3Ai                                               180   8e-51   synthetic construct
gb|ACU20959.1|  unknown                                                 179   8e-51   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               179   1e-50   Glycine max [soybeans]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    179   2e-50   Glycine max [soybeans]
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                179   2e-50   Erythranthe guttata [common monkey flower]
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          179   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              179   2e-50   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         178   2e-50   
ref|NP_173070.1|  DNA repair protein RAD23A                             178   3e-50   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76391.1|  RAD23-like protein                                     178   3e-50   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      178   4e-50   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             178   4e-50   
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    179   4e-50   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    178   4e-50   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             178   5e-50   
gb|AAB65841.1|  osRAD23                                                 178   5e-50   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    178   5e-50   
gb|AEA86336.1|  putative DNA repair protein                             172   5e-50   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       178   6e-50   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    178   7e-50   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    177   7e-50   
emb|CDX81753.1|  BnaC08g38480D                                          177   8e-50   
gb|EMT30328.1|  Putative DNA repair protein RAD23                       179   9e-50   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             177   1e-49   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      177   1e-49   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             177   1e-49   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     176   2e-49   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             176   2e-49   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      176   2e-49   
gb|ACJ83410.1|  unknown                                                 169   2e-49   
dbj|BAC76389.1|  RAD23-like protein                                     176   2e-49   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    176   2e-49   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    176   2e-49   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               176   2e-49   
dbj|BAC76390.1|  RAD23-like protein                                     176   2e-49   
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              171   3e-49   
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               167   4e-49   
ref|XP_003637292.1|  RAD23 protein                                      171   4e-49   
gb|EMS50196.1|  putative DNA repair protein RAD23                       179   5e-49   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               175   6e-49   
gb|ACF79443.1|  unknown                                                 174   1e-48   
ref|NP_001149553.1|  LOC100283179                                       174   2e-48   
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              169   2e-48   
ref|XP_003637291.1|  RAD23 protein                                      174   2e-48   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    173   2e-48   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    173   3e-48   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             173   3e-48   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    173   3e-48   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    173   4e-48   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 174   5e-48   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          172   6e-48   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    172   7e-48   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    172   7e-48   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              172   9e-48   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          172   1e-47   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   4e-47   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   4e-47   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          171   4e-47   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   4e-47   
emb|CDY33351.1|  BnaC05g12320D                                          169   5e-47   
emb|CDY35071.1|  BnaA06g10810D                                          170   5e-47   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      170   5e-47   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     169   3e-46   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    168   3e-46   
ref|XP_001780766.1|  predicted protein                                  168   5e-46   
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    159   8e-46   
emb|CAA72742.1|  RAD23 protein, isoform II                              167   9e-46   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          167   1e-45   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               165   2e-45   
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   2e-45   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    166   3e-45   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    166   3e-45   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    165   4e-45   
dbj|BAK04690.1|  predicted protein                                      165   4e-45   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    165   4e-45   
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   165   4e-45   
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    157   6e-45   
emb|CDX79333.1|  BnaC06g19700D                                          164   8e-45   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          164   1e-44   
gb|EEC72612.1|  hypothetical protein OsI_06092                          163   2e-44   
ref|NP_001046083.1|  Os02g0179300                                       163   2e-44   
emb|CDX67983.1|  BnaA07g20230D                                          164   2e-44   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    162   3e-44   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 162   4e-44   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    162   5e-44   
ref|NP_001148810.1|  LOC100282427                                       162   5e-44   
ref|XP_001752264.1|  predicted protein                                  153   2e-43   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          160   3e-43   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          154   2e-41   
dbj|BAC76395.1|  RAD23-like protein                                     154   3e-41   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    153   6e-41   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    154   7e-41   
gb|AAF68123.1|AC010793_18  F20B17.8                                     149   4e-39   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    147   5e-38   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    147   5e-38   
ref|NP_974181.1|  ubiquitin receptor RAD23b                             140   7e-36   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    132   4e-33   
gb|ACG24239.1|  hypothetical protein                                    122   1e-31   
dbj|BAJ97496.1|  predicted protein                                      129   2e-31   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     129   2e-31   
emb|CAB65692.1|  Rad23 Protein                                          120   3e-31   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     125   4e-31   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                124   5e-30   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...    123   1e-29   
gb|KGL75456.1|  UV excision repair protein RAD23 B                      123   2e-29   
ref|XP_005708114.1|  nucleotide excision repair protein                 123   2e-29   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     122   4e-29   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    122   5e-29   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    120   8e-29   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-28   
gb|KFU98476.1|  UV excision repair protein RAD23 B                      120   1e-28   
ref|XP_002432231.1|  uv excision repair protein rad23, putative         120   1e-28   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-28   
ref|XP_010306604.1|  PREDICTED: UV excision repair protein RAD23 ...    114   3e-28   
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    119   3e-28   
emb|CDQ90828.1|  unnamed protein product                                119   5e-28   
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   5e-28   
emb|CDQ83149.1|  unnamed protein product                                119   6e-28   
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          118   6e-28   
ref|XP_010284737.1|  PREDICTED: UV excision repair protein RAD23 ...    115   6e-28   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...    118   6e-28   
gb|EIE84327.1|  UV excision repair protein Rad23                        119   6e-28   
gb|KJB80001.1|  hypothetical protein B456_013G076800                    117   8e-28   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...    118   8e-28   
ref|XP_010161922.1|  PREDICTED: UV excision repair protein RAD23 ...    114   9e-28   
ref|XP_009977358.1|  PREDICTED: UV excision repair protein RAD23 ...    114   9e-28   
gb|EPS72838.1|  hypothetical protein M569_01918                         117   1e-27   
ref|XP_009958718.1|  PREDICTED: UV excision repair protein RAD23 ...    114   1e-27   
dbj|BAM18172.1|  UV excision repair protein rad23                       116   1e-27   
gb|KFV93588.1|  UV excision repair protein RAD23 B                      115   1e-27   
ref|XP_010150954.1|  PREDICTED: UV excision repair protein RAD23 ...    115   1e-27   
ref|XP_003081625.1|  Nucleotide excision repair factor NEF2, RAD2...    115   2e-27   
ref|XP_005240425.1|  PREDICTED: UV excision repair protein RAD23 ...    117   2e-27   
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...    117   2e-27   
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...    117   2e-27   
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...    117   2e-27   
gb|KFP28504.1|  UV excision repair protein RAD23 B                      117   2e-27   
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...    116   2e-27   
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...    116   2e-27   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...    116   2e-27   
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...    116   3e-27   
ref|XP_005446959.1|  PREDICTED: UV excision repair protein RAD23 ...    117   3e-27   
gb|KFV48041.1|  UV excision repair protein RAD23 B                      117   3e-27   
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    116   3e-27   
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...    116   3e-27   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...    117   3e-27   
gb|KFP54135.1|  UV excision repair protein RAD23 B                      117   3e-27   
gb|KFV42406.1|  UV excision repair protein RAD23 B                      116   3e-27   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...    117   3e-27   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...    117   3e-27   
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...    117   3e-27   
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...    116   3e-27   
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...    116   4e-27   
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...    116   4e-27   
gb|KFP78669.1|  UV excision repair protein RAD23 B                      116   4e-27   
gb|KHF98435.1|  Putative DNA repair RAD23-4 -like protein               109   4e-27   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...    117   4e-27   
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...    116   4e-27   
gb|KFQ93153.1|  UV excision repair protein RAD23 B                      116   4e-27   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...    116   4e-27   
gb|KFP45297.1|  UV excision repair protein RAD23 B                      116   4e-27   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...    116   4e-27   
emb|CEF99377.1|  UBA-like                                               116   4e-27   
ref|XP_009996457.1|  PREDICTED: UV excision repair protein RAD23 ...    115   4e-27   
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...    115   5e-27   
gb|KFP09954.1|  UV excision repair protein RAD23 B                      116   5e-27   
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...    115   5e-27   
gb|KFM01514.1|  UV excision repair protein RAD23 B                      116   5e-27   
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...    115   5e-27   
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...    115   6e-27   
ref|XP_008495758.1|  PREDICTED: UV excision repair protein RAD23 ...    115   6e-27   
gb|KFU90019.1|  UV excision repair protein RAD23 B                      116   6e-27   
ref|XP_010011187.1|  PREDICTED: UV excision repair protein RAD23 ...    115   6e-27   
ref|XP_005013373.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    116   6e-27   
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...    115   6e-27   
ref|XP_009070739.1|  PREDICTED: UV excision repair protein RAD23 ...    113   6e-27   
gb|KGL96224.1|  UV excision repair protein RAD23 B                      115   7e-27   
gb|KFW80798.1|  UV excision repair protein RAD23 B                      115   7e-27   
ref|XP_009964886.1|  PREDICTED: UV excision repair protein RAD23 ...    117   7e-27   
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...    115   8e-27   
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...    114   8e-27   
gb|KFW73791.1|  UV excision repair protein RAD23 B                      115   8e-27   
gb|KFQ43918.1|  UV excision repair protein RAD23 B                      115   8e-27   
gb|KFP03775.1|  UV excision repair protein RAD23 B                      115   8e-27   
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...    115   8e-27   
gb|KFP78177.1|  UV excision repair protein RAD23 B                      113   8e-27   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5       115   9e-27   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...    115   9e-27   
gb|KFP68145.1|  UV excision repair protein RAD23 B                      115   1e-26   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like    115   1e-26   
gb|KFO78985.1|  UV excision repair protein RAD23 B                      115   1e-26   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...    115   1e-26   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein           115   1e-26   
ref|XP_009685841.1|  PREDICTED: UV excision repair protein RAD23 ...    115   1e-26   
gb|KFW08178.1|  UV excision repair protein RAD23 B                      115   1e-26   
ref|XP_002503857.1|  predicted protein                                  115   1e-26   
dbj|BAM19254.1|  UV excision repair protein rad23                       114   1e-26   
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...    114   1e-26   
gb|KFV87804.1|  UV excision repair protein RAD23 B                      115   1e-26   
ref|XP_005502851.1|  PREDICTED: UV excision repair protein RAD23 ...    114   2e-26   
gb|KFQ29720.1|  UV excision repair protein RAD23 B                      114   2e-26   
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...    114   2e-26   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...    114   2e-26   
ref|XP_005646102.1|  UV excision repair protein Rad23                   114   2e-26   
gb|KFQ83380.1|  UV excision repair protein RAD23 B                      114   2e-26   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...    114   3e-26   
gb|EMC77210.1|  UV excision repair protein RAD23 like protein B         114   3e-26   
ref|XP_009487270.1|  PREDICTED: UV excision repair protein RAD23 ...    114   3e-26   
ref|XP_007875448.1|  UV excision repair protein Rad23                   114   3e-26   
ref|XP_003431168.1|  PREDICTED: UV excision repair protein RAD23 ...    110   3e-26   
ref|XP_004949424.1|  PREDICTED: UV excision repair protein RAD23 ...    114   3e-26   
ref|XP_004949423.1|  PREDICTED: UV excision repair protein RAD23 ...    114   3e-26   
gb|KFQ54436.1|  UV excision repair protein RAD23 B                      114   3e-26   
ref|XP_001625753.1|  predicted protein                                  114   4e-26   
ref|XP_009905224.1|  PREDICTED: UV excision repair protein RAD23 ...    113   4e-26   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...    113   4e-26   
ref|NP_001231653.1|  UV excision repair protein RAD23 homolog B i...    113   5e-26   
gb|KFV72415.1|  UV excision repair protein RAD23 B                      113   5e-26   
dbj|BAE89144.1|  unnamed protein product                                110   5e-26   
ref|XP_007950132.1|  PREDICTED: UV excision repair protein RAD23 ...    113   5e-26   
ref|XP_007178312.1|  PREDICTED: UV excision repair protein RAD23 ...    113   5e-26   
gb|AAP81008.1|  RAD23-like protein B                                    113   5e-26   
ref|XP_006906142.1|  PREDICTED: UV excision repair protein RAD23 ...    113   5e-26   
ref|XP_005968716.1|  PREDICTED: UV excision repair protein RAD23 ...    113   5e-26   
emb|CAF91196.1|  unnamed protein product                                112   5e-26   
ref|XP_009455312.1|  PREDICTED: UV excision repair protein RAD23 ...    113   5e-26   
ref|XP_008706147.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    112   6e-26   
ref|XP_007462497.1|  PREDICTED: UV excision repair protein RAD23 ...    113   6e-26   
ref|XP_003260372.1|  PREDICTED: UV excision repair protein RAD23 ...    113   6e-26   



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  273  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  332

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  333  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  392

Query  291  HEFED  277
            HEFED
Sbjct  393  HEFED  397



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  272  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  331

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  332  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  391

Query  291  HEFED  277
            HEFED
Sbjct  392  HEFED  396



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  279  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  338

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  339  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  398

Query  291  HEFED  277
            HEFED
Sbjct  399  HEFED  403



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  278  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  337

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  338  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  397

Query  291  HEFED  277
            HEFED
Sbjct  398  HEFED  402



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  279  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  338

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  339  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  398

Query  291  HEFED  277
            HEFED
Sbjct  399  HEFED  403



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  277  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  337  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  396

Query  291  HEFED  277
            HEFED
Sbjct  397  HEFED  401



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  276  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  335

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  336  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  395

Query  291  HEFED  277
            HEFED
Sbjct  396  HEFED  400



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  277  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  337  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  396

Query  291  HEFED  277
            HEFED
Sbjct  397  HEFED  401



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP EGGE
Sbjct  261  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPAEGGE  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  321  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEFED
Sbjct  381  HEFED  385



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/125 (95%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  273  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  332

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  333  GNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  392

Query  291  HEFED  277
            HEFED
Sbjct  393  HEFED  397



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/125 (95%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  274  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  333

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  334  GNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  393

Query  291  HEFED  277
            HEFED
Sbjct  394  HEFED  398



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP+EGGE
Sbjct  277  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPLEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA+SMPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+
Sbjct  337  GNILGQLASSMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHI  396

Query  291  HEFED  277
            HE+ED
Sbjct  397  HEYED  401



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  295  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  354

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  355  GNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  414

Query  291  HEFED  277
            HEF+D
Sbjct  415  HEFDD  419



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  273  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  332

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  333  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  392

Query  291  HEFED  277
            HEFED
Sbjct  393  HEFED  397



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEPVEGGE
Sbjct  285  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQTDFLRLINEPVEGGE  344

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNI+GQLAA+MPQAV VTPEEREAIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHM
Sbjct  345  GNIMGQLAAAMPQAVTVTPEEREAIERLEAMGFDRGLVLEVFFACNKNEELAANYLLDHM  404

Query  291  HEFED  277
            HEFED
Sbjct  405  HEFED  409



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  276  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  335

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  336  GNILGQLAGTMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  395

Query  291  HEFED  277
            HEF++
Sbjct  396  HEFDE  400



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  318  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  377

Query  291  HEFED  277
            HEF++
Sbjct  378  HEFDE  382



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  268  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  327

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA++MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  328  GNILGQLASAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  387

Query  291  HEFED  277
            HEF++
Sbjct  388  HEFDE  392



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  259  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  318

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  319  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  378

Query  291  HEFED  277
            HEF++
Sbjct  379  HEFDE  383



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  318  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  377

Query  291  HEFED  277
            HEF++
Sbjct  378  HEFDE  382



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  277  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  337  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  396

Query  291  HEFED  277
            HEF++
Sbjct  397  HEFDE  401



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE GE
Sbjct  211  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVESGE  270

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  271  GNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  330

Query  291  HEF  283
            HEF
Sbjct  331  HEF  333



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EGGE
Sbjct  277  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQ+A+ MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  337  GNILGQMASGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  396

Query  291  HEFED  277
            HEFE+
Sbjct  397  HEFEE  401



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMR IQEHQ DFLRLINEPVE GE
Sbjct  256  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRFIQEHQDDFLRLINEPVESGE  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  316  GNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  375

Query  291  HEF  283
            HEF
Sbjct  376  HEF  378



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  344  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  403

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  404  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  463

Query  291  HEFED  277
            HEF++
Sbjct  464  HEFDE  468



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  345  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  404

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  405  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  464

Query  291  HEFED  277
            HEF++
Sbjct  465  HEFDE  469



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  292  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGE  351

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHM
Sbjct  352  GNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHM  411

Query  291  HEFED  277
            HEF++
Sbjct  412  HEFDE  416



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP+EGGE
Sbjct  266  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPIEGGE  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQ +QVT EEREAI RLE MGFDRA VLEVFFACNKNEELAANYLLDHM
Sbjct  326  GNILGQLAGAMPQTIQVTAEEREAIRRLEEMGFDRATVLEVFFACNKNEELAANYLLDHM  385

Query  291  HEFED  277
            HEFE+
Sbjct  386  HEFEE  390



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG E
Sbjct  259  DFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-E  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  318  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  377

Query  291  HEFED  277
            HEFE+
Sbjct  378  HEFEE  382



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  271  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  330

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDHM
Sbjct  331  GNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHM  390

Query  291  HEFED  277
            HEFE+
Sbjct  391  HEFEE  395



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  98   DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  157

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  158  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  217

Query  291  HEFED  277
            H+F+D
Sbjct  218  HDFQD  222



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  260  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  320  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            H+F+D
Sbjct  380  HDFQD  384



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  253  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  312

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDHM
Sbjct  313  GNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDHM  372

Query  291  HEFED  277
            HEFE+
Sbjct  373  HEFEE  377



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  260  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  320  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            H+F+D
Sbjct  380  HDFQD  384



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  258  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  318  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  377

Query  291  HEFED  277
            H+F+D
Sbjct  378  HDFQD  382



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EG E
Sbjct  283  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAE  342

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  343  GNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  402

Query  291  HEFED  277
            HEFE+
Sbjct  403  HEFEE  407



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EG E
Sbjct  285  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAE  344

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  345  GNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  404

Query  291  HEFED  277
            HEFE+
Sbjct  405  HEFEE  409



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGE
Sbjct  216  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGE  275

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  276  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  335

Query  291  HEFED  277
            H+F+D
Sbjct  336  HDFQD  340



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  261  DFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  321  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            H+F+D
Sbjct  381  HDFQD  385



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGE
Sbjct  277  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+
Sbjct  337  GNILGQLAGGMPQAVSVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHI  396

Query  291  HEFED  277
            HEF++
Sbjct  397  HEFDE  401



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGE
Sbjct  260  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  320  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            H+F+D
Sbjct  380  HDFQD  384



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGE
Sbjct  260  DFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHM
Sbjct  320  GNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            H+F+D
Sbjct  380  HDFQD  384



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGE
Sbjct  275  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGE  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+
Sbjct  335  GNILGQLAGGMPQAVTVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHI  394

Query  291  HEFED  277
            HEF++
Sbjct  395  HEFDE  399



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  264  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGE  323

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNI G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+
Sbjct  324  GNISGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHI  383

Query  291  HEFED  277
            HEFED
Sbjct  384  HEFED  388



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  263  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  321

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  322  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  381

Query  291  HEFED  277
            HEF++
Sbjct  382  HEFDE  386



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  228  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGE  287

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+
Sbjct  288  GNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHI  347

Query  291  HEFED  277
            HEFED
Sbjct  348  HEFED  352



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQ+HQ DFLRLINEPVEGGE
Sbjct  102  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQDHQVDFLRLINEPVEGGE  161

Query  471  GNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            GNILGQ A A+MPQAV VTPEEREAIERLEAMGFDRA VLEV+FACNKNEELAANYLLDH
Sbjct  162  GNILGQPAGAAMPQAVSVTPEEREAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDH  221

Query  294  MHEFED  277
            MHEF++
Sbjct  222  MHEFDE  227



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG +
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-D  316

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ+V VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  317  GNLLGQLASAVPQSVSVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            H+FE+
Sbjct  377  HDFEE  381



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  214  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  272

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  273  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  332

Query  291  HEFED  277
            HEF++
Sbjct  333  HEFDE  337



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  257  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG-E  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  316  GNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  375

Query  291  HEFED  277
            HEF+D
Sbjct  376  HEFDD  380



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  262  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  321  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEF++
Sbjct  381  HEFDE  385



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  262  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  321  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEF++
Sbjct  381  HEFDE  385



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG E
Sbjct  264  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-E  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEEREAIERLEAMGFD ALVLEVFFACNKNEELAANYLLDHM
Sbjct  323  GNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDPALVLEVFFACNKNEELAANYLLDHM  382

Query  291  HEFED  277
            HEF++
Sbjct  383  HEFDE  387



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  272  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGE  331

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+
Sbjct  332  GNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHI  391

Query  291  HEFED  277
            HEFED
Sbjct  392  HEFED  396



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGE
Sbjct  275  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGE  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQ+A  MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+
Sbjct  335  GNLLGQMAGGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHI  394

Query  291  HEFED  277
            HEF++
Sbjct  395  HEFDE  399



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  250  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  308

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  309  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  368

Query  291  HEFED  277
            HEF++
Sbjct  369  HEFDE  373



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  268  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  327  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEF++
Sbjct  387  HEFDE  391



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG E
Sbjct  267  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-E  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHM
Sbjct  326  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHM  385

Query  291  HEFED  277
            HEF++
Sbjct  386  HEFDE  390



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  273  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  332

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH
Sbjct  333  GNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDH  392

Query  294  MHEFED  277
            MHEFE+
Sbjct  393  MHEFEE  398



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGE
Sbjct  261  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGE  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  321  GNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEFE+
Sbjct  381  HEFEE  385



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGE
Sbjct  261  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGE  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  321  GNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEFE+
Sbjct  381  HEFEE  385



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  282  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  341

Query  471  -GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
             GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH
Sbjct  342  GGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  401

Query  294  MHEFED  277
            +HEF++
Sbjct  402  IHEFDE  407



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 117/125 (94%), Gaps = 4/125 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R MVQANPQILQ    ELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  278  DFLRNSQQFQALRTMVQANPQILQ----ELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  333

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  334  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  393

Query  291  HEFED  277
            HEFED
Sbjct  394  HEFED  398



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG E
Sbjct  364  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-E  422

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDR +VLEVFFACNKNEELAANYLLDHM
Sbjct  423  GNLLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRNIVLEVFFACNKNEELAANYLLDHM  482

Query  291  HEFED  277
            HEFE+
Sbjct  483  HEFEE  487



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  257  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG-E  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  316  GNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  375

Query  291  HEFED  277
            HEF++
Sbjct  376  HEFDE  380



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGE
Sbjct  267  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGE  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  327  GNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEFE+
Sbjct  387  HEFEE  391



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRN+ QFQA RAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGE
Sbjct  265  EFLRNTPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEGGE  324

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++LGQLA  MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDH 
Sbjct  325  GDLLGQLAGGMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHG  384

Query  291  HEFED  277
            HEFED
Sbjct  385  HEFED  389



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  284  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  343

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH
Sbjct  344  GNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDH  403

Query  294  MHEFED  277
            +HEFE+
Sbjct  404  IHEFEE  409



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 122/126 (97%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGE
Sbjct  271  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGE  330

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G N+LGQ+AA MPQ+V VTPEER+AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDH
Sbjct  331  GNNLLGQMAAGMPQSVTVTPEERQAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDH  390

Query  294  MHEFED  277
            MHEF++
Sbjct  391  MHEFDE  396



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGG 
Sbjct  270  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGG  329

Query  474  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            EGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH
Sbjct  330  EGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDH  389

Query  294  MHEFED  277
            +HEFE+
Sbjct  390  IHEFEE  395



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  630  QFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  451
            QFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  313  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  372

Query  450  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  277
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  373  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  430



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG E
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-E  316

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQ V VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  317  GNILGQLAEAMPQTVNVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            HEF+D
Sbjct  377  HEFDD  381



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  310  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  369

Query  471  -GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
             GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH
Sbjct  370  GGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  429

Query  294  MHEFED  277
            +HEF++
Sbjct  430  IHEFDE  435



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGE
Sbjct  263  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  323  GNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  382

Query  291  HEFED  277
            HEFE+
Sbjct  383  HEFEE  387



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEGG 
Sbjct  309  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGGA  368

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNIL QLA +MPQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  369  GNILEQLAGAMPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  428

Query  291  HEFED  277
            HEFE+
Sbjct  429  HEFEE  433



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  276  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  335  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  394

Query  291  HEFED  277
            HEF++
Sbjct  395  HEFDE  399



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGG 
Sbjct  252  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGG  311

Query  474  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            EGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYLLDH
Sbjct  312  EGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYLLDH  371

Query  294  MHEFED  277
            +HEFE+
Sbjct  372  IHEFEE  377



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  276  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  335  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  394

Query  291  HEFED  277
            HEF++
Sbjct  395  HEFDE  399



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  275  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  333

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  334  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  393

Query  291  HEFED  277
            HEF++
Sbjct  394  HEFDE  398



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  261  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  320  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEF++
Sbjct  380  HEFDE  384



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 3/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  266  DFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  326  GNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  382

Query  291  HEFED  277
            HEFED
Sbjct  383  HEFED  387



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 3/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE
Sbjct  265  DFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  324

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  325  GNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  381

Query  291  HEFED  277
            HEFED
Sbjct  382  HEFED  386



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  316

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  317  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            HEF++
Sbjct  377  HEFDE  381



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  259  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  318  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  377

Query  291  HEFED  277
            HEF++
Sbjct  378  HEFDE  382



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR+S QFQA RAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGE
Sbjct  277  DFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGE  336

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHM
Sbjct  337  GDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHM  396

Query  291  HEFED  277
            HEFED
Sbjct  397  HEFED  401



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR+S QFQA RAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGE
Sbjct  276  DFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGE  335

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHM
Sbjct  336  GDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHM  395

Query  291  HEFED  277
            HEFED
Sbjct  396  HEFED  400



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  241  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  299

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  300  GNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHM  359

Query  291  HEFED  277
            HEF++
Sbjct  360  HEFDE  364



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  289  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  348

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQ+AA M  PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  349  ESGNLLGQMAAGMPQPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  408

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  409  LDHMHEFEE  417



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR+SQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGE
Sbjct  263  DFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  323  GNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEFE+
Sbjct  381  HEFEE  385



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  292  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  351

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  352  ESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  411

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  412  LDHMHEFEE  420



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR+SQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGE
Sbjct  263  DFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  323  GNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  380

Query  291  HEFED  277
            HEFE+
Sbjct  381  HEFEE  385



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  267  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  326  GNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  385

Query  291  HEFED  277
            HEF++
Sbjct  386  HEFDE  390



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  71   DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  129

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  130  GNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  189

Query  291  HEFED  277
            HEF++
Sbjct  190  HEFDE  194



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  291  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  350

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  351  ESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  410

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  411  LDHMHEFEE  419



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR SQQFQA RAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGE
Sbjct  262  DFLRGSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGE  321

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  322  GNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEFE+
Sbjct  380  HEFEE  384



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  294  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  353

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  354  ESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  413

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  414  LDHMHEFEE  422



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE GE
Sbjct  259  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE-GE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQL  ++PQAV +TPEERE+IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  318  GNVLGQL-GTVPQAVTITPEERESIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            HEFE+
Sbjct  377  HEFEE  381



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  266  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  324

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDH+
Sbjct  325  GNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHL  384

Query  291  HEFED  277
            HEF++
Sbjct  385  HEFDE  389



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGE
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGE  317

Query  471  -GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
             GNI  QL  +MPQA+QVTPEEREAIERLEAMGF+R LVLEVFFACNKNEELAANYLLDH
Sbjct  318  GGNISSQLGGAMPQAIQVTPEEREAIERLEAMGFERGLVLEVFFACNKNEELAANYLLDH  377

Query  294  MHEFED  277
            MHEF++
Sbjct  378  MHEFDE  383



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQ  RAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGE
Sbjct  266  DFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGE  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  326  GNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  385

Query  291  HEFED  277
            HEFED
Sbjct  386  HEFED  390



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  425  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  483

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  484  GNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  543

Query  291  HEFED  277
            HEF+D
Sbjct  544  HEFDD  548



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG E
Sbjct  264  DFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-E  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHM
Sbjct  323  GNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHM  382

Query  291  HEFED  277
            HEF++
Sbjct  383  HEFDE  387



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQ  RAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGE
Sbjct  243  DFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGE  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  303  GNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  362

Query  291  HEFED  277
            HEFED
Sbjct  363  HEFED  367



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A +A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG E
Sbjct  267  DFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTE  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  327  GNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEFED
Sbjct  387  HEFED  391



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQ  RAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGE
Sbjct  266  DFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGE  325

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  326  GNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHM  385

Query  291  HEFED  277
            HEFED
Sbjct  386  HEFED  390



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  261  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  320

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  321  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEFED
Sbjct  380  HEFED  384



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  265  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  324

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  325  -NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  383

Query  291  HEFED  277
            HEFED
Sbjct  384  HEFED  388



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  299  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  358

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LG +AA +  PQA+QVTPEEREAIERLE MGFDRALVLEVFFACNKNEELAANYL
Sbjct  359  ESGNLLGHMAAGIPQPQAIQVTPEEREAIERLEGMGFDRALVLEVFFACNKNEELAANYL  418

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  419  LDHMHEFEE  427



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   227 bits (578),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E
Sbjct  253  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE  312

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  313  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  371

Query  291  HEFED  277
            HEFED
Sbjct  372  HEFED  376



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  254  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  314  -NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHM  372

Query  291  HEFED  277
            HEFED
Sbjct  373  HEFED  377



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  244  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  303

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  304  ESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  363

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  364  LDHMHEFEE  372



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINEP EG E
Sbjct  263  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINEPAEGEE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  323  -NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  381

Query  291  HEFED  277
            HEFED
Sbjct  382  HEFED  386



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQ+FQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  253  DFLRNSQKFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  312

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  313  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  371

Query  291  HEFED  277
            HEFED
Sbjct  372  HEFED  376



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINEP EG E
Sbjct  260  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINEPAEGEE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  320  -NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  378

Query  291  HEFED  277
            HEFED
Sbjct  379  HEFED  383



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E
Sbjct  252  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE  311

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  312  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  370

Query  291  HEFED  277
            HEFED
Sbjct  371  HEFED  375



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E
Sbjct  250  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE  309

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  310  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  368

Query  291  HEFED  277
            HEFED
Sbjct  369  HEFED  373



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGG  475
            +FLRNSQQFQA R M QANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE P EG 
Sbjct  264  DFLRNSQQFQALRDMFQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEQPAEGA  323

Query  474  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            EGN+LGQLA++MPQAV VTPEEREAIERLEA+GFDRALVLEVFFACNKNEELAANYLLDH
Sbjct  324  EGNLLGQLASAMPQAVTVTPEEREAIERLEALGFDRALVLEVFFACNKNEELAANYLLDH  383

Query  294  MHEFED  277
            M+EFE+
Sbjct  384  MNEFEE  389



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  288  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  347

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  348  ESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  407

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  408  LDHMHEFEE  416



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  209  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  268

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  269  ESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  328

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  329  LDHMHEFEE  337



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  260  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  318

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  319  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  378

Query  291  HEFED  277
            HEF++
Sbjct  379  HEFDE  383



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  264  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  323  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  382

Query  291  HEFED  277
            HEF++
Sbjct  383  HEFDE  387



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RA+VQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG +
Sbjct  321  DFLRNSQQFQALRAVVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-D  379

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQ+V VT EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  380  GNVLGQLAEAMPQSVAVTAEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  439

Query  291  HEFED  277
            HEF+D
Sbjct  440  HEFDD  444



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  254  DFLRNSHQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  314  -NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHM  372

Query  291  HEFED  277
            HEFED
Sbjct  373  HEFED  377



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  291  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  350

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  351  ESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  410

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  411  LDHMHEFEE  419



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  290  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGG  349

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYL
Sbjct  350  ESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYL  409

Query  303  LDHMHEFED  277
            LDHMHEFE+
Sbjct  410  LDHMHEFEE  418



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  318  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            HEFE+
Sbjct  377  HEFEE  381



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  258  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  318  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  376

Query  291  HEFED  277
            HEFE+
Sbjct  377  HEFEE  381



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  246  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  304

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  305  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  364

Query  291  HEFED  277
            HEF++
Sbjct  365  HEFDE  369



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  242  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  300

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  301  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  360

Query  291  HEFED  277
            HEF++
Sbjct  361  HEFDE  365



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A +A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG E
Sbjct  267  DFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTE  326

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDH
Sbjct  327  GSNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDH  386

Query  294  MHEFED  277
            MHEFED
Sbjct  387  MHEFED  392



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  260  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  320  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  378

Query  291  HEFED  277
            HEFE+
Sbjct  379  HEFEE  383



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E
Sbjct  260  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPTEGAE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             ++LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  320  SDLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEFED
Sbjct  380  HEFED  384



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  261  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEE+AANYLLDHM
Sbjct  320  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEEMAANYLLDHM  379

Query  291  HEFED  277
            HEF++
Sbjct  380  HEFDE  384



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A +A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG E
Sbjct  284  DFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTE  343

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  344  GNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  403

Query  291  HEFED  277
            HEFED
Sbjct  404  HEFED  408



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A +A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG E
Sbjct  285  DFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTE  344

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  345  GNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  404

Query  291  HEFED  277
            HEFED
Sbjct  405  HEFED  409



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E
Sbjct  271  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAE  330

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  331  SNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  390

Query  291  HEFED  277
            HEFED
Sbjct  391  HEFED  395



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E
Sbjct  244  DFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-E  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  303  SNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  362

Query  291  HEFED  277
            HEFED
Sbjct  363  HEFED  367



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E
Sbjct  247  DFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-E  305

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  306  SNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  365

Query  291  HEFED  277
            HEFED
Sbjct  366  HEFED  370



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E
Sbjct  272  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAE  331

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  332  SNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  391

Query  291  HEFED  277
            HEFED
Sbjct  392  HEFED  396



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E
Sbjct  265  DFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-E  323

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  324  SNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  383

Query  291  HEFED  277
            HEFED
Sbjct  384  HEFED  388



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  258  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  316

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHM
Sbjct  317  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHM  376

Query  291  HEFED  277
            HEF++
Sbjct  377  HEFDE  381



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQF+A R MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E
Sbjct  257  DFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE  316

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  317  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  375

Query  291  HEFED  277
            HEFED
Sbjct  376  HEFED  380



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  260  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  318

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHM
Sbjct  319  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHM  378

Query  291  HEFED  277
            HEF++
Sbjct  379  HEFDE  383



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  254  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  314  -NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  372

Query  291  HEFED  277
            HEFE+
Sbjct  373  HEFEE  377



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E
Sbjct  268  DFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-E  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  327  SNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEFED
Sbjct  387  HEFED  391



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  254  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  314  -NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  372

Query  291  HEFED  277
            HEFE+
Sbjct  373  HEFEE  377



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQF+A R MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E
Sbjct  255  DFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE  314

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  315  -NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  373

Query  291  HEFED  277
            HEFED
Sbjct  374  HEFED  378



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 115/125 (92%), Gaps = 4/125 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA R MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE GE
Sbjct  263  DFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE-GE  321

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+
Sbjct  322  GNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHI  378

Query  291  HEFED  277
            HEFE+
Sbjct  379  HEFEE  383



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  256  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHM
Sbjct  316  -NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHM  374

Query  291  HEFED  277
            HEFE+
Sbjct  375  HEFEE  379



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQ  RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  297  DFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGA  356

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELAANYL
Sbjct  357  ETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELAANYL  416

Query  303  LDHMHEFED  277
            LDH+HEFE+
Sbjct  417  LDHIHEFEE  425



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E
Sbjct  327  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAE  386

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  387  SNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  446

Query  291  HEFED  277
            HEFED
Sbjct  447  HEFED  451



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 4/129 (3%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQ  RAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG 
Sbjct  307  DFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGA  366

Query  474  -EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  304
              GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELAANYL
Sbjct  367  ETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELAANYL  426

Query  303  LDHMHEFED  277
            LDH+HEFE+
Sbjct  427  LDHIHEFEE  435



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E
Sbjct  328  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAE  387

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  388  SNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  447

Query  291  HEFED  277
            HEFED
Sbjct  448  HEFED  452



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E
Sbjct  326  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAE  385

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  386  SNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  445

Query  291  HEFED  277
            HEFED
Sbjct  446  HEFED  450



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E
Sbjct  327  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAE  386

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  387  SNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  446

Query  291  HEFED  277
            HEFED
Sbjct  447  HEFED  451



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  242  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  300

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLLDHM
Sbjct  301  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLLDHM  360

Query  291  HEFED  277
            HEF++
Sbjct  361  HEFDE  365



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE  E
Sbjct  264  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVES-E  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHM
Sbjct  323  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHM  382

Query  291  HEFED  277
            HEF++
Sbjct  383  HEFDE  387



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL NS QFQA RAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG E
Sbjct  259  DFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-E  317

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFAC KNEE+AANYLLDHM
Sbjct  318  GNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACXKNEEMAANYLLDHM  377

Query  291  HEFED  277
            HEF++
Sbjct  378  HEFDE  382



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E
Sbjct  268  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE  327

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N++ QL A+MPQAV VTPEEREAIERLEAMGF+RA+VLEVFFACNKNEELAANYLLDHM
Sbjct  328  -NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFERAMVLEVFFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEF++
Sbjct  387  HEFDE  391



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QF+A + +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E
Sbjct  260  DFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAE  319

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             ++LGQ A+ MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  320  SDLLGQFASPMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEFED
Sbjct  380  HEFED  384



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA +A+VQANPQIL+PMLQELGKQNP +MRLIQEHQ +FL LINEP EGGE
Sbjct  267  DFLRNSPQFQAFKALVQANPQILRPMLQELGKQNPLVMRLIQEHQDEFLCLINEPAEGGE  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLAA+MPQA+ VTPEE EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  327  SNLLGQLAAAMPQALTVTPEECEAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  386

Query  291  HEFED  277
            HEFED
Sbjct  387  HEFED  391



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR++QQFQA R+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGE
Sbjct  263  DFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LG   A++PQA+ ++PEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHM
Sbjct  323  GNVLGD--AAVPQAIAISPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHM  380

Query  291  HEFED  277
            HEFED
Sbjct  381  HEFED  385



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  EG E
Sbjct  254  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQGEGEE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYLLDH+
Sbjct  314  -NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYLLDHI  372

Query  291  HEFED  277
            HEFED
Sbjct  373  HEFED  377



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  EG E
Sbjct  255  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQGEGEE  314

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYLLDH+
Sbjct  315  -NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYLLDHI  373

Query  291  HEFED  277
            HEFED
Sbjct  374  HEFED  378



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+EG E
Sbjct  294  DFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEPLEG-E  352

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANYLLDH+
Sbjct  353  GNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANYLLDHI  412

Query  291  HEFE  280
            HEFE
Sbjct  413  HEFE  416



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 1/124 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+EG E
Sbjct  296  DFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEPLEG-E  354

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANYLLDH+
Sbjct  355  GNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANYLLDHI  414

Query  291  HEFE  280
            HEFE
Sbjct  415  HEFE  418



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+EG E
Sbjct  250  DFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPIEGAE  309

Query  471  GNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANYLLDH
Sbjct  310  GDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANYLLDH  369

Query  294  MHEFED  277
            MHEFE+
Sbjct  370  MHEFEE  375



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQA RAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+EG E
Sbjct  251  DFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPIEGAE  310

Query  471  GNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANYLLDH
Sbjct  311  GDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANYLLDH  370

Query  294  MHEFED  277
            MHEFE+
Sbjct  371  MHEFEE  376



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG 
Sbjct  276  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGA  335

Query  474  EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
            EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLD
Sbjct  336  EGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLD  394

Query  297  HMHEFED  277
            HMHEFE+
Sbjct  395  HMHEFEE  401



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR++QQFQA R+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGE
Sbjct  237  DFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGE  296

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN LG   A++PQA+ +TPEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHM
Sbjct  297  GNALGD--AAVPQAIAITPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHM  354

Query  291  HEFED  277
            HEFED
Sbjct  355  HEFED  359



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG 
Sbjct  278  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGA  337

Query  474  EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
            EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLD
Sbjct  338  EGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLD  396

Query  297  HMHEFED  277
            HMHEFE+
Sbjct  397  HMHEFEE  403



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 3/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-  475
            +FLRNSQQFQA RAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG 
Sbjct  276  DFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGA  335

Query  474  EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
            EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLD
Sbjct  336  EGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLD  394

Query  297  HMHEFED  277
            HMHEFE+
Sbjct  395  HMHEFEE  401



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA RAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINEPVE GE
Sbjct  279  DFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEPVE-GE  337

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L QL ++MP +V VTPEEREAIERLE MGF RA VL+V+FACNKNEELAANYLLDHM
Sbjct  338  GNLLSQLTSAMPASVSVTPEEREAIERLEGMGFRRATVLQVYFACNKNEELAANYLLDHM  397

Query  291  HEFED  277
             EFE+
Sbjct  398  DEFEN  402



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   206 bits (525),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -3

Query  609  MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQA  430
            MVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQA
Sbjct  1    MVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQA  60

Query  429  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  277
            V VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  61   VTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR++QQFQA R+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLRLINEP EGGE
Sbjct  256  DFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGTHQADFLRLINEPAEGGE  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LG   A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEELAANYLLDHM
Sbjct  316  GNVLGD--AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEELAANYLLDHM  373

Query  291  HEFED  277
            HEFED
Sbjct  374  HEFED  378



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR++QQFQA R+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLRLINEP EGGE
Sbjct  262  DFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGAHQADFLRLINEPAEGGE  321

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LG   A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEELAANYLLDHM
Sbjct  322  GNVLGD--AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEELAANYLLDHM  379

Query  291  HEFED  277
            HEFED
Sbjct  380  HEFED  384



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  232  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  291

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  292  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  351

Query  291  HEF  283
            HEF
Sbjct  352  HEF  354



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  251  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  310

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  311  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  370

Query  291  HEF  283
            HEF
Sbjct  371  HEF  373



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  235  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  294

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  295  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  354

Query  291  HEF  283
            HEF
Sbjct  355  HEF  357



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLR +QQFQA RAMVQ+NPQILQPMLQELGKQNPHLMRLIQEHQADFL+LINEP+EGGE
Sbjct  264  DFLRTNQQFQALRAMVQSNPQILQPMLQELGKQNPHLMRLIQEHQADFLQLINEPMEGGE  323

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+LG      PQA+ VTPEER+AIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHM
Sbjct  324  -NLLGH----GPQAISVTPEERDAIERLEAMGFDRELVLEVFFACNKNEELAANYLLDHM  378

Query  291  HEFE  280
            HEFE
Sbjct  379  HEFE  382



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FL+NS QF+A +A+VQANPQ LQPMLQELGKQNP ++RLIQEHQ +FLRLINEP EG E
Sbjct  266  DFLQNSPQFRALQALVQANPQFLQPMLQELGKQNPQILRLIQEHQGEFLRLINEPAEGTE  325

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G NILGQL   MPQA+ VTPEE EAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDH
Sbjct  326  GGNILGQLPTGMPQALSVTPEEHEAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDH  385

Query  294  MHEFED  277
            MHEFED
Sbjct  386  MHEFED  391



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  254  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  314  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  373

Query  291  HEF  283
            HEF
Sbjct  374  HEF  376



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  270  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  329

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  330  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  389

Query  291  HEF  283
            HEF
Sbjct  390  HEF  392



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS+QFQA RAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG E
Sbjct  273  DFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKE  332

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHM
Sbjct  333  GNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHM  392

Query  291  HEF  283
            HEF
Sbjct  393  HEF  395



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 116/151 (77%), Gaps = 26/151 (17%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQ--------------------------PMLQELGKQN  550
            +FLRNS QF+A + +VQANPQILQ                          PMLQELGKQN
Sbjct  271  DFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQELGKQN  330

Query  549  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  370
            P +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFD
Sbjct  331  PQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFD  390

Query  369  RALVLEVFFACNKNEELAANYLLDHMHEFED  277
            RALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  391  RALVLEVFFACNKNEELAANYLLDHMHEFED  421



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 116/151 (77%), Gaps = 26/151 (17%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQ--------------------------PMLQELGKQN  550
            +FLRNS QF+A + +VQANPQILQ                          PMLQELGKQN
Sbjct  272  DFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQELGKQN  331

Query  549  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  370
            P +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFD
Sbjct  332  PQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFD  391

Query  369  RALVLEVFFACNKNEELAANYLLDHMHEFED  277
            RALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  392  RALVLEVFFACNKNEELAANYLLDHMHEFED  422



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQA R MVQANPQILQPMLQEL KQNP LMRLIQ+HQADFLRL+NEPVEG E
Sbjct  279  DFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQADFLRLVNEPVEGAE  338

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+   QLA +MPQA+ VTPEEREAIERLEAMGFDRALV+E F AC+KNE+LAANYLL+H 
Sbjct  339  GDFFNQLAGAMPQAINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEQLAANYLLEHA  398

Query  291  HEFED  277
             ++ED
Sbjct  399  GDYED  403



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGE
Sbjct  265  DFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGE  324

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA-NYLLDH  295
            GN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV EV+FACNKNEELA+  +L   
Sbjct  325  GNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVPEVYFACNKNEELASIPFLCLG  384

Query  294  MHEFE  280
             H+F 
Sbjct  385  WHKFS  389



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRNS QFQA R MVQANPQILQPMLQELGKQNPHLM LIQEHQADFLRLINEP  GGE
Sbjct  255  EFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMELIQEHQADFLRLINEP--GGE  312

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+  QL A++PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH 
Sbjct  313  ENLESQLGAAVPQTITITPEEHEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQ  372

Query  291  HEFED  277
            +EF+D
Sbjct  373  NEFDD  377



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRNSQQFQA R MVQANPQILQPMLQELGKQNP+LM LIQEHQADFLRLINEP  GGE
Sbjct  248  EFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPNLMELIQEHQADFLRLINEP--GGE  305

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             N+ GQL A  PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH 
Sbjct  306  ENLEGQLGALAPQTITITPEENEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQ  365

Query  291  HEFED  277
            +EF+D
Sbjct  366  NEFDD  370



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNS QFQA R MVQANPQILQPML ELGKQNPHLM+LIQ HQADFLRLINEPVEGG 
Sbjct  264  DFLRNSPQFQALRTMVQANPQILQPMLLELGKQNPHLMQLIQAHQADFLRLINEPVEGGG  323

Query  471  GNILGQL--AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
               L     +A+MPQAV VTPEEREAIERLEAMGF+RALVLEV+FACNKNEELAANYLLD
Sbjct  324  EGNLLGQLGSAAMPQAVTVTPEEREAIERLEAMGFERALVLEVYFACNKNEELAANYLLD  383

Query  297  HMHEFED  277
            HMHEFE+
Sbjct  384  HMHEFEE  390



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  469
            LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  284  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGTGG  343

Query  468  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  289
            NILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH H
Sbjct  344  NILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGH  403

Query  288  EFED  277
            EFED
Sbjct  404  EFED  407



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQ  R+MVQANPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEP+EG E
Sbjct  297  DFLRNNQQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPLEGSE  356

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTPEE+EAIERLEAMGFDRALV+E + AC++NEELAANYLL+H 
Sbjct  357  GDIFDQPEQDMPHAINVTPEEQEAIERLEAMGFDRALVIEAYLACDRNEELAANYLLEHA  416

Query  291  HEFED  277
             +FED
Sbjct  417  GDFED  421



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-  469
            LR   QFQA   +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G 
Sbjct  284  LRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGAGG  343

Query  468  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  289
            NILGQLAA+MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH H
Sbjct  344  NILGQLAAAMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDHGH  403

Query  288  EFED  277
            EF++
Sbjct  404  EFDE  407



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  264  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSE  323

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  324  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  383

Query  291  HEFED  277
             +FED
Sbjct  384  GDFED  388



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  263  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  323  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  382

Query  291  HEFED  277
             +FED
Sbjct  383  GDFED  387



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  249  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSE  308

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  309  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  368

Query  291  HEFED  277
             +FED
Sbjct  369  GDFED  373



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  469
            LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  289  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  348

Query  468  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  289
            NILG LAA MPQAVQVTPEEREAI+RLE+MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  349  NILGALAAQMPQAVQVTPEEREAIQRLESMGFNRELVLEVFFACNRDEELAANYLLDHGH  408

Query  288  EFED  277
            EFE+
Sbjct  409  EFEE  412



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G 
Sbjct  285  DALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGT  344

Query  471  --GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
              GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLD
Sbjct  345  AGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLD  404

Query  297  HMHEFED  277
            H HEFED
Sbjct  405  HGHEFED  411



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  250  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSE  309

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  310  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  369

Query  291  HEFED  277
             +FED
Sbjct  370  GDFED  374



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LRN+ QF+   ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP EG E
Sbjct  275  DVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAE  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM
Sbjct  335  GNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNKDEQLAANYLLDHM  394

Query  291  HEFED  277
            +EF+D
Sbjct  395  NEFDD  399



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G 
Sbjct  285  DALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGA  344

Query  471  --GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  298
              GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLD
Sbjct  345  AGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLD  404

Query  297  HMHEFED  277
            H HEFED
Sbjct  405  HGHEFED  411



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  249  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  308

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  309  GDIFDQAEQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  368

Query  291  HEFED  277
             +FED
Sbjct  369  GDFED  373



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  193  DFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  252

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  253  GDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENG  312

Query  291  HEFED  277
             +FED
Sbjct  313  GDFED  317



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  238  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  297

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP AV VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  298  GDIFDQAEQEMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENG  357

Query  291  HEFED  277
             +FED
Sbjct  358  GDFED  362



>gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas]
Length=352

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP+EG E
Sbjct  228  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLEGSE  287

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q+   MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  288  GDIFDQVDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  347

Query  291  HEFED  277
             +FED
Sbjct  348  GDFED  352



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQA R MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE  EG  
Sbjct  269  DFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINEETEG--  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAANYLL+H 
Sbjct  327  -DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHA  385

Query  291  HEFED  277
             ++ED
Sbjct  386  ADYED  390



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQ +FL+LINEPV+G E
Sbjct  177  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQTEFLQLINEPVDGSE  236

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  237  GDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENA  296

Query  291  HEFED  277
             +FED
Sbjct  297  GDFED  301



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  238  DFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  297

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  298  GDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENG  357

Query  291  HEFED  277
             +FED
Sbjct  358  GDFED  362



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  469
            LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  299  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  358

Query  468  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  289
            NILG LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  359  NILGALAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGH  418

Query  288  EFED  277
            EFE+
Sbjct  419  EFEE  422



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQA R MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE  +G  
Sbjct  269  DFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINEETDG--  326

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
             ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAANYLL+H 
Sbjct  327  -DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHA  385

Query  291  HEFED  277
             ++ED
Sbjct  386  ADYED  390



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  469
            LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  298  LRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGG  357

Query  468  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  289
            NILG LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH H
Sbjct  358  NILGALAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGH  417

Query  288  EFED  277
            EFE+
Sbjct  418  EFEE  421



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LRN+ QF+   ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP EG E
Sbjct  275  DVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAE  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK+E LAANYLLDHM
Sbjct  335  GNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNKDELLAANYLLDHM  394

Query  291  HEFED  277
            +EF+D
Sbjct  395  NEFDD  399



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEPV+G E
Sbjct  253  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPVDGSE  312

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  313  GDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENA  372

Query  291  HEFED  277
             +FED
Sbjct  373  GDFED  377



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -3

Query  645  LRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEG  469
            LR   QFQA  A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  G
Sbjct  287  LRALPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAAG  346

Query  468  NILGQLAASMPQA-VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            NILGQLAA+MPQA V VTPEERE+I+RLEAMGF+R LVLEVFFACN++EELAANYLLDH 
Sbjct  347  NILGQLAAAMPQAAVTVTPEERESIQRLEAMGFNRELVLEVFFACNRDEELAANYLLDHG  406

Query  291  HEFED  277
            HE+ED
Sbjct  407  HEYED  411



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA   +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG 
Sbjct  274  DALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGP  333

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH
Sbjct  334  GGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDH  393

Query  294  MHEFED  277
             HEF++
Sbjct  394  GHEFDE  399



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  249  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLQGSE  308

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  309  GDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENS  368

Query  291  HEFED  277
             +FED
Sbjct  369  GDFED  373



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN++QFQ  R MVQANPQILQPMLQEL KQNP L+RLIQEHQA+FL+LINEP EG E
Sbjct  246  DFLRNNEQFQTLRHMVQANPQILQPMLQELSKQNPQLLRLIQEHQAEFLQLINEPAEGAE  305

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++ GQ    MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  306  GDLFGQAEQDMPQSITVTPEEREAIERLEAMGFDRALVIEAFLACDRNEELAINYLLENP  365

Query  291  HEFED  277
             ++ED
Sbjct  366  GDYED  370



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRN+ QFQA RAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG E
Sbjct  287  EFLRNNHQFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSE  346

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  347  GDIFDQPEQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  406

Query  291  HEFED  277
             ++ED
Sbjct  407  GDYED  411



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            EFLRN+ QFQA RAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG E
Sbjct  275  EFLRNNHQFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSE  334

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  335  GDIFDQPEQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  394

Query  291  HEFED  277
             ++ED
Sbjct  395  GDYED  399



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +
Sbjct  172  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSD  231

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  232  GDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  291

Query  291  HEFED  277
             ++ED
Sbjct  292  GDYED  296



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +
Sbjct  243  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSD  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  303  GDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  362

Query  291  HEFED  277
             ++ED
Sbjct  363  GDYED  367



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +
Sbjct  242  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSD  301

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  302  GDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  361

Query  291  HEFED  277
             ++ED
Sbjct  362  GDYED  366



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  234  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSE  293

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++ 
Sbjct  294  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENA  353

Query  291  HEFED  277
             +FED
Sbjct  354  GDFED  358



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  248  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSE  307

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++ 
Sbjct  308  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENA  367

Query  291  HEFED  277
             +FED
Sbjct  368  GDFED  372



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRNSQQFQA R+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  254  DFLRNSQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEPLEGSE  313

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  314  GDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  373

Query  291  HEFED  277
             +FED
Sbjct  374  GDFED  378



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 107/125 (86%), Gaps = 5/125 (4%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA RAMVQANPQILQPMLQELGKQNPHLM+LIQEHQ+DFL LINEP EG E
Sbjct  257  DFLRNNQQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQEHQSDFLNLINEP-EGEE  315

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
                  LAA M QA+ VTPEE EAI+RLE MGFDR LVLEVF ACN+NE+LAANYLLDH 
Sbjct  316  ----NPLAAGMTQAITVTPEEDEAIQRLEDMGFDRDLVLEVFIACNRNEDLAANYLLDHQ  371

Query  291  HEFED  277
            +EF+D
Sbjct  372  NEFDD  376



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  181  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLQGSE  240

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  241  GDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENS  300

Query  291  HEFED  277
             +FED
Sbjct  301  GDFED  305



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  248  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSE  307

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++ 
Sbjct  308  GDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENA  367

Query  291  HEFED  277
             +FED
Sbjct  368  GDFED  372



>ref|XP_009797063.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797064.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +
Sbjct  244  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSD  303

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  304  GDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  363

Query  291  HEFED  277
             ++ED
Sbjct  364  GDYED  368



>ref|XP_009797065.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +
Sbjct  243  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSD  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  303  GDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  362

Query  291  HEFED  277
             ++ED
Sbjct  363  GDYED  367



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA   +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG 
Sbjct  274  DALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGP  333

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+  LVLEVFFACNK+EELAANYLLDH
Sbjct  334  GGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNHELVLEVFFACNKDEELAANYLLDH  393

Query  294  MHEFED  277
             HEF++
Sbjct  394  GHEFDE  399



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQ+NPQILQPML ELGKQNP L+RLIQEH A+FL+LINEP++G E
Sbjct  249  DFLRNNQQFQALRSMVQSNPQILQPMLLELGKQNPQLLRLIQEHHAEFLQLINEPLQGSE  308

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  309  GDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENS  368

Query  291  HEFED  277
             +FED
Sbjct  369  GDFED  373



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LRN+ QF+   ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP EG E
Sbjct  263  DVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM
Sbjct  323  GNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLLDHM  382

Query  291  HEFED  277
            +EF+D
Sbjct  383  NEFDD  387



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LRN+ QF+   ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP EG E
Sbjct  264  DVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAEGAE  323

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            GN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANYLLDHM
Sbjct  324  GNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLLDHM  383

Query  291  HEFED  277
            +EF+D
Sbjct  384  NEFDD  388



>ref|XP_006368664.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
 gb|ABK95041.1| unknown [Populus trichocarpa]
 gb|ERP65233.1| hypothetical protein POPTR_0001s07510g [Populus trichocarpa]
Length=375

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  251  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDGSE  310

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  311  GDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLENG  370

Query  291  HEFED  277
             +FED
Sbjct  371  ADFED  375



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+ QFQ  R+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  247  DFLRNNHQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  306

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  307  GDMFDQPDQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  366

Query  291  HEFED  277
             +FED
Sbjct  367  GDFED  371



>ref|XP_011034604.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=375

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  251  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDGSE  310

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  311  GDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLENG  370

Query  291  HEFED  277
             +FED
Sbjct  371  ADFED  375



>ref|XP_002299163.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE83968.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=349

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G E
Sbjct  225  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLDGSE  284

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP A+ VTP E+EAIERL AMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  285  GDIFDQPDQDMPHAINVTPAEQEAIERLVAMGFDRALVIEAFLACDRNEELAANYLLENG  344

Query  291  HEFED  277
             +FED
Sbjct  345  ADFED  349



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA   +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG 
Sbjct  277  DALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGP  336

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH
Sbjct  337  GGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDH  396

Query  294  MHEFED  277
             HEF++
Sbjct  397  GHEFDE  402



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            + LR   QFQA   +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG 
Sbjct  277  DALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGP  336

Query  471  G-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  295
            G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH
Sbjct  337  GGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDH  396

Query  294  MHEFED  277
             HEF++
Sbjct  397  GHEFDE  402



>ref|XP_004235877.1| PREDICTED: ubiquitin receptor RAD23b [Solanum lycopersicum]
Length=366

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +
Sbjct  242  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPVDGSD  301

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  302  GDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  361

Query  291  HEFED  277
             ++ED
Sbjct  362  GDYED  366



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  263  DFLRNNQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEPLEGSE  322

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  323  GDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENA  382

Query  291  HEFED  277
             +FED
Sbjct  383  GDFED  387



>ref|XP_006341431.1| PREDICTED: ubiquitin receptor RAD23b-like [Solanum tuberosum]
Length=367

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +
Sbjct  243  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPVDGSD  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  303  GDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  362

Query  291  HEFED  277
             ++ED
Sbjct  363  GDYED  367



>ref|XP_009759118.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Nicotiana sylvestris]
Length=366

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +
Sbjct  242  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINEPVDGSD  301

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  302  GDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  361

Query  291  HEFED  277
             ++ED
Sbjct  362  GDYED  366



>ref|XP_009759117.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Nicotiana sylvestris]
Length=367

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +
Sbjct  243  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINEPVDGSD  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  303  GDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  362

Query  291  HEFED  277
             ++ED
Sbjct  363  GDYED  367



>ref|XP_009615678.1| PREDICTED: ubiquitin receptor RAD23b [Nicotiana tomentosiformis]
Length=367

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +
Sbjct  243  DFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINEPVDGSD  302

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAANYLL+H 
Sbjct  303  GDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHA  362

Query  291  HEFED  277
             ++ED
Sbjct  363  GDYED  367



>ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [Malus domestica]
Length=369

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN++QFQA R+MVQ+NPQILQPMLQELGKQNP L+RLIQEH  +FL+LINEPVEG E
Sbjct  242  DFLRNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPVEGSE  301

Query  471  GNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  301
            G+I  Q       +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL
Sbjct  302  GDIFDQADGPDQDLPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLL  361

Query  300  DHMHEFED  277
            ++  +FED
Sbjct  362  ENAGDFED  369



>ref|XP_011082656.1| PREDICTED: ubiquitin receptor RAD23b-like [Sesamum indicum]
Length=361

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN+QQFQA R++VQANPQILQPMLQELGKQNP L+RLIQE+  +FL+LINEPV+G E
Sbjct  237  DFLRNNQQFQALRSLVQANPQILQPMLQELGKQNPSLLRLIQENHQEFLQLINEPVDGSE  296

Query  471  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  292
            G+I  Q    MP AV VTP E+EAIER+EAMGFDRALV+E F AC++NEELA NYLL++ 
Sbjct  297  GDIFDQAEQEMPHAVSVTPAEQEAIERMEAMGFDRALVIEAFLACDRNEELAVNYLLENA  356

Query  291  HEFED  277
             +FED
Sbjct  357  GDFED  361



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = -3

Query  651  EFLRNSQQFQAXRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  472
            +FLRN++QFQA R+MVQANPQILQPMLQELGKQNP L+RLIQEH  +FL+LINEP+EG E
Sbjct  247  DFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPLEGSE  306

Query  471  GNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  301
            G+I  Q       MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL
Sbjct  307  GDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLL  366

Query  300  DHMHEFED  277
            ++  ++ED
Sbjct  367  ENAGDYED  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250