BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039J05

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13474.1|  unnamed protein product                                166   8e-45   Coffea canephora [robusta coffee]
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    164   8e-44   Solanum lycopersicum
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    164   8e-44   Solanum tuberosum [potatoes]
gb|AGS56396.1|  LRR receptor-like serine/threonine-protein kinase       155   2e-42   Populus tremula [European aspen]
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    158   6e-42   Nicotiana tomentosiformis
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             156   4e-41   
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    154   1e-40   Prunus mume [ume]
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    154   1e-40   Prunus mume [ume]
ref|XP_006452986.1|  hypothetical protein CICLE_v100073972mg            150   2e-40   
gb|KEH39916.1|  LRR receptor-like kinase family protein                 154   2e-40   Medicago truncatula
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    154   2e-40   
gb|AES59193.2|  LRR receptor-like kinase family protein                 154   2e-40   Medicago truncatula
gb|AIR08789.1|  receptor-like kinase ERECTA                             153   4e-40   Medicago sativa [alfalfa]
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    153   5e-40   Vitis vinifera
emb|CBI20727.3|  unnamed protein product                                153   5e-40   Vitis vinifera
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    153   6e-40   Populus euphratica
emb|CAN74952.1|  hypothetical protein VITISV_025649                     151   6e-40   Vitis vinifera
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    152   7e-40   Fragaria vesca subsp. vesca
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    151   2e-39   Glycine max [soybeans]
gb|KDO73637.1|  hypothetical protein CISIN_1g0023491mg                  149   3e-39   Citrus sinensis [apfelsine]
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g             150   5e-39   Phaseolus vulgaris [French bean]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    150   5e-39   Citrus sinensis [apfelsine]
ref|NP_001235257.1|  ERECTA                                             146   6e-39   Glycine max [soybeans]
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             150   6e-39   
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      150   6e-39   Citrus unshiu [satsuma mandarin]
gb|KHG04653.1|  LRR receptor-like serine/threonine-protein kinase...    141   2e-38   Gossypium arboreum [tree cotton]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    147   4e-38   Pyrus x bretschneideri [bai li]
gb|KDP34024.1|  hypothetical protein JCGZ_07595                         147   8e-38   Jatropha curcas
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...    147   8e-38   Malus domestica [apple tree]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    146   1e-37   Nicotiana sylvestris
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    146   1e-37   Cicer arietinum [garbanzo]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    146   1e-37   
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    146   1e-37   Cicer arietinum [garbanzo]
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...    145   2e-37   
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    145   2e-37   Glycine soja [wild soybean]
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    145   3e-37   Eucalyptus grandis [rose gum]
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    145   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...    145   4e-37   Glycine max [soybeans]
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    144   8e-37   Sesamum indicum [beniseed]
ref|XP_002516144.1|  erecta, putative                                   143   1e-36   Ricinus communis
gb|KJB07391.1|  hypothetical protein B456_001G019800                    142   2e-36   Gossypium raimondii
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-36   Sesamum indicum [beniseed]
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-36   Cucumis melo [Oriental melon]
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-36   
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...    141   6e-36   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...    141   6e-36   Glycine max [soybeans]
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...    140   1e-35   
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    140   2e-35   Cucumis sativus [cucumbers]
ref|XP_010060188.1|  PREDICTED: LRR receptor-like serine/threonin...    128   7e-35   Eucalyptus grandis [rose gum]
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg                134   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_010431630.1|  PREDICTED: LRR receptor-like serine/threonin...    126   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    131   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    130   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_010429656.1|  PREDICTED: LRR receptor-like serine/threonin...    126   9e-32   
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg                126   1e-30   Erythranthe guttata [common monkey flower]
dbj|BAD94220.1|  putative receptor-like protein kinase                  123   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    125   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g             125   3e-30   Phaseolus vulgaris [French bean]
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    125   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    124   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    124   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-29   Nelumbo nucifera [Indian lotus]
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    122   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             122   3e-29   
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             122   4e-29   Capsella rubella
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    121   6e-29   Nelumbo nucifera [Indian lotus]
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    117   2e-27   Arabis alpina [alpine rockcress]
gb|KHG05309.1|  LRR receptor-like serine/threonine-protein kinase...    108   1e-26   Gossypium arboreum [tree cotton]
gb|EPS58979.1|  hypothetical protein M569_15834                         108   4e-26   Genlisea aurea
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             112   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440          112   1e-25   
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-25   Brassica rapa
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    111   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    111   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    111   3e-25   Oryza brachyantha
gb|EEC80197.1|  hypothetical protein OsI_22078                          110   4e-25   Oryza sativa Indica Group [Indian rice]
gb|AAL50210.1|  ER1-like receptor kinase                                103   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...    110   4e-25   Oryza brachyantha
gb|EEE65279.1|  hypothetical protein OsJ_20503                          110   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057087.1|  Os06g0203800                                       110   6e-25   
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...    110   7e-25   
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    110   8e-25   Phoenix dactylifera
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...    109   9e-25   Phoenix dactylifera
dbj|BAD16970.1|  receptor protein kinase PERK1-like                     106   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    109   9e-25   Elaeis guineensis
ref|NP_001048290.1|  Os02g0777400                                       107   1e-24   
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          109   1e-24   Sorghum bicolor [broomcorn]
gb|AAL68842.1|AF466199_1  putative receptor protein kinase              109   1e-24   Sorghum bicolor [broomcorn]
gb|AFJ14786.1|  ERECTA-like kinase                                      109   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74102.1|  hypothetical protein OsI_09151                          109   1e-24   Oryza sativa Indica Group [Indian rice]
gb|EEE57902.1|  hypothetical protein OsJ_08587                          109   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         108   2e-24   Brassica napus [oilseed rape]
gb|KJB65471.1|  hypothetical protein B456_010G096300                    108   3e-24   Gossypium raimondii
gb|KJB65473.1|  hypothetical protein B456_010G096300                    108   3e-24   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                    107   4e-24   Gossypium raimondii
gb|KJB65469.1|  hypothetical protein B456_010G096300                    107   6e-24   Gossypium raimondii
gb|KJB65470.1|  hypothetical protein B456_010G096300                    107   7e-24   Gossypium raimondii
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...    107   8e-24   
ref|XP_002452905.1|  hypothetical protein SORBIDRAFT_04g034820          104   7e-23   
ref|NP_001132173.1|  uncharacterized protein LOC100193598               101   2e-22   
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...    102   5e-22   Zea mays [maize]
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...    102   5e-22   Zea mays [maize]
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...    101   6e-22   
gb|ACF80312.1|  unknown                                               97.4    2e-21   Zea mays [maize]
ref|NP_001281212.1|  uncharacterized protein LOC103504710             97.1    2e-21   
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...  98.6    8e-21   
gb|AFW73725.1|  putative leucine-rich repeat receptor-like protei...  97.4    1e-20   
gb|AFW73726.1|  putative leucine-rich repeat receptor-like protei...  97.4    1e-20   
dbj|BAJ87863.1|  predicted protein                                    97.1    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...  93.6    3e-19   Triticum urartu
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    5e-19   Setaria italica
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    6e-19   Setaria italica
gb|EMT04765.1|  LRR receptor-like serine/threonine-protein kinase...  91.3    3e-18   
dbj|BAK07025.1|  predicted protein                                    89.7    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96098.1|  predicted protein                                    89.7    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFC88469.1|  ERECTA                                                84.7    5e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1       84.7    5e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2       84.7    5e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase       84.3    6e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase       84.0    7e-16   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...  83.6    1e-15   Triticum urartu
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...  83.2    1e-15   
gb|EEE65024.1|  hypothetical protein OsJ_19993                        83.2    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056687.1|  Os06g0130100                                     82.8    2e-15   
dbj|BAD44800.1|  putative transmembrane protein kinase                82.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-15   Elaeis guineensis
gb|ACY07616.1|  stress-induced protein kinase                         82.4    3e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDP05285.1|  unnamed protein product                              81.6    5e-15   Coffea canephora [robusta coffee]
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    7e-15   Oryza brachyantha
emb|CDP20026.1|  unnamed protein product                              79.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...  79.7    2e-14   Vitis vinifera
emb|CAN79933.1|  hypothetical protein VITISV_008329                   76.6    4e-14   Vitis vinifera
ref|NP_001235330.1|  ERECTA-like kinase                               78.6    6e-14   Glycine max [soybeans]
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2         78.2    7e-14   Glycine max [soybeans]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1         78.2    7e-14   Glycine max [soybeans]
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    8e-14   Glycine soja [wild soybean]
ref|XP_006372044.1|  hypothetical protein POPTR_0018s08390g           76.3    9e-14   
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-13   
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    1e-13   
ref|XP_010109087.1|  LRR receptor-like serine/threonine-protein k...  76.6    1e-13   
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g           77.4    1e-13   Phaseolus vulgaris [French bean]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    2e-13   Glycine max [soybeans]
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    4e-13   Phoenix dactylifera
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    4e-13   
ref|XP_007038488.1|  ERECTA-like 1                                    76.3    4e-13   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    4e-13   
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    4e-13   
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg           75.9    4e-13   
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                 75.9    5e-13   Citrus sinensis [apfelsine]
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    5e-13   
dbj|BAJ89970.1|  predicted protein                                    75.9    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    5e-13   
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...  75.5    6e-13   Glycine soja [wild soybean]
dbj|BAJ90194.1|  predicted protein                                    75.1    7e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1         75.1    8e-13   Glycine max [soybeans]
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    8e-13   Populus euphratica
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2         75.1    9e-13   Glycine max [soybeans]
ref|NP_001237639.1|  ERECTA-like kinase                               75.1    9e-13   Glycine max [soybeans]
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...  73.6    3e-12   Populus euphratica
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...  73.6    3e-12   Malus domestica [apple tree]
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase              73.2    3e-12   Populus nigra x Populus x canadensis
gb|ABR08864.1|  erecta                                                69.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318267.2|  PTH-1 family protein                             72.8    5e-12   
ref|XP_002510897.1|  erecta, putative                                 72.8    6e-12   
gb|KEH43759.1|  LRR receptor-like kinase family protein               72.4    7e-12   Medicago truncatula
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    9e-12   Nicotiana tomentosiformis
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g           72.0    1e-11   Phaseolus vulgaris [French bean]
gb|KJB39364.1|  hypothetical protein B456_007G009000                  71.6    1e-11   Gossypium raimondii
gb|ABR08875.1|  erecta                                                67.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    1e-11   Setaria italica
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    2e-11   Fragaria vesca subsp. vesca
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...  70.9    2e-11   Gossypium arboreum [tree cotton]
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    3e-11   Cicer arietinum [garbanzo]
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522           70.5    4e-11   
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124           70.1    4e-11   
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    5e-11   Prunus mume [ume]
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg           69.3    9e-11   Capsella rubella
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    9e-11   Solanum tuberosum [potatoes]
gb|ACF87330.1|  unknown                                               66.6    9e-11   Zea mays [maize]
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    1e-10   
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    1e-10   
ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    1e-10   Nicotiana sylvestris
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    1e-10   Nicotiana sylvestris
gb|KGN49592.1|  hypothetical protein Csa_5G014290                     68.6    1e-10   Cucumis sativus [cucumbers]
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase  68.6    2e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg           68.2    2e-10   
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    3e-10   Glycine max [soybeans]
ref|XP_006394418.1|  hypothetical protein EUTSA_v100036151mg          67.8    3e-10   
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    3e-10   Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...  67.8    3e-10   Glycine soja [wild soybean]
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase  67.8    3e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg              67.8    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...  67.4    4e-10   Solanum lycopersicum
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    4e-10   Brassica rapa
emb|CDY00268.1|  BnaA06g21690D                                        67.0    4e-10   
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    4e-10   Brassica rapa
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    6e-10   Cucumis melo [Oriental melon]
emb|CDX86913.1|  BnaC03g51830D                                        66.6    6e-10   
emb|CBI24498.3|  unnamed protein product                              66.6    7e-10   Vitis vinifera
gb|ACR34621.1|  unknown                                               65.9    7e-10   Zea mays [maize]
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                  66.2    8e-10   Arabis alpina [alpine rockcress]
gb|ACN26436.1|  unknown                                               65.5    9e-10   Zea mays [maize]
dbj|BAA97187.1|  receptor-like protein kinase                         65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...  65.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...  65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAP69763.1|  ERECTA-like kinase 1                                  65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22376.1|  hypothetical protein JCGZ_26207                       65.1    2e-09   Jatropha curcas
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    2e-09   Sesamum indicum [beniseed]
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399           65.1    2e-09   
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    2e-09   Sesamum indicum [beniseed]
dbj|BAC42683.1|  unknown protein                                      63.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970        64.3    4e-09   Sorghum bicolor [broomcorn]
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    8e-09   Tarenaya hassleriana [spider flower]
gb|AGT17158.1|  ERECTA-like 2                                         62.8    1e-08   Saccharum hybrid cultivar R570
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...  62.4    2e-08   
ref|NP_001146239.1|  uncharacterized LOC100279811                     62.0    2e-08   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...  62.0    2e-08   
gb|EPS66497.1|  hypothetical protein M569_08274                       62.0    2e-08   Genlisea aurea
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500        61.2    4e-08   
ref|XP_002322426.1|  PTH-1 family protein                             58.2    4e-07   
emb|CDM84625.1|  unnamed protein product                              55.8    4e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...  56.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...  56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87274.1|  receptor-like protein kinase                         56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...  55.8    2e-06   
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...  55.8    2e-06   Triticum urartu
gb|AAO26312.1|  receptor-like protein kinase                          55.5    3e-06   Elaeis guineensis
ref|XP_010423244.1|  PREDICTED: LRR receptor-like serine/threonin...  55.5    3e-06   
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267           55.1    4e-06   
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051           54.7    5e-06   
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg           53.1    2e-05   
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...  53.1    2e-05   
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    2e-05   Brassica rapa
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...  52.8    2e-05   
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657           52.8    3e-05   Arabidopsis lyrata subsp. lyrata
emb|CDX99001.1|  BnaC09g48340D                                        52.8    3e-05   
emb|CDX70013.1|  BnaA10g23620D                                        51.2    8e-05   
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  50.8    9e-05   
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...  50.1    2e-04   
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg           49.7    2e-04   



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   166 bits (421),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG+VKKVFQ A  C++RQP ERP+MHEVARVLGSLMPSS PK +   P+   LPSA
Sbjct  888  TCNDLGEVKKVFQLALLCSRRQPSERPTMHEVARVLGSLMPSSTPKMLTTNPTANLLPSA  947

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TPQL+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  948  KVPCYMDEYANLKTPQLVNCSSMSTSDAQLFLKFGEVISQNS  989



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   164 bits (414),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DL DVKKVFQ A  C+KRQP ERP+MHEVARVL SL+P +  KQ N TPSLA LPSA
Sbjct  888  TCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVLESLIPVAETKQPNPTPSLALLPSA  947

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  948  KVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  989



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   164 bits (414),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DL DVKKVFQ A  C+KRQP ERP+MHEVARVL SL+P +  KQ N TPSLA LPSA
Sbjct  888  TCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVLESLIPVAETKQPNPTPSLALLPSA  947

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  948  KVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  989



>gb|AGS56396.1| LRR receptor-like serine/threonine-protein kinase, partial [Populus 
tremula]
Length=413

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+P  + PKQ  Q P  APLPS
Sbjct  311  TCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPLITPPKQCTQAPP-APLPS  369

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY+DEY N+++P +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  370  AKVPCYIDEYANIKSPHILNCPSMSTSDAQLFLKFGEVISQNS  412



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   158 bits (400),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLGDVKKVFQ A  CTKRQP ERP+MHEVARVL SL+P +  KQ N TP  A LPSA
Sbjct  890  TCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARVLESLVPVAETKQPNPTPP-ALLPSA  948

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  949  KVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  990



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   156 bits (394),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+P  + PKQ  Q P  APLPS
Sbjct  788  TCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPLITPPKQCTQAPP-APLPS  846

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY+DEY N+++P +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  847  AKVPCYIDEYANIKSPHILNCPSMSTSDAQLFLKFGEVISQNS  889



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVN--QTPSLAPL  213
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS + PKQ+     PS   L
Sbjct  887  TCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSPAPPKQLTPMNPPSTQLL  946

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            PSAKVPCYMDEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  947  PSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  991



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVN--QTPSLAPL  213
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS + PKQ+     PS   L
Sbjct  886  TCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSPAPPKQLTPMNPPSTQLL  945

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            PSAKVPCYMDEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  946  PSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  990



>ref|XP_006452986.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
 gb|ESR66226.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
Length=400

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  C+KRQP +RP+MHEV+RVLGSL+P+  P KQ    PS A L S
Sbjct  298  TCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVLGSLVPAPEPQKQPTSIPS-ALLSS  356

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  357  AKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  399



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 84/107 (79%), Gaps = 10/107 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPL---  213
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV+RVLGSLMPS  P +      L PL   
Sbjct  854  TCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVLGSLMPSVAPAK-----QLTPLQPA  908

Query  212  --PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  909  SHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  955



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 84/107 (79%), Gaps = 10/107 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPL---  213
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV+RVLGSLMPS  P +      L PL   
Sbjct  876  TCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVLGSLMPSVAPAK-----QLTPLQPA  930

Query  212  --PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  931  SHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  977



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 84/107 (79%), Gaps = 10/107 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPL---  213
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV+RVLGSLMPS  P +      L PL   
Sbjct  883  TCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVLGSLMPSVAPAK-----QLTPLQPA  937

Query  212  --PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  938  SHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  984



>gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa]
Length=978

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 84/107 (79%), Gaps = 10/107 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPL---  213
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV+RVLGSLMPS  P +      L PL   
Sbjct  876  TCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVLGSLMPSVAPAK-----QLTPLQPA  930

Query  212  --PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  931  SHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  977



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   153 bits (386),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG VKKVFQ A  CTK+QP +RP+MHEV RVLGSL+P++ PKQ+  T +  APLPS
Sbjct  886  TCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVLGSLVPATAPKQIALTTTPPAPLPS  945

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  84
             KVPCYMDEY NL+TP ++ C SMSTSDAQLFLKFGEVISQ
Sbjct  946  TKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLKFGEVISQ  986



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   153 bits (386),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG VKKVFQ A  CTK+QP +RP+MHEV RVLGSL+P++ PKQ+  T +  APLPS
Sbjct  878  TCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVLGSLVPATAPKQIALTTTPPAPLPS  937

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  84
             KVPCYMDEY NL+TP ++ C SMSTSDAQLFLKFGEVISQ
Sbjct  938  TKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLKFGEVISQ  978



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+P  + PKQ  Q P  APLPS
Sbjct  878  TCTDLGAVKKVFQLALLCTKRQPADRPTMHEVTRVLGSLVPPITPPKQCTQAPP-APLPS  936

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AK PCY+DEY N+++P +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  937  AKAPCYIDEYANIKSPHILNCPSMSTSDAQLFLKFGEVISQNS  979



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG VKKVFQ A  CTK+QP +RP+MHEV RVLGSL+P++ PKQ+  T +  APLPS
Sbjct  648  TCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVLGSLVPATAPKQIALTTTPPAPLPS  707

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  84
             KVPCYMDEY NL+TP ++ C SMSTSDAQLFLKFGEVISQ
Sbjct  708  TKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLKFGEVISQ  748



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTPSLAPLPS  207
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS + PKQ    P    L S
Sbjct  880  TCMDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSPTQPKQATLNPLSITLSS  939

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             K PCYMDEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  940  VKAPCYMDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  982



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   151 bits (381),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSS-HPKQVNQTPSLAPLPS  207
            TC+DLG VKKV+Q A  CTKRQP +RP+MHEV RVLGSL+PSS  PKQ+   P  A  PS
Sbjct  878  TCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVLGSLVPSSIPPKQLADLPP-ASNPS  936

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  937  AKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  979



>gb|KDO73637.1| hypothetical protein CISIN_1g0023491mg, partial [Citrus sinensis]
Length=764

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  C+KRQP +RP+MHEV+RVLGSL+P+  P KQ    PS A L S
Sbjct  662  TCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVLGSLVPAPEPQKQPTSIPS-ALLSS  720

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  721  AKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  763



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score =   150 bits (379),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKV+Q A  CTKRQP +RP+MHEV RVLGSL+PS+ P +       A  PSA
Sbjct  856  TCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVLGSLVPSNTPPKQPAALPPASNPSA  915

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  916  KVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  957



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   150 bits (379),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  C+KRQP +RP+MHEV+RVLGSL+P+  P KQ    PS A L S
Sbjct  879  TCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVLGSLVPAPEPQKQPTSIPS-ALLSS  937

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  938  AKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  980



>ref|NP_001235257.1| ERECTA [Glycine max]
 gb|ACM89555.1| ERECTA [Glycine max]
Length=467

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TC+DLG VKKV+Q A  CTKRQP +RP+MHEV RVLGSL+ S+ P KQ+   P  A  PS
Sbjct  365  TCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVLGSLVLSNTPPKQLAALPP-ASNPS  423

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  424  AKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  466



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 84/107 (79%), Gaps = 7/107 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTP----SLA  219
            TC DL  VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS + PKQ   TP    S  
Sbjct  878  TCMDLAAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSPALPKQ--STPLNPASTQ  935

Query  218  PLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             LPSAKVPCYMDEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  936  LLPSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  982



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  C+KRQP +RP+MHEV+RVLGSL+P+  P KQ    PS A L S
Sbjct  831  TCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVLGSLVPAPEPQKQPTSIPS-ALLSS  889

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  890  AKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  932



>gb|KHG04653.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Gossypium 
arboreum]
Length=253

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKR P +RP+MHEV RVLGSLMP   P +   T   APL S 
Sbjct  151  TCKDLGAVKKVFQLALLCTKRHPSDRPTMHEVTRVLGSLMPLEPPAKQPTTIPPAPLSST  210

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KV  YMDEY NL+TP L+ CPSMSTSDAQLF+ FGEVIS+NS
Sbjct  211  KVTSYMDEYANLKTPHLVNCPSMSTSDAQLFINFGEVISRNS  252



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   147 bits (372),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 74/105 (70%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP---L  213
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVL SLMPS  P +   TP+  P   L
Sbjct  888  TCTDLGQVKKVFQLALLCTKRQPTDRPTMHEVTRVLASLMPSPAPPK-QPTPANPPSSQL  946

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            P  KVPCY+DEY N++TP LL CPSMSTSDAQLFLKFGEVISQNS
Sbjct  947  PITKVPCYVDEYANVKTPHLLNCPSMSTSDAQLFLKFGEVISQNS  991



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   147 bits (370),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS   KQ        PLPSA
Sbjct  878  TCKDLGAVKKVFQLALLCTKRQPADRPTMHEVTRVLGSLLPSVPIKQCTTPAPPPPLPSA  937

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KV CYMD+Y NL+TP ++ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  938  KVSCYMDDYANLKTPHMVNCPSMSTSDAQLFLKFGEVISQNS  979



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQ-VNQTPSLAPLP  210
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS + PKQ  +  P     P
Sbjct  887  TCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSPAPPKQPASANPPSTQHP  946

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            SAK PCY+DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  947  SAKAPCYVDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  990



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   146 bits (368),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLGDVKKVFQ A  CTKRQP ERP+MHEVARVL SL+P +  KQ N TP      SA
Sbjct  889  TCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARVLESLVPVAETKQPNPTPPTLLP-SA  947

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  948  KVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  989



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   146 bits (368),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC+DLG +KKV+Q A  CTKRQP +RP+MHEVARVL SL+P ++ PKQ+  TP L P  S
Sbjct  884  TCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLASLVPLTTPPKQL--TPPL-PAIS  940

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  941  AKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  983



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   146 bits (368),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/102 (68%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKK FQ A  CTKR P +RP+MHEV RVLGSLMP   P +   +   +PLPS 
Sbjct  881  TCKDLGAVKKAFQLALLCTKRHPSDRPTMHEVTRVLGSLMPLDTPPKQPSSMQPSPLPST  940

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KV CY DEY NL+TP L+ CPSMSTSDAQLFLKFGEVIS+NS
Sbjct  941  KVTCYKDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISRNS  982



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   146 bits (368),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC+DLG +KKV+Q A  CTKRQP +RP+MHEVARVL SL+P ++ PKQ+  TP L P  S
Sbjct  880  TCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLASLVPLTTPPKQL--TPPL-PAIS  936

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  937  AKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  979



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score =   145 bits (367),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAPLPS  207
            TC+DLG +KKV+Q A  CTKRQP +RP+MHEVARVL SL+P ++ PKQ+  TP L P  S
Sbjct  859  TCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLASLVPLTTPPKQL--TPPL-PAIS  915

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  916  AKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  958



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   145 bits (367),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSL-MPSSHPKQVNQTPSLAPLPS  207
            TC+DLG VKKV+Q A  CTKRQP +RP+MHEV RVLGSL + ++ PKQ+   P  A  PS
Sbjct  878  TCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVLGSLVLSNTPPKQLAALPP-ASNPS  936

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            AKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  937  AKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  979



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH-PKQVNQTPSLAPLPS  207
            TC+DLG VKKVFQ A  CTKRQP ERP+MHEVARVLGSL+PS+  PKQ++   S APLP 
Sbjct  879  TCKDLGAVKKVFQLALLCTKRQPSERPTMHEVARVLGSLLPSTTPPKQLSALGS-APLPG  937

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             K+  Y DEY NL+TP L+ C +MSTSDAQLF KFGEVISQNS
Sbjct  938  TKIASYKDEYANLKTPHLVNCSAMSTSDAQLFRKFGEVISQNS  980



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQ-VNQTPSLAPLP  210
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+ S + PKQ  +  P     P
Sbjct  888  TCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVLSPAPPKQPASANPPSTQHP  947

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            SAKVPCY+DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  948  SAKVPCYVDEYANLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  991



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score =   145 bits (365),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 72/105 (69%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTPSLAP--L  213
            TC+D+G VKKVFQ A  CTK+QP +RP+MHEV RVLGSL+PS + PKQ + T  L P   
Sbjct  879  TCRDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVLGSLVPSITLPKQTDSTQVLLPDSQ  938

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             SAK+ CY DEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  939  SSAKMQCYKDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNS  983



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   144 bits (363),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG+VKKVFQ A  CTK+QP +RP+MHEV RVLG+L P   P+     P L APLPS
Sbjct  890  TCKDLGEVKKVFQLALLCTKKQPLDRPTMHEVVRVLGTLKPP--PESKTLAPILPAPLPS  947

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +K+ CY+DEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  948  SKIQCYVDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  990



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   143 bits (361),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+PS+ P +       AP+PSA
Sbjct  878  TCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGSLVPSTTPPKQCMPAPPAPIPSA  937

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KV CYMDEY NL+TP ++ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  938  KVSCYMDEYANLKTPHMVNCPSMSTSDAQLFLKFGEVISQNS  979



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   142 bits (359),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 69/102 (68%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKR P +RP+MHEV RVLGSL P   P +   T   APLPS 
Sbjct  881  TCKDLGAVKKVFQLALLCTKRHPLDRPTMHEVTRVLGSLRPLEPPAKQPTTIPPAPLPST  940

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            KV  YMDEY NL+TP L+ CPSMSTSDAQLF+ FGEVIS+NS
Sbjct  941  KVTSYMDEYANLKTPHLVNCPSMSTSDAQLFINFGEVISRNS  982



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   142 bits (358),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVLG+L+P   P+    TP++ A L S
Sbjct  872  TCKDLGEVKKVFQLALLCTKRQPLDRPTMHEVVRVLGTLVPP--PEAKLSTPTISAQLQS  929

Query  206  AKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            A+  CYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  930  ARAQCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  972



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   142 bits (358),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 5/104 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH-PKQVNQTPSLAPLP-  210
            TC+DLG VKK FQ A  CTKRQP +RP+MHEV RV+GSL+PS+  PKQ   TP++  +P 
Sbjct  890  TCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVIGSLLPSAATPKQ---TPTITTIPP  946

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            SAK  CY DEY NL+TP +L CP+MSTSDAQLF+KFGEVISQNS
Sbjct  947  SAKSSCYKDEYANLKTPHVLNCPTMSTSDAQLFVKFGEVISQNS  990



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQ-VNQTPSLAPLP  210
            TC DLG VKKVFQ A  CTKRQP +RP+MHEV RVL SLMP  + PKQ     P  + LP
Sbjct  888  TCTDLGPVKKVFQLALLCTKRQPTDRPTMHEVTRVLASLMPXPAPPKQPTXANPPSSQLP  947

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              K PCY+DEY NL+TP +L CPSMSTSDAQLFLKFGEVISQNS
Sbjct  948  ITKXPCYVDEYVNLKTPHMLNCPSMSTSDAQLFLKFGEVISQNS  991



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score =   141 bits (356),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTPSLAP--L  213
            TC+D+G VKKVFQ A  CTK+QP +RP+MHEV RVL SL+PS + PKQ +QT  +     
Sbjct  880  TCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVLASLVPSITPPKQTDQTQVVLSDSQ  939

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            PSAK+ CY DEY NL TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  940  PSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFLKFGEVISQNS  984



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score =   141 bits (356),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTPSLAP--L  213
            TC+D+G VKKVFQ A  CTK+QP +RP+MHEV RVL SL+PS + PKQ +QT  +     
Sbjct  887  TCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVLASLVPSITPPKQTDQTQVVLSDSQ  946

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            PSAK+ CY DEY NL TP L+ CPSMSTSDAQLFLKFGEVISQNS
Sbjct  947  PSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFLKFGEVISQNS  991



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 7/108 (6%)
 Frame = -2

Query  383   TC-QDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-SSHPKQVNQTPSLAP--  216
             TC +DLG V+KVFQ A  C KRQP +RP+MHEV RVL SL P ++ PKQ   TP+L P  
Sbjct  906   TCKEDLGAVRKVFQLALLCAKRQPTDRPTMHEVTRVLSSLTPPAAPPKQA--TPALPPPS  963

Query  215   -LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNST  75
              LPSAKVP Y+DEY NL+TP L+ CPSMSTSDAQLFLKFGEVISQNST
Sbjct  964   TLPSAKVPGYIDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNST  1011



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   140 bits (353),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 5/104 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH-PKQVNQTPSLAPLP-  210
            TC+DLG VKK FQ A  CTKRQP +RP+MHEV RV+GSL+PS+  PKQ+   P++  +P 
Sbjct  890  TCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVIGSLLPSAATPKQI---PTITTIPP  946

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            SAK  CY DEY NL+TP +L CP+MSTSDAQLF KFGEVISQNS
Sbjct  947  SAKSSCYKDEYANLKTPHVLNCPTMSTSDAQLFAKFGEVISQNS  990



>ref|XP_010060188.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
Length=138

 Score =   128 bits (322),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = -2

Query  380  CQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPSA  204
            C+DL  +KKVFQ A  CTKRQP ERP+MHEVARVLGSL+ S+ P KQ++   S A LPS 
Sbjct  30   CKDLRALKKVFQLALLCTKRQPSERPTMHEVARVLGSLLLSTIPLKQLSAVGS-ALLPST  88

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+  YMD+Y NL+T  L+ C +MSTSDAQLF +FGEVIS NS
Sbjct  89   KIASYMDKYANLKTLHLVNCSAMSTSDAQLFREFGEVISHNS  130



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS-SHPKQVNQTPSLAPL-P  210
            TC+DLG+VKKVFQ A  CTKR P +RPSMHEV RVL +++ +    K   Q     PL P
Sbjct  881  TCKDLGEVKKVFQLALLCTKRLPLDRPSMHEVVRVLNTMVVNLPEGKSFGQNIQSGPLLP  940

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            S K+ CYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVISQNS
Sbjct  941  STKIQCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS  984



>ref|XP_010431630.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=245

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  148  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMMSEQPPAVTDTS--AALAGS  205

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  206  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  244



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   131 bits (330),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTK+QP +RP+MHEV RVL SL+P +  KQV  TP     PS 
Sbjct  891  TCKDLGNVKKVFQLALLCTKKQPGDRPTMHEVTRVLTSLIPETPVKQVALTPLPPLPPS-  949

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +P YM+EY NL++P ++ CP+MSTSDAQLFLKFGEVISQNS
Sbjct  950  HMPSYMNEYANLKSPHMVNCPTMSTSDAQLFLKFGEVISQNS  991



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   130 bits (328),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP ERP+MH+V RVLGSL P+S P  V  T      P +
Sbjct  887  TCKDLGEVKKVFQLALLCTKRQPGERPTMHQVTRVLGSLAPTSVPVAVASTTQ----PGS  942

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+ P  L CPSMS SDAQLFL+FGEVISQNS
Sbjct  943  ---CYVDEYANLKAPHSLNCPSMSASDAQLFLRFGEVISQNS  981



>ref|XP_010429656.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=381

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  284  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMMSEQPPAVTDTS--AALAGS  341

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  342  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  380



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG+VKKVFQ A  CTKRQ  ERP+MHEV RVL +L+P    K     PS   + S 
Sbjct  853  TCNDLGEVKKVFQLALLCTKRQLMERPTMHEVVRVLRTLVPRED-KSSTVLPS-DQITST  910

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K  CYMDEY NL+TP L+ C SMSTSDA+LFLKFGEVIS+NS
Sbjct  911  KAQCYMDEYANLKTPHLVNCSSMSTSDAELFLKFGEVISKNS  952



>dbj|BAD94220.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=441

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T   A L  +
Sbjct  344  TCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTS--ATLAGS  401

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  402  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  440



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 5/104 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQVNQTPSLAPLPS  207
            TC+DLGDVKKVFQ A  CTKRQP +RP+MHEV+RVLG L+ PS  PKQ  Q   L   PS
Sbjct  879  TCKDLGDVKKVFQLALLCTKRQPSDRPTMHEVSRVLGCLVQPSPTPKQ-PQPHGLTQPPS  937

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
              VP Y+DEY NL+ P +L C  S+STSD QLFLKFGEVISQNS
Sbjct  938  --VPSYIDEYANLKNPNMLDCATSLSTSDGQLFLKFGEVISQNS  979



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+++  VKKVFQ A  CTK+QP +RP+MHEV RVLGSL+P        Q       PSA
Sbjct  856  TCKEMIAVKKVFQLALLCTKKQPVDRPTMHEVTRVLGSLVPPKESVPTMQVLIPPSRPSA  915

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y DEY NL+ P L+ CPS+STSDAQLFLKFGEVISQNS
Sbjct  916  KTQSYKDEYANLKAPHLVNCPSISTSDAQLFLKFGEVISQNS  957



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   125 bits (313),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  885  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMMSEQPPAVTDTS--AALAGS  942

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  943  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  981



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   124 bits (311),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  699  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLSEQPPAVTDTS--AALAGS  756

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  757  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  795



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  878  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLSEQPPAVTDTS--AALAGS  935

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  936  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  974



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG VKKVFQ A  CTK+Q  +RP+MHEV R+LGSL+PS   K ++Q  +L AP+  
Sbjct  878  TCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRILGSLVPSEETKCLHQQFALQAPVSP  937

Query  206  AK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             K  V  YMDEY  L+ P ++ C S+STSDAQLFLKFGEVISQ +
Sbjct  938  TKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFLKFGEVISQTT  982



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSL-APLPS  207
            TC+DLG VKKVFQ A  CTK+Q  +RP+MHEV R+LGSL+PS   K ++Q  +L AP+  
Sbjct  855  TCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRILGSLVPSEETKCLHQQFALQAPVSP  914

Query  206  AK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             K  V  YMDEY  L+ P ++ C S+STSDAQLFLKFGEVISQ +
Sbjct  915  TKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFLKFGEVISQTT  959



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T +     + 
Sbjct  879  TCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSA-----TL  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  934  AGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  975



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T +     + 
Sbjct  879  TCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSA-----TL  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  934  AGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  975



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 72/102 (71%), Gaps = 5/102 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T   A L  +
Sbjct  879  TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLSEQPPAATDTS--AALAGS  936

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQNS
Sbjct  937  ---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  975



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG VKKVFQ A  CTK+QP +RP+MHEV RVLG LMPSS  KQ+ Q PS  P  + 
Sbjct  878  TCTDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVLGCLMPSSETKQLAQPPSAPPPAAK  937

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                YMDEY NL+ P ++ C S+ TSDAQLFLKFGEVISQ +
Sbjct  938  VPS-YMDEYANLKNPHMINCASLGTSDAQLFLKFGEVISQTT  978



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M    P       S     S 
Sbjct  883  TCKDLGMVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLPEQPTAAAAAASTTLAGS-  941

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+TP  + C SMS SDA+LFL+FG+VISQNS
Sbjct  942  ---CYVDEYANLKTPHSVNCSSMSASDAELFLRFGQVISQNS  980



>gb|KHG05309.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Gossypium 
arboreum]
Length=183

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RV+GSLMP   P     T  LA +  +
Sbjct  93   TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVVGSLMPLDTPP----TKQLASIQLS  148

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDA  120
            KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  149  KVTCYKDEYVNLKTPHLVNCPSMSTSQG  176



>gb|EPS58979.1| hypothetical protein M569_15834, partial [Genlisea aurea]
Length=249

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 72/106 (68%), Gaps = 4/106 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP---SSHPKQVNQTPSLAPL  213
            TC DLG+VKKVFQ A  CTKRQP +RP+M EV RVLG+L+P   ++     ++    +P 
Sbjct  144  TCGDLGEVKKVFQLALLCTKRQPSDRPNMAEVVRVLGTLLPQPITASCDGKSRPAEASPP  203

Query  212  PSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFGEVISQNS  78
                   Y++EY  LRTP L+ C  S STSDAQLFLKFGEVISQN+
Sbjct  204  RGGGGGGYVNEYAKLRTPHLVNCSSSRSTSDAQLFLKFGEVISQNT  249



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DL  VKKVFQ A  CTK+QP +RP+MH+V RVLGS M S  P       S     + 
Sbjct  879  TCKDLAVVKKVFQLALLCTKKQPSDRPTMHQVTRVLGSFMLSEQPPAAAAATST----TL  934

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               CY+DEY NL+ P  + C SMS SDA+LFL+FG+VISQNS
Sbjct  935  TASCYIDEYANLKNPHNVNCSSMSASDAELFLRFGQVISQNS  976



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLP--  210
            TC+DL  VKKVFQ A  CTKRQP +RP+MHEV RVLGSL+P S      Q P   P    
Sbjct  888  TCKDLNAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLVPQSITDPKPQAPQPPPCVPL  947

Query  209  ---SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
               S+    YMDEY NL+ P L+ C S++T+D  LF+KFGEVISQN+
Sbjct  948  IGISSTCRTYMDEYANLKNPNLIACTSLTTTDGHLFVKFGEVISQNT  994



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP--KQVNQTPSLAPLP  210
            TC+DL  VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P         + A   
Sbjct  883  TCKDLAVVKKVFQLALLCTKRQPNDRPTMHQVVRVLGSFMFSEQPPAANAVAAAAAATSA  942

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +    CY+DEY NL+ P  + C SMS SDA+LFL+FG+VISQNS
Sbjct  943  TLASSCYVDEYANLKAPHNVNCSSMSASDAELFLRFGQVISQNS  986



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TCQDLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P K V  + SL P+PS
Sbjct  878  TCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPLKPVQTSSSLQPVPS  937

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
                 Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN+
Sbjct  938  -----YVNEYVSLRGAGALSCATSSSTSDAELFLKFGEAISQNT  976



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP-KQVNQTPSLAPLPS  207
            TCQDLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P K V  + SL P+PS
Sbjct  879  TCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPLKPVQTSSSLQPVPS  938

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
                 Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN+
Sbjct  939  -----YVNEYVSLRGAGALSCATSSSTSDAELFLKFGEAISQNT  977



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +  Q P+L    S+
Sbjct  897  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSKPAQPPALP--QSS  954

Query  203  KVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
             VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN
Sbjct  955  TVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQN  996



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score =   110 bits (276),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +  Q  ++   P+ 
Sbjct  829  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPPKSAQQLAMPQRPA-  887

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFGEVISQNS  78
             VP Y++EY +LR   +L+C + S TSDA+LFLKFGEVISQN+
Sbjct  888  -VPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEVISQNT  929



>gb|AAL50210.1| ER1-like receptor kinase, partial [Camelina sativa]
Length=144

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P  V  T   A L  +
Sbjct  60   TCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLSEQPPAVTDTS--AALAGS  117

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQL  114
               CY+DEY NL+TP  + C SMS SDAQL
Sbjct  118  ---CYVDEYANLKTPHSVNCSSMSASDAQL  144



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score =   110 bits (276),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +  Q  ++   P+ 
Sbjct  878  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVHPDPPLKSAQQLAMPQAPT-  936

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFGEVISQNS  78
             VP Y++EY +LR   +L+C + S TSDA+LFLKFGEVISQN+
Sbjct  937  -VPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEVISQNT  978



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score =   110 bits (274),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +  Q  ++   P+ 
Sbjct  781  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPPKSAQQLAMPQRPA-  839

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFGEVISQNS  78
             VP Y++EY +LR   +L+C + S TSDA+LFLKFGEVISQN+
Sbjct  840  -VPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEVISQNT  881



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score =   110 bits (274),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +  Q  ++   P+ 
Sbjct  877  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPPKSAQQLAMPQRPA-  935

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFGEVISQNS  78
             VP Y++EY +LR   +L+C + S TSDA+LFLKFGEVISQN+
Sbjct  936  -VPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEVISQNT  977



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score =   110 bits (274),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVLG L+    P + +  P   P P +
Sbjct  858  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVLGCLVQPGPPPKQSPPPLPLPPPPS  917

Query  203  KVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFGEVISQNS  78
                Y+DEY NL++P  LTC  S+STSDAQLFLKFGEVISQN+
Sbjct  918  VPS-YIDEYANLKSPNTLTCTASLSTSDAQLFLKFGEVISQNT  959



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   110 bits (274),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVLG L+    P + +  P   P P +
Sbjct  883  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVLGCLVQPGPPPKQSPPPLPLPPPPS  942

Query  203  KVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFGEVISQNS  78
                Y+DEY NL++P  LTC  S+STSDAQLFLKFGEVISQN+
Sbjct  943  VPS-YIDEYANLKSPNTLTCTASLSTSDAQLFLKFGEVISQNT  984



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score =   109 bits (273),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -2

Query  383   TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
             TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVLG L+    P + +  P   P P +
Sbjct  905   TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVLGCLVQPGPPPKQSPPPLPLPPPPS  964

Query  203   KVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFGEVISQNS  78
                 Y+DEY NL++P  LTC  S+STSDAQLFLKFGEVISQN+
Sbjct  965   VPS-YIDEYANLKSPNTLTCTASLSTSDAQLFLKFGEVISQNT  1006



>dbj|BAD16970.1| receptor protein kinase PERK1-like [Oryza sativa Japonica Group]
 dbj|BAG87384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP-LP-  210
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +    P+L P LP 
Sbjct  291  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSK----PALPPALPQ  346

Query  209  SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            S+ VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN+
Sbjct  347  SSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNT  391



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   109 bits (273),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVLG L+  + P + +    L   PS 
Sbjct  885  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVLGCLVQPTPPPKHSPPLPLPAPPSV  944

Query  203  KVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFGEVISQNS  78
                Y+DEY NL+ P  LTC  S+STSDAQLFLKFGEVISQN+
Sbjct  945  PS--YIDEYANLKNPTTLTCTASLSTSDAQLFLKFGEVISQNT  985



>ref|NP_001048290.1| Os02g0777400 [Oryza sativa Japonica Group]
 dbj|BAF10204.1| Os02g0777400, partial [Oryza sativa Japonica Group]
Length=447

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP-LP-  210
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +    P+L P LP 
Sbjct  346  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSK----PALPPALPQ  401

Query  209  SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            S+ VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN+
Sbjct  402  SSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNT  446



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQVNQTPSLAPLPS  207
            TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+ P   PK    +    P PS
Sbjct  881  TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPDPPPK---PSAHQLPQPS  937

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
              VP Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  938  PAVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEAISQN  980



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQVNQTPSLAPLPS  207
            TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+ P   PK    +    P PS
Sbjct  820  TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPDPPPK---PSAHQLPQPS  876

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
              VP Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  877  PAVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEAISQN  919



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP-LP-  210
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +    P+L P LP 
Sbjct  885  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSK----PALPPALPQ  940

Query  209  SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            S+ VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN+
Sbjct  941  SSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNT  985



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP-LP-  210
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +    P+L P LP 
Sbjct  812  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSK----PALPPALPQ  867

Query  209  SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            S+ VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN+
Sbjct  868  SSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNT  912



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAP-LP-  210
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL  L+    P +    P+L P LP 
Sbjct  812  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDCLVYPDPPSK----PALPPALPQ  867

Query  209  SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            S+ VP Y++EY +LR    L+C  S S SDA+LFLKFGEVISQN+
Sbjct  868  SSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEVISQNT  912



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH--PKQVNQTPSLAPLP  210
            TC+DL  VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S            + A   
Sbjct  883  TCKDLAVVKKVFQLALLCTKRQPNDRPTMHQVVRVLGSFMFSEQPPAANAVPAAAAATSA  942

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +    CY+DEY NL+ P  + C SMS SDA+LFL+FG+VISQNS
Sbjct  943  TLASSCYVDEYANLKAPHNVNCSSMSASDAELFLRFGQVISQNS  986



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score =   108 bits (269),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSLM    P     T  LA +  +
Sbjct  881  TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLMLLDTPP----TKQLASIQLS  936

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTS  126
            KV CY DEY NL+TP L+ CPSMSTS
Sbjct  937  KVTCYKDEYVNLKTPHLVNCPSMSTS  962



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score =   108 bits (269),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSLM    P     T  LA +  +
Sbjct  888  TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLMLLDTPP----TKQLASIQLS  943

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTS  126
            KV CY DEY NL+TP L+ CPSMSTS
Sbjct  944  KVTCYKDEYVNLKTPHLVNCPSMSTS  969



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score =   107 bits (268),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSLM    P     T  LA +  +
Sbjct  882  TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLMLLDTPP----TKQLASIQLS  937

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTS  126
            KV CY DEY NL+TP L+ CPSMSTS
Sbjct  938  KVTCYKDEYVNLKTPHLVNCPSMSTS  963



>gb|KJB65469.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=927

 Score =   107 bits (267),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSLM    P     T  LA +  +
Sbjct  837  TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLMLLDTPP----TKQLASIQLS  892

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTS  126
            KV CY DEY NL+TP L+ CPSMSTS
Sbjct  893  KVTCYKDEYVNLKTPHLVNCPSMSTS  918



>gb|KJB65470.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=928

 Score =   107 bits (267),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG VKKVFQ A  CTKRQP +RP+MHEV RVLGSLM    P     T  LA +  +
Sbjct  838  TCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLGSLMLLDTPP----TKQLASIQLS  893

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTS  126
            KV CY DEY NL+TP L+ CPSMSTS
Sbjct  894  KVTCYKDEYVNLKTPHLVNCPSMSTS  919



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score =   107 bits (266),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQVNQTPSLAPLPS  207
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEV RVL SL+ P   PKQ     S     S
Sbjct  874  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLDSLVCPDPPPKQAQPQGSEQ---S  930

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            A  P Y+ EY +LR    L+C  S S SDA+LF+KFGEVIS+N+
Sbjct  931  ATAPSYVSEYVSLRGGTALSCANSSSASDAELFMKFGEVISRNT  974



>ref|XP_002452905.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
 gb|EES05881.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
Length=893

 Score =   104 bits (259),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 5/104 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQVNQTPSLAPLPS  207
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+ P   PKQ  Q  +L    S
Sbjct  792  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPGPLPKQA-QPQALE--KS  848

Query  206  AKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            +  P Y+ EY  LR    L+C  S S SDA+LF+KFGEVIS+++
Sbjct  849  STAPSYVSEYVGLRGGSALSCANSSSASDAELFMKFGEVISRST  892



>ref|NP_001132173.1| uncharacterized protein LOC100193598 [Zea mays]
 gb|ACF80913.1| unknown [Zea mays]
Length=492

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 10/109 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-------PSSHPKQVNQTPS  225
            TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+       P    ++ +    
Sbjct  384  TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPEPPPQPQQQQQKAHAHHQ  443

Query  224  LAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
            L P PS   P Y+DEY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  444  LPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDAELFLKFGEAISQN  490



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 10/109 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-------PSSHPKQVNQTPS  225
            TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+       P    ++ +    
Sbjct  886  TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPEPPPQPQQQQQKAHAHHQ  945

Query  224  LAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
            L P PS   P Y+DEY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  946  LPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDAELFLKFGEAISQN  992



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 10/109 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-------PSSHPKQVNQTPS  225
            TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+       P    ++ +    
Sbjct  885  TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPEPPPQPQQQQQKAHAHHQ  944

Query  224  LAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
            L P PS   P Y+DEY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  945  LPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDAELFLKFGEAISQN  991



>gb|AFW76643.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1034

 Score =   101 bits (252),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 10/109 (9%)
 Frame = -2

Query  383   TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-------PSSHPKQVNQTPS  225
             TC+DLG+VKK+FQ A  CTKRQP +RP+MHEV RVL  L+       P    ++ +    
Sbjct  926   TCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPEPPPQPQQQQQKAHAHHQ  985

Query  224   LAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQN  81
             L P PS   P Y+DEY +LR    L+C  S STSDA+LFLKFGE ISQN
Sbjct  986   LPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDAELFLKFGEAISQN  1032



>gb|ACF80312.1| unknown [Zea mays]
Length=310

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP----KQVNQTPSLAP  216
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+  + P     Q       + 
Sbjct  200  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASE  259

Query  215  LPSAKVPCYMDEYTNLR---TPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
             PS   P Y+ EY  LR       L+C  S S SDA+LF+KFGEVIS+++
Sbjct  260  KPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAELFMKFGEVISRST  309



>ref|NP_001281212.1| uncharacterized protein LOC103504710 [Zea mays]
 gb|ACN34449.1| unknown [Zea mays]
Length=360

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP----KQVNQTPSLAP  216
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+  + P     Q       + 
Sbjct  250  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASE  309

Query  215  LPSAKVPCYMDEYTNLRTPQL---LTCP-SMSTSDAQLFLKFGEVISQNS  78
             PS   P Y+ EY  LR       L+C  S S SDA+LF+KFGEVIS+++
Sbjct  310  KPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAELFMKFGEVISRST  359



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQ---VNQTPSLAP  216
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+ P+  P +          + 
Sbjct  889  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASE  948

Query  215  LPSAKVPCYMDEYTNLR---TPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
             PS   P Y+ EY  LR       L+C  S S SDA+LF+KFGEVIS+++
Sbjct  949  KPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAELFMKFGEVISRST  998



>gb|AFW73725.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=722

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQ---VNQTPSLAP  216
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+ P+  P +          + 
Sbjct  612  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASE  671

Query  215  LPSAKVPCYMDEYTNLR---TPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
             PS   P Y+ EY  LR       L+C  S S SDA+LF+KFGEVIS+++
Sbjct  672  KPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAELFMKFGEVISRST  721



>gb|AFW73726.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=721

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM-PSSHPKQ---VNQTPSLAP  216
            TC+DLG+VKKVFQ A  C+KRQP +RP+MHEVARVL SL+ P+  P +          + 
Sbjct  611  TCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASE  670

Query  215  LPSAKVPCYMDEYTNLR---TPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
             PS   P Y+ EY  LR       L+C  S S SDA+LF+KFGEVIS+++
Sbjct  671  KPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAELFMKFGEVISRST  720



>dbj|BAJ87863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=863

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VK++FQ A  C+KRQP +RP+MH+V  VL  L+    P      P  A   S+
Sbjct  766  TCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVLSCLVCPEAP------PKTASPQSS  819

Query  203  KVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
              P Y++EY +LR    L+C  S S SDA+LFLKFGE ISQN+
Sbjct  820  TAPSYVNEYVSLRGASALSCANSSSASDAELFLKFGEAISQNT  862



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VK++FQ A  C+KRQP +RP+MH+V  VL  L+    P +  Q P+     S+
Sbjct  746  TCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVLSCLVCPEAPPKPAQPPASP--QSS  803

Query  203  KVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
              P Y++EY +LR+   L+C  S S SDA+LFLKFGE ISQN+
Sbjct  804  TAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGEAISQNT  846



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV---NQTPSLAPL  213
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +      +      
Sbjct  890  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPDPPPKPPAHQPSGQSPLP  949

Query  212  PSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            P + VP Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN+
Sbjct  950  PPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEAISQNT  995



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV---NQTPSLAPL  213
            TC+DLG+VKKVFQ A  CTKRQP +RP+MHEV RVL  L+    P +      +      
Sbjct  884  TCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVNPDPPPKPPAHQPSGQSPLP  943

Query  212  PSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
            P + VP Y++EY +LR    L+C  S STSDA+LFLKFGE ISQN+
Sbjct  944  PPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEAISQNT  989



>gb|EMT04765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=939

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC+DLG+VK++FQ A  C+KRQP +RP+MH+V  VL  L+              A   S+
Sbjct  838  TCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVLSCLVCPE--APPKPAQPPASPQSS  895

Query  203  KVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGEVISQNS  78
              P Y++EY +LR+   L+C  S S SDA+LFLKFG+ ISQN+
Sbjct  896  TAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGKAISQNT  938



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+    P +V Q P   P P+ 
Sbjct  877  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLVHPDPPPKVAQ-PHPQP-PNG  934

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR    L     S STSDA+LFLKFG+ IS N+
Sbjct  935  --PSYANEYVSLRGAGALSSCANSSSTSDAELFLKFGQAISHNT  976



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+    P +V Q P   P P+ 
Sbjct  877  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLVHPDPPPKVAQ-PHPQP-PNG  934

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR    L     S STSDA+LFLKFG+ IS N+
Sbjct  935  --PSYANEYVSLRGAGALSSCANSSSTSDAELFLKFGQAISHNT  976



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  878  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  933

Query  203  KVPCYMDEYTNLR---TPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR   T       S STSDA+LFLKFG+ IS N+
Sbjct  934  --PSYANEYVSLRGAGTLSSSCANSSSTSDAELFLKFGQAISHNT  976



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 8/104 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  877  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  932

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR    L     S STSDA+LFLKFG+ IS N+
Sbjct  933  --PSYANEYVSLRGAGTLSSCANSSSTSDAELFLKFGQAISHNT  974



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 8/104 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  878  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  933

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR    L     S STSDA+LFLKFG+ IS N+
Sbjct  934  --PSYANEYVSLRGAGTLSSCANSSSTSDAELFLKFGQAISHNT  975



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 64/104 (62%), Gaps = 8/104 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  878  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  933

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR    L     S STSDA+LFLKFG+ IS N+
Sbjct  934  --PSYANEYVSLRGAGTLSSCANSSSTSDAELFLKFGQAISHNT  975



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  840  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  895

Query  203  KVPCYMDEYTNLR---TPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR   T       S STSDA+LFLKFG+ IS N+
Sbjct  896  --PSYANEYVSLRGAGTLSSSCANSSSTSDAELFLKFGQAISHNT  938



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  823  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  878

Query  203  KVPCYMDEYTNLR---TPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              P Y +EY +LR   T       S STSDA+LFLKFG+ IS N+
Sbjct  879  --PSYANEYVSLRGAGTLSSSCANSSSTSDAELFLKFGQAISHNT  921



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDLG+VKKVFQ A  CTK+QP +RP+MHEV RVL  L+   HP    +     P    
Sbjct  829  TCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVLDCLV---HPDPPPKAAQPQPPTG-  884

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNST*R  69
              P Y  +Y +LR    L     S STSDA+LFLKFG+ IS N+  R
Sbjct  885  --PSYAHQYASLRGAGTLSSCANSSSTSDAELFLKFGQAISHNTECR  929



>gb|EEE65024.1| hypothetical protein OsJ_19993 [Oryza sativa Japonica Group]
Length=908

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH---PKQVNQTPSLAPL  213
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SL+P+S    PK V+ +  LA  
Sbjct  812  TCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSRLLAST  871

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +A          ++R   +      S+SD Q F++FGEVIS+++
Sbjct  872  TTA---------ADMRGHDVTDIGDNSSSDEQWFVRFGEVISKHT  907



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH---PKQVNQTPSLAPL  213
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SL+P+S    PK V+ +  LA  
Sbjct  903  TCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSRLLAST  962

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +A          ++R   +      S+SD Q F++FGEVIS+++
Sbjct  963  TTA---------ADMRGHDVTDIGDNSSSDEQWFVRFGEVISKHT  998



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH---PKQVNQTPSLAPL  213
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SL+P+S    PK V+ +  LA  
Sbjct  884  TCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSRLLAST  943

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +A          ++R   +      S+SD Q F++FGEVIS+++
Sbjct  944  TTA---------ADMRGHDVTDIGDNSSSDEQWFVRFGEVISKHT  979



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 61/109 (56%), Gaps = 21/109 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM--PSSHPKQVNQTPS-----  225
            TC D+G VKK FQ A  CTKR P +RP+MHEVARVL SL+  PS  P  V Q P      
Sbjct  893  TCMDMGLVKKAFQLALLCTKRHPSDRPTMHEVARVLVSLLPVPSLKPGLVPQKPMDYAHY  952

Query  224  LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            LA  P  K+    D+               S+SD Q FL+FGEVIS+N+
Sbjct  953  LAAGPDVKIKRNHDDN--------------SSSDGQWFLRFGEVISKNT  987



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSH---PKQVNQTPSLAPL  213
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SL+P+S    PK V+ +  LA  
Sbjct  884  TCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSRLLAST  943

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +A          ++R   +      S+SD Q F++FGEVIS+++
Sbjct  944  TTA---------ADMRGHDVTDIGDNSSSDEQWFVRFGEVISKHT  979



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 13/107 (12%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG VKKVFQ A  CT+  P ERP++HEVARVL SL+P          P+   L +A
Sbjct  849  TCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARVLVSLLPPP--------PTKPALGTA  900

Query  203  KVPCY-----MDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y       E + L+T Q       ++SDA+ F++FGEV+S+N+
Sbjct  901  KTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEWFVRFGEVVSKNT  947



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 13/105 (12%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS---SHPKQVNQTPSLAPL  213
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SL+P+   + PK V+ +  LA  
Sbjct  889  TCTDIGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPAPAVTTPKTVDYSRLLAST  948

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +A          ++R   +      S+SD Q F++FGEVIS+++
Sbjct  949  TAA----------DMRGHDVTDIGDNSSSDEQWFVRFGEVISKHT  983



>emb|CDP20026.1| unnamed protein product [Coffea canephora]
Length=490

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 13/107 (12%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG VKKVFQ A  CT+  P ERP++HEVARVL SL+P          P+   L +A
Sbjct  391  TCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARVLVSLLPPP--------PTKPALGTA  442

Query  203  KVPCY-----MDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y       E + L+T Q       ++SDA+ F++FGEV+S+N+
Sbjct  443  KTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEWFVRFGEVVSKNT  489



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 14/109 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P+   K  +  P   P+  A
Sbjct  887  TCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARVLVSLLPAPPAKPCSSPPK--PIDYA  944

Query  203  KVPCYMDEYTNLRTPQLLTCP-------SMSTSDAQLFLKFGEVISQNS  78
                 MD+    +  QL   P       + S++DAQ F++F EVIS+NS
Sbjct  945  HF--VMDKGQKQQNAQL---PPHVEPDNNTSSNDAQWFVRFHEVISKNS  988



>emb|CAN79933.1| hypothetical protein VITISV_008329 [Vitis vinifera]
Length=340

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P+  P +   +P   P P  
Sbjct  238  TCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARVLVSLLPAP-PAKPCSSP---PKPID  293

Query  203  KVPCYMDEYTNLRTPQL--LTCPSMSTS--DAQLFLKFGEVISQNS  78
                 MD+    +  QL     P  +TS  DAQ F++F EVIS+NS
Sbjct  294  YAHFVMDKGQKQQNAQLPPHVEPDNNTSSNDAQWFVRFHEVISKNS  339



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = -2

Query  383   TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
             TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  908   TCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSKTIDYA  966

Query  203   KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             +      +  NL   Q+        S+ Q F++F +V+S NS
Sbjct  967   QFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDVVSNNS  1008



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K    +P L      
Sbjct  863  TCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVLVSLLPPPPSKSCTLSPKLINYAQF  922

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             V     ++ + +  Q   C    +SDAQ F+KFGEVIS+ +
Sbjct  923  VVNKEGKQHHHQQQGQQDNC----SSDAQWFMKFGEVISKTT  960



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K    +P L      
Sbjct  848  TCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVLVSLLPPPPSKSCTLSPKLINYAQF  907

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             V     ++ + +  Q   C    +SDAQ F+KFGEVIS+ +
Sbjct  908  VVNKEGKQHHHQQQGQQDNC----SSDAQWFMKFGEVISKTT  945



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  848  TCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSKTIDYA  906

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +      +  NL   Q+        S+ Q F++F +V+S NS
Sbjct  907  QFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDVVSNNS  948



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K    +P L      
Sbjct  887  TCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVLVSLLPPPPSKSCTLSPKLINYAQF  946

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             V     ++ + +  Q   C    +SDAQ F+KFGEVIS+ +
Sbjct  947  VVNKEGKQHHHQQQGQQDNC----SSDAQWFMKFGEVISKTT  984



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  892  TCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSKTIDYA  950

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +      +  NL   Q+        S+ Q F++F +V+S NS
Sbjct  951  QFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDVVSNNS  992



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  848  TCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSKTIDYA  906

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +      +  NL   Q+        S+ Q F++F +V+S NS
Sbjct  907  QFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDVVSNNS  948



>ref|XP_006372044.1| hypothetical protein POPTR_0018s08390g, partial [Populus trichocarpa]
 gb|ERP49841.1| hypothetical protein POPTR_0018s08390g, partial [Populus trichocarpa]
Length=384

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  221  APLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            A LPS KVPCYMDE+ N++   +L CPSMSTS+A+LFLKFGEVISQNS
Sbjct  336  ALLPSNKVPCYMDEHANIKNAHILHCPSMSTSEAELFLKFGEVISQNS  383



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 62/112 (55%), Gaps = 25/112 (22%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SLMP+         P+L   PS 
Sbjct  846  TCTDMGLVRKAFQLALLCTKRHPMDRPTMHEVARVLLSLMPA---------PALK--PSY  894

Query  203  KVPCYMDEYTNLRTPQLLTCPSM----------STSDAQLFLKFGEVISQNS  78
                   +YT      L T P +          S+SD Q F++FGEVIS+++
Sbjct  895  TTASKTVDYTRY----LATTPDLNHDGTDIGNNSSSDEQWFVRFGEVISKHT  942



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 20/108 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS------SHPKQVNQTPSL  222
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P+      S PK ++    +
Sbjct  865  TCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVLVSLLPATATKHGSIPKGIDYAKFV  924

Query  221  APLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            A           D+  +   PQ     S   SDAQ F++FGEVIS+N+
Sbjct  925  A-----------DKEPHKPKPQQQESHS---SDAQWFVRFGEVISKNT  958



>ref|XP_010109087.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
 gb|EXC20887.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
Length=527

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 61/109 (56%), Gaps = 16/109 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLP-S  207
            TC DL  V+K FQ A  CTKR P ERP+MHE+ARVL SL+P+         P++ P P +
Sbjct  427  TCMDLAHVRKTFQLALLCTKRNPSERPTMHEIARVLVSLLPA---------PAIKPCPIT  477

Query  206  AKVPCYMDEYTNLRTPQ------LLTCPSMSTSDAQLFLKFGEVISQNS  78
             K   Y     +    Q      L      ++SDAQ F++FGEVIS+N+
Sbjct  478  PKTIDYAKFVVDKGGQQPKVMQPLARQQENNSSDAQWFVRFGEVISKNT  526



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK  P ERP+MH+VARVL SL+P+  P  +   PS   +  A
Sbjct  891  TCMDLTHVKKTFQLALLCTKGNPSERPTMHQVARVLASLLPAP-PSNIFAPPS-KTIDYA  948

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            ++   + +  NL  PQ+    S   S+ Q F++F  V+S NS
Sbjct  949  QI--VIQKGNNLHPPQMERLQSQKYSNDQWFVRFENVVSNNS  988



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 11/102 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  893  TCMDLTHVKKTFQLALLCTKRNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSNTIDYA  951

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +         +L TPQ+           Q F++F +V+S NS
Sbjct  952  QFVIQKVNKNSLHTPQM----------DQWFVRFEDVVSNNS  983



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 58/108 (54%), Gaps = 18/108 (17%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEV+RVL SL+P    K     P   P    
Sbjct  869  TCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRVLVSLLPPLSSKSCTALPK--PF---  923

Query  203  KVPCYMDEYTNL------RTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                    YT        +  Q     + ++SDAQ F+KFGEVIS+NS
Sbjct  924  -------NYTQFVVNKEGKQNQHQQQDNNNSSDAQWFVKFGEVISKNS  964



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 6/102 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEV+RVL SL+P    K     P   P    
Sbjct  885  TCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRVLVSLLPPLSSKSCTALPK--PFNYT  942

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +     +     +  Q     + ++SDAQ F+KFGEVIS+NS
Sbjct  943  QFVVNKEG----KQNQHQQQDNNNSSDAQWFVKFGEVISKNS  980



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+   K     P L P  + 
Sbjct  893  TCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVLVSLLPAPSLK-----PGLVPPKAV  947

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                Y+    +++   +      S+SD Q F++FGEVIS N+
Sbjct  948  DYKHYLAAGPDVK---IKGSHGDSSSDGQWFVRFGEVISMNT  986



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383   TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
             TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+   K     P L P  + 
Sbjct  923   TCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVLVSLLPAPSLK-----PGLVPPKAV  977

Query  203   KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                 Y+    +++   +      S+SD Q F++FGEVIS N+
Sbjct  978   DYKHYLAAGPDVK---IKGSHGDSSSDGQWFVRFGEVISMNT  1016



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P+  P +++  P  +   S 
Sbjct  890  TCMDLSHVRKTFQLALLCTKRHPSERPTMHEVARVLVSLLPAP-PTKLSSAPPKSIDYSQ  948

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             V     +   L   Q       ++SDAQ F++F EVIS+N+
Sbjct  949  FVIGKGQKRLQLEQQQPQVEQETNSSDAQWFVRFREVISKNT  990



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+   K     P L P  + 
Sbjct  845  TCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVLVSLLPAPSLK-----PGLVPPKAV  899

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                Y+    +++   +      S+SD Q F++FGEVIS N+
Sbjct  900  DYKHYLAAGPDVK---IKGSHGDSSSDGQWFVRFGEVISMNT  938



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 12/104 (12%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQ--VNQTPSLAPLP  210
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P++  K   + +    A   
Sbjct  861  TCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVLVSLLPATATKHGSIPKGIDYAKFV  920

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            + K P         + P+     S S S+AQ F++FGEVIS+N+
Sbjct  921  ADKEP---------QKPKPQQQESHS-SNAQWFVRFGEVISKNT  954



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+M EVARVL SL+P+         P+   L + 
Sbjct  849  TCMDLSVVRKTFQLALLCTKRYPSERPTMQEVARVLVSLLPAP--------PTKLSLAAP  900

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y  ++   R  Q       ++SDA+ F++FGEVIS+N+
Sbjct  901  KPIDYYTKFVVDRERQQRVEHDDNSSDARWFVRFGEVISKNT  942



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+M EVARVL SL+P+         P+   L + 
Sbjct  849  TCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARVLVSLLPAP--------PAKLSLAAP  900

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y  ++   R  Q       ++SDA+ F++FGEVIS+N+
Sbjct  901  KPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFGEVISKNT  942



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+M EVARVL SL+P+         P+   L + 
Sbjct  871  TCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARVLVSLLPAP--------PAKLSLAAP  922

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y  ++   R  Q       ++SDA+ F++FGEVIS+N+
Sbjct  923  KPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFGEVISKNT  964



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 59/110 (54%), Gaps = 17/110 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SLMP          P  A  PS+
Sbjct  881  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVLLSLMPP---------PPAAVKPSS  931

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--------STSDAQLFLKFGEVISQNS  78
                  D    +   + L   +         S+SD Q F++FGEVIS+++
Sbjct  932  YGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSDEQWFVRFGEVISKHT  981



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 12/107 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  VKKVFQ A  C KR P ERP+MHEVARVL SL+P+   K     PS   + + 
Sbjct  848  TCMDISLVKKVFQLALLCAKRYPSERPTMHEVARVLISLLPAPASK-----PSSCNVKTI  902

Query  203  KVPCYMDEYTNLRTPQLLT-CPSM----STSDAQLFLKFGEVISQNS  78
                ++    N    QL++  P +    STSDAQ FLKF EVIS+N+
Sbjct  903  DYARFV--INNKGQQQLMSQLPQVRQEDSTSDAQWFLKFREVISKNT  947



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 59/109 (54%), Gaps = 21/109 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMP-------SSHPKQVNQTPS  225
            TC D+G VKK FQ A  CTKR P +RPSMH+VA VL +L+P       ++ PK  + T  
Sbjct  901  TCMDMGLVKKAFQLALLCTKRHPSDRPSMHQVALVLVTLLPAPSSKPSTAAPKPTDYTHY  960

Query  224  LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            LA  P  K     D              S S SD Q F++FGEVIS+++
Sbjct  961  LAAGPVVKANAKHD--------------SSSLSDGQWFVRFGEVISKST  995



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 56/102 (55%), Gaps = 11/102 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+P+   K +   PS   +  A
Sbjct  849  TCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVLASLLPAPPSKNIF-VPSSNTIDYA  907

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +         +L TPQ+           Q F++F +V+S NS
Sbjct  908  QFVIQKVNKNSLHTPQM----------DQWFVRFEDVVSNNS  939



>dbj|BAJ90194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 59/110 (54%), Gaps = 17/110 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SLMP          P  A  PS+
Sbjct  669  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVLLSLMPP---------PPAAVKPSS  719

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--------STSDAQLFLKFGEVISQNS  78
                  D    +   + L   +         S+SD Q F++FGEVIS+++
Sbjct  720  YGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSDEQWFVRFGEVISKHT  769



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 61/106 (58%), Gaps = 12/106 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERPSMHEVARVL SL+PS         PS    P A
Sbjct  896  TCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLLPSP--------PSKILAPPA  947

Query  203  KVPCY----MDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y    +++    +  +       ++S+AQ F++FG+VIS+++
Sbjct  948  KKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISKST  993



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 60/105 (57%), Gaps = 11/105 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+M +V+RVL S +P+  P +     SL P P  
Sbjct  885  TCMDLTTVKKSFQLALLCTKRHPSERPTMQDVSRVLVSFVPA--PTKA----SLLPKPFD  938

Query  203  KVPCYMD---EYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                 MD   +   L  PQLL     ++SDA  F++F EV+S+N+
Sbjct  939  YAKFVMDKGQQQPTLHQPQLLQ--ENNSSDAHWFMRFKEVVSKNT  981



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 61/106 (58%), Gaps = 12/106 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERPSMHEVARVL SL+PS         PS    P A
Sbjct  892  TCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLLPSP--------PSKILAPPA  943

Query  203  KVPCY----MDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y    +++    +  +       ++S+AQ F++FG+VIS+++
Sbjct  944  KKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISKST  989



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 61/106 (58%), Gaps = 12/106 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERPSMHEVARVL SL+PS         PS    P A
Sbjct  731  TCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLLPSP--------PSKILAPPA  782

Query  203  KVPCY----MDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y    +++    +  +       ++S+AQ F++FG+VIS+++
Sbjct  783  KKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISKST  828



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 57/102 (56%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS   +   + PSL   PS 
Sbjct  881  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLLPSL--QVAKKLPSLD--PST  936

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P +  E  NL               +Q F++F EVIS +S
Sbjct  937  KTPQHESEVRNLE-----------AEASQWFVQFREVISNSS  967



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 61/106 (58%), Gaps = 9/106 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+M +V+RVL S +P+   K      SL P P  
Sbjct  883  TCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVLVSFLPALPTK-----ASLLPKPID  937

Query  203  KVPCYMDEYTNLRTPQLLT--CPSM--STSDAQLFLKFGEVISQNS  78
                 +D+    + P ++    PS   ++SDAQ F++F EV+S+N+
Sbjct  938  YAKFVIDKGQQQQQPSIVNQQQPSQENNSSDAQWFVRFKEVVSKNT  983



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 13/108 (12%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS------SHPKQVNQTPSL  222
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P+      S PK ++    +
Sbjct  886  TCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVLVSLLPAPATKHCSIPKGIDYAKFV  945

Query  221  APLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            A     +         + +           +SDAQ F++FGEVIS+N+
Sbjct  946  ADKEQQRP-------KSQQQQPRPVQQESHSSDAQWFVRFGEVISKNT  986



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 7/104 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+M +V+RVL S +P+   K      SL P P  
Sbjct  848  TCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVLVSFLPALPTKA-----SLLPKPID  902

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLKFGEVISQNS  78
                 +D+    +       PS   ++SDAQ F++F EV+S+N+
Sbjct  903  YAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVRFKEVVSKNT  946



>gb|ABR08864.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08865.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08866.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08867.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08868.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08869.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08870.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08871.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08872.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08873.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08874.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08876.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08877.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08878.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08879.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08880.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08881.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08882.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08883.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08884.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08885.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08886.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPS  225
            TC+DLG VKKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T +
Sbjct  89   TCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSA  141



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 7/104 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+M +V+RVL S +P+   K      SL P P  
Sbjct  885  TCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVLVSFLPALPTKA-----SLLPKPID  939

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLKFGEVISQNS  78
                 +D+    +       PS   ++SDAQ F++F EV+S+N+
Sbjct  940  YAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVRFKEVVSKNT  983



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P ERP+M EV RVL S +P+   K+    P   P P  
Sbjct  848  TCMDITHVRKTFQLALLCTKRHPSERPTMPEVVRVLVSFLPAPPTKKPCSAP---PKPID  904

Query  203  KVPCYMDEYTNLRTPQ-LLTCPSMSTSDAQLFLKFGEVISQNS  78
                 +D+      P+  L     ++SDAQ FL+F EVIS+N+
Sbjct  905  YAKFVIDKGQQQPAPKNQLAQQENNSSDAQWFLRFREVISKNT  947



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 61/105 (58%), Gaps = 9/105 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV---NQTPSLAPL  213
            TC DL  VKK FQ A  CT+R P ERPSMHEVARVL SL+P    K V    ++   AP 
Sbjct  894  TCIDLAHVKKTFQLALLCTRRNPSERPSMHEVARVLISLLPPPPSKVVAAAAKSFDYAPF  953

Query  212  PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             + K   +  +   L+  Q       + S+AQ F++FG+VIS++S
Sbjct  954  VAEKGQ-HHRKLDGLQPQQ-----DNNLSNAQWFVRFGDVISKSS  992



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS   +   + PSL   PS 
Sbjct  878  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLLPSL--QVAKKLPSLD--PST  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P +  E  N                +Q F++F EVIS +S
Sbjct  934  KTPQHESEVRN-----------REAEASQWFVQFREVISNSS  964



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEV+RVL SL+P    K     P LAP  S 
Sbjct  875  TCMDLTHVRKTFQLALLCTKRFPCERPTMHEVSRVLVSLLPPPPTK-----PCLAPPKSI  929

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                Y         PQ+    S ++SDAQ  ++F E IS+N+
Sbjct  930  D---YTKFVLGKGLPQVQQ--SENSSDAQWLVRFREAISKNT  966



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS   +   + PSL   PS 
Sbjct  877  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLLPSL--QVAKKLPSLD--PST  932

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P +  E  N                +Q F++F EVIS +S
Sbjct  933  KTPQHESEVRN-----------REAEASQWFVQFREVISNSS  963



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 59/106 (56%), Gaps = 12/106 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+PS         PS    P A
Sbjct  890  TCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSP--------PSKILAPPA  941

Query  203  KVPCYMDEYTNLRTPQLLTCPSM----STSDAQLFLKFGEVISQNS  78
            K   Y         P+ +         ++++AQ F++FG+VIS+++
Sbjct  942  KKFDYAHFVIEKGQPRKVEGQQPHQEDNSTNAQWFVRFGDVISKST  987



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC +L  V+K FQ A  CTKR P ERP+MHEVAR L SL+PS+   ++   P+  P+  A
Sbjct  890  TCMNLTHVRKTFQLALLCTKRHPSERPTMHEVARALVSLLPSAPAPKLCSAPT-KPVDYA  948

Query  203  K--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +  +   +      +  +       ++SDAQ F +F EVIS N+
Sbjct  949  RFIIDKGLQRSQKEQQQRQQVPQETNSSDAQWFARFREVISMNT  992



>gb|ABR08875.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPS  225
            TC+DLG +KKVFQ A  CTKRQP +RP+MH+V RVLGS M S  P     T +
Sbjct  89   TCKDLGVMKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSA  141



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 20/110 (18%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+         P++ P P+ 
Sbjct  879  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPA---------PAVKP-PTT  928

Query  203  KVPCYMDEYT--------NLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K      +YT        +++    +     S+SD Q F++FGEVIS+++
Sbjct  929  KGAA--GDYTRFLATTTADMKHDVSVDIGDNSSSDEQWFVRFGEVISKHT  976



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 57/104 (55%), Gaps = 6/104 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D   +KK FQ A  CTKR P ERP+MHEVA VL SL+P  H K+    P    +  A
Sbjct  889  TCMDTTHLKKTFQLALLCTKRNPTERPTMHEVASVLVSLLPLRHSKK----PLSKGIDYA  944

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS--TSDAQLFLKFGEVISQNS  78
            K     ++      PQ          ++DAQ F++FGEVIS+N+
Sbjct  945  KFAVDKEQQQPKAQPQQPKPVQQENHSTDAQWFVRFGEVISKNT  988



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC +L  V+K FQ A  CTKR P ERP+MHEVAR L SL+PS+   ++   P+  P+  A
Sbjct  888  TCMNLTHVRKTFQLALLCTKRLPSERPTMHEVARALVSLLPSAPAPKLCSAPT-KPVDYA  946

Query  203  K--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +  V   +      +  +       ++SDAQ F +F EVIS N+
Sbjct  947  RFIVDEGLQRSQKEQQQRQQVPQETNSSDAQWFARFREVISMNT  990



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK F+ A  CTK+ P ERP+MHEVARVL S +P+         PS     +A
Sbjct  897  TCIDLAHVKKTFRLALLCTKKNPSERPTMHEVARVLISQLPAP--------PSKVVAAAA  948

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y  +   L+ PQ    P  + S+AQ F++FG+ IS+++
Sbjct  949  KSFDYNQKVDGLQ-PQ----PDNNASNAQWFVRFGDDISKST  985



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSL--MPSSHPKQVNQTPSLAPLP  210
            TCQD+G V+K+ + A  C ++Q  +RP+MH+VA VL SL  +P+   K V+  P+     
Sbjct  851  TCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANVLFSLSPVPALSKKSVSSNPNQRR--  908

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQN  81
                  Y+D+Y   +    L+  S + S   LF+KFGEVISQ+
Sbjct  909  ------YIDDYAESKHADNLSASS-TNSGGHLFMKFGEVISQD  944



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSL--MPSSHPKQVNQTPSLAPLP  210
            TCQD+G V+K+ + A  C ++Q  +RP+MH+VA VL SL  +P+   K V+  P+     
Sbjct  851  TCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANVLFSLSPVPALSKKSVSSNPNQRR--  908

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQN  81
                  Y+D+Y   +    L+  S + S   LF+KFGEVISQ+
Sbjct  909  ------YIDDYAESKHADNLSASS-TNSGGHLFMKFGEVISQD  944



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  C KR P ERP+MHEVARVL SL+PS   K  + +     +  A
Sbjct  851  TCMDLSHVRKTFQLALLCLKRNPIERPTMHEVARVLVSLLPSPPTKHCSVSKG---IDYA  907

Query  203  KVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFGEVISQNS  78
            K      +  +    Q       S +SDAQ F +FGEVIS N+
Sbjct  908  KFAVDKGQQQSKLQQQQHPVQQESNSSDAQWFERFGEVISNNT  950



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 55/102 (54%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    +  Q PSL    S 
Sbjct  881  TCVDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLLPSLQVAKKLQEPSLD--KST  938

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P    E  N                ++ F++F EVIS++S
Sbjct  939  KKPQQESEVRN-----------REAEASEWFVQFREVISKSS  969



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K     P L P P  
Sbjct  882  TCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVLVSLLPPPPTK-----PCLDPPP--  934

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y         PQ+       +S+AQ  ++F E IS+NS
Sbjct  935  KSIDYTKFVIGKGLPQVQQ--GDDSSEAQWLVRFQEAISKNS  974



>gb|ACF87330.1| unknown [Zea mays]
Length=260

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +  K      + A   + 
Sbjct  156  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPA-AKPPASKAAAASAAAG  214

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
                ++    +LR   +        S+SD Q F++FGEVIS+++
Sbjct  215  DYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFGEVISKHT  258



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTK  P ERP+MHEV+RVL SL P     +    P+   L  A
Sbjct  845  TCIDLAHVRKTFQLALLCTKHNPSERPTMHEVSRVLISLQPPRPTVKQTSFPT-KTLDYA  903

Query  203  KVPCYMDEYTNLRTPQLLTCPS-MSTSDAQLFLKFGEVISQNST  75
            +      +  N +  Q     S ++TSDA+ F++FGEV+S+  +
Sbjct  904  QYVIEKGQNRNAKGGQEEQQKSDVNTSDARWFVQFGEVMSEQHS  947



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/102 (45%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K     P L P P  
Sbjct  880  TCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVLVSLLPPPPTK-----PCLDPPP--  932

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y         PQ+       +S+AQ  ++F E IS+NS
Sbjct  933  KSIDYTKFVIGKGLPQVQQ--GDDSSEAQWLVRFQEAISKNS  972



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 56/104 (54%), Gaps = 14/104 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K     P L P  S 
Sbjct  872  TCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVLVSLLPPPPTK-----PCLDPPKSI  926

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLKFGEVISQNS  78
                   +YT     + L       ++SDAQ  ++F E IS+N+
Sbjct  927  -------DYTKFVLGKGLPQAQQNDNSSDAQWLVRFREAISKNT  963



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 56/104 (54%), Gaps = 14/104 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTKR P ERP+MHEVARVL SL+P    K     P L P  S 
Sbjct  875  TCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVLVSLLPPPPTK-----PCLDPPKSI  929

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLKFGEVISQNS  78
                   +YT     + L       ++SDAQ  ++F E IS+N+
Sbjct  930  -------DYTKFVLGKGLPQAQQNDNSSDAQWLVRFREAISKNT  966



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTK  P ERP+MHEV+RVL SL P     +    P+   L  A
Sbjct  889  TCIDLAHVRKTFQLALLCTKHNPSERPTMHEVSRVLISLQPPRPTVKQTSFPT-KTLDYA  947

Query  203  KVPCYMDEYTNLRTPQLLTCPS-MSTSDAQLFLKFGEVISQNST  75
            +      +  N +  Q     S ++TSDA+ F++FGEV+S+  +
Sbjct  948  QYVIEKGQNRNAKGGQEEQQKSDVNTSDARWFVQFGEVMSEQHS  991



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 55/104 (53%), Gaps = 17/104 (16%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SLMP+  P     +   A   S 
Sbjct  857  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVLLSLMPA--PAAAKPSSYAATDASK  914

Query  203  KVPCYMDEYTNLRTPQLLTCPSM--------STSDAQLFLKFGE  96
            KV     +YT  R       P+         S+ D Q F++FGE
Sbjct  915  KV-----DYT--RYLAAAAAPNTEHDMGGDNSSPDEQWFVRFGE  951



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 53/102 (52%), Gaps = 8/102 (8%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  C KR P ERP MHEVARVL SL+P+   K  ++      L   
Sbjct  898  TCMDLSHVRKTFQLALLCLKRNPIERPFMHEVARVLVSLLPAPPTKHFDKGQQQPKLQQQ  957

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +           +          ++SDAQ F +FGEVIS+N+
Sbjct  958  Q--------QPQQQQHHPVQQESNSSDAQWFERFGEVISKNT  991



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 10/105 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+PS   K       LAP P+ 
Sbjct  896  TCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPLSK------ILAP-PAK  948

Query  203  K---VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K       +++    +  +          +AQ F++FG+VIS+++
Sbjct  949  KFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISKST  993



>ref|XP_006394418.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
 gb|ESQ31704.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
Length=821

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K F+ A  CTKR P ERP+M EV+RVL SL+PS    +  + PSL   PS 
Sbjct  723  TCMDLGHLRKTFKLALLCTKRNPLERPTMLEVSRVLLSLLPSLQAGK--KLPSLD--PSK  778

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y D+    +  +     +     +Q F++F EVIS+NS
Sbjct  779  KPTEYEDKDQQKQKQEKGEVRNHEEEGSQWFVQFREVISKNS  820



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 10/105 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+PS   K       LAP P+ 
Sbjct  892  TCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPLSK------ILAP-PAK  944

Query  203  K---VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K       +++    +  +          +AQ F++FG+VIS+++
Sbjct  945  KFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISKST  989



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 10/105 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTK+ P ERP+MHEVARVL SL+PS   K       LAP P+ 
Sbjct  896  TCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLLPSPLSK------ILAP-PAK  948

Query  203  K---VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K       +++    +  +          +AQ F++FG+VIS+++
Sbjct  949  KFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISKST  993



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+G V+K FQ A  CTKR P +RP+MHEVARVL SLMP+    +    PS      A
Sbjct  855  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVLLSLMPAPAAAK----PSSYATTDA  910

Query  203  KVPCYMDEYTNLRTPQL--LTCPSMSTSDAQLFLKFGE  96
                    Y     P          S+SD Q F++FGE
Sbjct  911  SKKVDYTRYLAAAAPNADHDMGGDNSSSDEQWFVRFGE  948



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTK+ P  RP+MHEV  VL SL+PS  PK    + +   +  A
Sbjct  850  TCTDLSHVRKAFQLALLCTKQHPTARPTMHEVRNVLVSLLPSP-PKNTTCSTNTKSVDYA  908

Query  203  KVPCYMDEYTN----LRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +     ++  +     +  Q L   + S+SDAQ +++FGEVIS N+
Sbjct  909  QFVVGKEQQPHHLQTPQQQQQLQQDNSSSSDAQWYVRFGEVISNNT  954



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  C KR P ERP+MHEVARVL SL+P    K     P L P P  
Sbjct  883  TCMDLMHVRKTFQLALLCAKRFPCERPTMHEVARVLVSLLPPPPTK-----PCLDPPP--  935

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y         PQ+      ++S+AQ  ++F E IS+NS
Sbjct  936  KSIDYTKFVIGKGLPQVQQ--GDNSSEAQWLVRFQEAISKNS  975



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K F+ A  CTKR P ERP+M EV+RVL SL+PS   +   + PS  P PS 
Sbjct  877  TCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVLLSLLPSM--QVAKKLPS--PDPSK  932

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y      +R  Q       S   +Q F +F EVIS++S
Sbjct  933  KPTNY-----GVREQQ----QERSEEGSQWFEQFHEVISKSS  965



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K F+ A  CTKR P ERP+M EV+RVL SL+PS   +   + PS  P PS 
Sbjct  878  TCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVLLSLLPSM--QVAKKLPS--PDPSK  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y      +R  Q       S   +Q F +F EVIS++S
Sbjct  934  KPTNY-----GVREQQ----QERSEEGSQWFEQFHEVISKSS  966



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K F+ A  CTKR P ERP+M EV+RVL SL+PS   +   + PS  P PS 
Sbjct  878  TCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVLLSLLPSM--QVAKKLPS--PDPSK  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y      +R  Q       S   +Q F +F EVIS++S
Sbjct  934  KPTNY-----GVREQQ----QERSEEGSQWFEQFHEVISKSS  966



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTK    ERP+MHEV+RVL SL P+    + +  P+   L  A
Sbjct  895  TCIDLAHVRKTFQLALLCTKHNSSERPTMHEVSRVLISLQPAQPTVKRSSFPT-KTLDYA  953

Query  203  KVPCYMDEYTNLRTPQLLTCPS-MSTSDAQLFLKFGEVISQNST  75
            +      ++  L+  Q     S ++TSDA+ F++FGEV S+  +
Sbjct  954  QYVIEKGQHRKLKGGQEEQQKSDVNTSDARWFVQFGEVTSEQHS  997



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K F+ A  CTKR P ERP+M EV+RVL SL+PS   +   + PS  P PS 
Sbjct  878  TCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVLLSLLPSM--QVAKKLPS--PDPSK  933

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K   Y      +R  Q       S   +Q F +F EVIS++S
Sbjct  934  KPTVY-----GVRDQQKQQ-QERSEEGSQWFDQFHEVISKSS  969



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 23/104 (22%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVL--GSLMPSSHPKQVNQTPSLAPLP  210
            TC DL  V+K FQ A  CTKR P ERP+MHEVAR +     +     KQ N         
Sbjct  847  TCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARPIDYAHFVMDKGQKQQN---------  897

Query  209  SAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             A++P +++   N            S++DAQ F++F EVIS+NS
Sbjct  898  -AQLPPHVEPDNN-----------TSSNDAQWFVRFHEVISKNS  929



>gb|ACR34621.1| unknown [Zea mays]
Length=460

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +  K      + A   + 
Sbjct  356  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPA-AKPPASKAAAASAAAG  414

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
                ++    +LR   +        S+SD Q F++FGEVIS+++
Sbjct  415  DYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFGEVISKHT  458



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 57/102 (56%), Gaps = 7/102 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG +KK F+ A  CTKR P ERP+M EV+RVL SL+PS   +   + PSL   PS 
Sbjct  880  TCMDLGHIKKTFKLALLCTKRNPLERPTMLEVSRVLLSLVPSL--QVAKKLPSLD--PST  935

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P    +Y   +  +           +Q F++F E IS++S
Sbjct  936  KKPI---DYVVGQQQEKSEAQDREAEASQWFVQFHEDISKSS  974



>gb|ACN26436.1| unknown [Zea mays]
Length=500

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +  K      + A   + 
Sbjct  396  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPA-AKPPASKAAAASAAAG  454

Query  203  KVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKFGEVISQNS  78
                ++    +LR   +        S+SD Q F++FGEVIS+++
Sbjct  455  DYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFGEVISKHT  498



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    QV          + 
Sbjct  851  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLVPS---LQV----------AK  897

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+P        L+    +  P    S  Q F++F EVIS++S
Sbjct  898  KLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFREVISKSS  937



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    QV          + 
Sbjct  831  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLVPS---LQV----------AK  877

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+P        L+    +  P    S  Q F++F EVIS++S
Sbjct  878  KLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFREVISKSS  917



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    QV          + 
Sbjct  879  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLVPS---LQV----------AK  925

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+P        L+    +  P    S  Q F++F EVIS++S
Sbjct  926  KLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFREVISKSS  965



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    QV          + 
Sbjct  879  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLVPS---LQV----------AK  925

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+P        L+    +  P    S  Q F++F EVIS++S
Sbjct  926  KLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFREVISKSS  965



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 5/103 (5%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  V+K FQ A  CTK  P ERP+MHEV RVL S +P+   K  +  P    +  A
Sbjct  893  TCVDLTHVRKTFQLALLCTKPYPSERPTMHEVVRVLVSFLPAPAMKPCSAPPK--RIDYA  950

Query  203  KVPCYMDEYTNLRTP-QLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K    +D+      P Q       ++SDAQ F+ F EVIS+N+
Sbjct  951  KF--VIDKGQQQPAPKQEQAQQENNSSDAQWFVGFREVISKNT  991



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 2/102 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P ERP+MHEV+R LGSL+P     +   +     +   
Sbjct  893  TCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRFLGSLLPPP--PKKPCSTPPKNIDYT  950

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +      +  +L+ PQ       ++SDAQ +++FGEVIS+N+
Sbjct  951  QFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFGEVISKNT  992



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS   +   + PS     S 
Sbjct  879  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLLPSL--QVAKKLPSHD--QST  934

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K P   +E  N                +Q F++F EVIS++S
Sbjct  935  KKPQQENEVRN-----------HDAEASQWFVQFREVISKSS  965



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 2/102 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P ERP+MHEV+R LGSL+P     +   +     +   
Sbjct  849  TCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRFLGSLLPPP--PKKPCSTPPKNIDYT  906

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +      +  +L+ PQ       ++SDAQ +++FGEVIS+N+
Sbjct  907  QFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFGEVISKNT  948



>dbj|BAC42683.1| unknown protein [Arabidopsis thaliana]
Length=325

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTKR P ERP+M EV+RVL SL+PS    QV          + 
Sbjct  238  TCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLLSLVPS---LQV----------AK  284

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            K+P        L+    +  P    S  Q F++F EVIS++S
Sbjct  285  KLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFREVISKSS  324



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+    +   + ++A   + 
Sbjct  878  TCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARVLLSLLPAPPAAKPPASKAVA---AG  934

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                ++    ++           S+SD Q F++FGEVIS+++
Sbjct  935  DYTRFLAAAADMNHGLPDDIGDNSSSDEQWFVRFGEVISKHT  976



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHP  249
            TC DLG ++K FQ A  CTKR P ERP+MHEV+RVL SL+   HP
Sbjct  878  TCMDLGHIRKTFQLALLCTKRNPSERPTMHEVSRVLHSLL---HP  919



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 19/110 (17%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV--------NQTP  228
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P+    +         + T 
Sbjct  886  TCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARVLLSLLPAPPAAKPPATKAAAGDYTR  945

Query  227  SLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             LA     K     D+  +            S+SD Q F++FGEVIS+++
Sbjct  946  FLATAADMKHGGLSDDIGD-----------NSSSDEQWFVRFGEVISKHT  984



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DLG ++K FQ A  CTK  P ERP+M EV+RVL SL+PS   +   + PSL   PS 
Sbjct  877  TCMDLGHIRKTFQLALLCTKLNPLERPTMLEVSRVLLSLLPSL--QVAKKLPSLD--PST  932

Query  203  KVPCYMDEYTN  171
            K P   +E  N
Sbjct  933  KKPQQENEVRN  943



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 21/113 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV-----------N  237
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +                +
Sbjct  881  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPAAKPPASKAAAASAAAGD  940

Query  236  QTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             T  LA     +     D+ T             S+SD Q F++FGEVIS+++
Sbjct  941  YTRFLATAADLRRGGVADDDTG----------DNSSSDEQWFVRFGEVISKHT  983



>ref|NP_001146239.1| uncharacterized LOC100279811 [Zea mays]
 gb|ACL53538.1| unknown [Zea mays]
Length=774

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 21/113 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV-----------N  237
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +                +
Sbjct  670  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPAAKPPAPKAAAASAAAGD  729

Query  236  QTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             T  LA     +     D+ T             S+SD Q F++FGEVIS+++
Sbjct  730  YTRFLATAADLRRGGVADDDTG----------DNSSSDEQWFVRFGEVISKHT  772



>gb|AFW86031.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=944

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 21/113 (19%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQV-----------N  237
            TC D+  V+K FQ A  CTKR P +RP+MHEVARVL SL+P +                +
Sbjct  840  TCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVLLSLLPPAAKPPASKAAAASAAAGD  899

Query  236  QTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
             T  LA     +     D+ T             S+SD Q F++FGEVIS+++
Sbjct  900  YTRFLATAADLRRGGVADDDTG----------DNSSSDEQWFVRFGEVISKHT  942



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 53/102 (52%), Gaps = 13/102 (13%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D   +KKVFQ A  CTKR P ERP+M++V+ VL S++P+  P Q  Q        S 
Sbjct  853  TCMDSSHIKKVFQLALLCTKRLPSERPTMNDVSSVLKSMLPA--PPQKKQL-------SV  903

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            + P   D         L     M     + +++FGEVIS+NS
Sbjct  904  QQPHCKDAAAGGHEEDL----QMKRDAEEWYVRFGEVISKNS  941



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D   ++K FQ A  CTK QP ERP+M EV+RVL SL+P         + + + L   
Sbjct  875  TCTDHNLLRKTFQLALLCTKCQPSERPTMQEVSRVLLSLLPPPPTSTTKPSSTSSRL-VM  933

Query  203  KVPCYMDEYTNLRTPQLL-TCPSMSTSDAQLFLKFGEVISQNS  78
                Y+DEY++++   +       ST+D   F++FGEVISQN+
Sbjct  934  TYSQYIDEYSDVKKEAVAGNLTHNSTTDPHWFVRFGEVISQNT  976



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 48/102 (47%), Gaps = 35/102 (34%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC DL  VKK FQ A  CTKR P ERP+M +V+R               Q P+       
Sbjct  803  TCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSR---------------QQPT-------  840

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
                       L  PQLL     ++SDA  F++F EV+S+N+
Sbjct  841  -----------LHQPQLLQ--ENNSSDAHWFMRFKEVVSKNT  869



>emb|CDM84625.1| unnamed protein product [Triticum aestivum]
Length=216

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPS  258
            TC D+G V+KVFQ A  CTK+ P +RP MHE ARVL  LMP+
Sbjct  172  TCTDMGLVQKVFQLALLCTKQHPIDRPRMHEEARVLLWLMPA  213



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSL  267
            TC D G +KK FQ A  CTKR P ERP+M EVARVL SL
Sbjct  882  TCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARVLLSL  920



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM  264
            TC D G +KK FQ A  CTKR P ERP+M EV+RVL SL+
Sbjct  882  TCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLV  921



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM  264
            TC D G +KK FQ A  CTKR P ERP+M EV+RVL SL+
Sbjct  847  TCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLV  886



>ref|XP_001783127.1| ERL1a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ52064.1| ERL1a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=946

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDL  ++K  + A  C+K  P  RPSM++V++VL SL+P        Q+ +  P+  +
Sbjct  850  TCQDLDALEKTLKLALLCSKLNPSHRPSMYDVSQVLLSLLPM-------QSETDDPMSKS  902

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDA--QLFLKFGEVIS  87
             +P     Y ++ + +     S+S S +   L  +F EVIS
Sbjct  903  SLPANQRRYIDMYSTKHTEAISLSNSSSGDTLLYQFKEVIS  943



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLM  264
            TC D+G V+K FQ A  CTKR P +RP+MHEVAR L SL+
Sbjct  850  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARGLLSLV  889



>gb|AAO26312.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=719

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 10/94 (11%)
 Frame = -2

Query  359  KKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDE  180
            +K FQ A  C +R   +RP+MHEVARVL SL+P    K     P L P        Y+  
Sbjct  635  QKAFQLAI-CAQRS--DRPTMHEVARVLVSLLPVPSLK-----PGLVPQKPMDYAHYLAA  686

Query  179  YTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
              +++  +  T    S+SD Q FL+FGEVIS+N+
Sbjct  687  GPDVKIKR--THDDNSSSDGQWFLRFGEVISKNT  718



>ref|XP_010423244.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Camelina sativa]
Length=852

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSL  267
            TC D G +KK FQ A  CTKR P ERP+M EVARVL SL
Sbjct  767  TCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARVLLSL  805



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D   ++K+ + A  C ++ P +RP+MH+V  V+ +L+P    K+ +   + A   +A
Sbjct  869  TCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNVILTLLPPPSVKKSSAGAANAAANAA  928

Query  203  KVPC---------YMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  84
                         Y+D+Y + +    L+  S +TS   LF+KFGEVISQ
Sbjct  929  VDSAANAGGANRRYVDDYVDSKHRDNLSASS-TTSGGHLFVKFGEVISQ  976



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D   ++K+ + A  C ++ P +RP+MH+V  V+ +L+P    K+ +   + A   +A
Sbjct  868  TCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNVILTLLPPPTVKKSSAGAANAAANAA  927

Query  203  KVPC---------YMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  84
                         Y+D+Y + +    L+  S +TS   LF+KFGEVISQ
Sbjct  928  VDSSANAGGANRRYVDDYVDSKHRDNLSASS-TTSGGHLFVKFGEVISQ  975



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 17/102 (17%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TC D G +KK FQ A  CTKR P ERP+M EV+RVL SL+  S P +  Q+P  A LP A
Sbjct  882  TCVDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLL-PSPPPKKLQSP--AKLPEA  938

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQNS  78
            +              +     S  T+  Q F++F E IS++S
Sbjct  939  E--------------ERRESHSSDTATPQWFVQFREDISKSS  966



>ref|XP_001770079.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ65061.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=948

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSA  204
            TCQDL  ++K  + A  C+K  P  RPSM++V++VL SL+P  +    + + S    PS 
Sbjct  841  TCQDLDSLEKTLKLALLCSKDNPSHRPSMYDVSQVLLSLLPPQYSDDFHTSNS---FPST  897

Query  203  KVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVIS  87
            +   Y+D Y+   T       S ++S   L  +F E IS
Sbjct  898  QRR-YVDMYSTKHTESFSL--SKTSSGDTLLYQFKEAIS  933



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D G +KK FQ A  CTKR P ERP+M EVARV
Sbjct  881  TCVDSGHIKKTFQLALMCTKRNPMERPTMQEVARV  915



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVAR  282
            TC D+G V+K FQ A  CTKR P +RP+MHEVAR
Sbjct  918  TCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVAR  951



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D G +KK FQ A  CTKR P ERP+M EV+RV
Sbjct  881  TCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRV  915



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D G +KK FQ A  CTKR P ERP+M EVARV
Sbjct  879  TCVDSGHIKKTFQLALLCTKRNPMERPTMQEVARV  913



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D G +KK FQ A  C KR P ERP+M EVARV
Sbjct  881  TCVDSGHIKKTFQLALMCAKRNPMERPTMQEVARV  915



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D   +KK FQ A  CTKR P ERP+M EVARV
Sbjct  878  TCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARV  912



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  TCQDLGDVKKVFQRAXXCTKRQPXERPSMHEVARV  279
            TC D   +KK FQ A  CTKR P ERP+M EVARV
Sbjct  876  TCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARV  910



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565581808380