BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039F18

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602281.1|  PREDICTED: uncharacterized protein LOC104097433    214   2e-65   Nicotiana tomentosiformis
ref|XP_009800007.1|  PREDICTED: uncharacterized protein LOC104245986    214   3e-65   Nicotiana sylvestris
ref|XP_006353669.1|  PREDICTED: uncharacterized protein LOC102581215    191   1e-56   Solanum tuberosum [potatoes]
ref|XP_010322724.1|  PREDICTED: uncharacterized protein LOC101265245    190   4e-56   
ref|XP_009624814.1|  PREDICTED: uncharacterized protein LOC104115808    184   5e-54   
ref|XP_010244875.1|  PREDICTED: uncharacterized protein LOC104588581    182   6e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010250328.1|  PREDICTED: uncharacterized protein LOC104592576    181   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_003633146.1|  PREDICTED: putative protein TPRXL                  176   9e-51   Vitis vinifera
ref|XP_010648721.1|  PREDICTED: uncharacterized protein LOC100266438    176   1e-50   Vitis vinifera
emb|CAN72752.1|  hypothetical protein VITISV_030561                     176   8e-50   Vitis vinifera
gb|AFK41588.1|  unknown                                                 171   7e-49   Medicago truncatula
gb|ACJ83954.1|  unknown                                                 170   2e-48   Medicago truncatula
gb|AFK45204.1|  unknown                                                 170   2e-48   Medicago truncatula
ref|XP_009387687.1|  PREDICTED: uncharacterized protein LOC103974562    169   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84160.1|  unknown                                                 169   6e-48   Medicago truncatula
gb|ACJ86153.1|  unknown                                                 168   1e-47   Medicago truncatula
ref|XP_004508409.1|  PREDICTED: putative protein TPRXL-like             166   6e-47   Cicer arietinum [garbanzo]
ref|XP_009355793.1|  PREDICTED: uncharacterized protein LOC103946738    167   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_008394152.1|  PREDICTED: dual specificity tyrosine-phospho...    164   5e-46   Malus domestica [apple tree]
ref|XP_007155099.1|  hypothetical protein PHAVU_003G173100g             163   6e-46   Phaseolus vulgaris [French bean]
ref|XP_007013641.1|  Serine-rich protein-related                        163   1e-45   
ref|XP_003542665.1|  PREDICTED: trinucleotide repeat-containing g...    163   1e-45   Glycine max [soybeans]
gb|EPS66288.1|  hypothetical protein M569_08491                         162   3e-45   Genlisea aurea
ref|XP_004139263.1|  PREDICTED: uncharacterized protein LOC101209...    162   4e-45   
ref|XP_007202593.1|  hypothetical protein PRUPE_ppa011611mg             162   4e-45   Prunus persica
ref|XP_007226111.1|  hypothetical protein PRUPE_ppa011080mg             162   4e-45   Prunus persica
gb|KJB64619.1|  hypothetical protein B456_010G057600                    161   5e-45   Gossypium raimondii
ref|XP_009393722.1|  PREDICTED: uncharacterized protein LOC103979335    160   8e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54226.1|  hypothetical protein                                    161   8e-45   Phaseolus vulgaris [French bean]
ref|XP_009362322.1|  PREDICTED: uncharacterized protein JIP4-like       161   1e-44   Pyrus x bretschneideri [bai li]
gb|KJB53963.1|  hypothetical protein B456_009G013700                    160   2e-44   Gossypium raimondii
ref|XP_008219542.1|  PREDICTED: putative protein TPRXL                  160   2e-44   Prunus mume [ume]
ref|XP_008242917.1|  PREDICTED: putative protein TPRXL                  159   2e-44   Prunus mume [ume]
ref|XP_003544605.1|  PREDICTED: uncharacterized protein LOC100814735    159   3e-44   Glycine max [soybeans]
ref|XP_009769290.1|  PREDICTED: uncharacterized protein LOC104220170    158   9e-44   Nicotiana sylvestris
emb|CDP18810.1|  unnamed protein product                                158   2e-43   Coffea canephora [robusta coffee]
gb|EYU20232.1|  hypothetical protein MIMGU_mgv1a018309mg                158   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_009403190.1|  PREDICTED: uncharacterized protein LOC103986811    157   2e-43   
ref|XP_008802034.1|  PREDICTED: uncharacterized protein LOC103715996    156   3e-43   Phoenix dactylifera
ref|XP_004146710.1|  PREDICTED: uncharacterized protein LOC101217...    156   4e-43   Cucumis sativus [cucumbers]
ref|XP_010533108.1|  PREDICTED: uncharacterized protein LOC104808950    157   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_008366660.1|  PREDICTED: putative protein TPRXL                  157   5e-43   
ref|XP_010913363.1|  PREDICTED: uncharacterized protein LOC105039072    156   6e-43   Elaeis guineensis
emb|CDP10497.1|  unnamed protein product                                156   7e-43   Coffea canephora [robusta coffee]
ref|XP_008443919.1|  PREDICTED: uncharacterized serine-rich prote...    155   8e-43   
ref|XP_002324885.1|  hypothetical protein POPTR_0018s02140g             155   9e-43   
ref|XP_009622884.1|  PREDICTED: uncharacterized protein LOC104114...    154   2e-42   Nicotiana tomentosiformis
gb|AFK42940.1|  unknown                                                 154   3e-42   Lotus japonicus
gb|KJB23691.1|  hypothetical protein B456_004G110000                    154   3e-42   Gossypium raimondii
ref|XP_010047203.1|  PREDICTED: homeobox protein Nkx-6.1-like           154   4e-42   Eucalyptus grandis [rose gum]
ref|XP_003550193.1|  PREDICTED: uncharacterized serine-rich prote...    154   4e-42   Glycine max [soybeans]
gb|KHN48540.1|  hypothetical protein glysoja_041593                     154   5e-42   Glycine soja [wild soybean]
ref|XP_011036619.1|  PREDICTED: putative protein TPRXL                  153   8e-42   Populus euphratica
ref|XP_007136989.1|  hypothetical protein PHAVU_009G090900g             154   8e-42   Phaseolus vulgaris [French bean]
ref|XP_003522528.1|  PREDICTED: putative protein TPRXL-like             153   9e-42   
ref|XP_006359514.1|  PREDICTED: uncharacterized serine-rich prote...    153   9e-42   Solanum tuberosum [potatoes]
ref|XP_007161188.1|  hypothetical protein PHAVU_001G049400g             153   9e-42   Phaseolus vulgaris [French bean]
gb|KHN07053.1|  hypothetical protein glysoja_023236                     153   9e-42   Glycine soja [wild soybean]
ref|XP_004235914.1|  PREDICTED: uncharacterized protein LOC101263595    151   1e-41   
ref|XP_010519639.1|  PREDICTED: putative protein TPRXL                  153   1e-41   Tarenaya hassleriana [spider flower]
gb|KHG27589.1|  Vitamin K-dependent S                                   153   1e-41   Gossypium arboreum [tree cotton]
ref|XP_003526301.1|  PREDICTED: putative protein TPRXL-like             153   1e-41   
ref|XP_003549713.1|  PREDICTED: trinucleotide repeat-containing g...    152   1e-41   Glycine max [soybeans]
ref|XP_006341382.1|  PREDICTED: uncharacterized protein LOC102606030    150   2e-41   
ref|XP_004501356.1|  PREDICTED: 1-phosphatidylinositol 3-phosphat...    152   2e-41   
ref|XP_010908362.1|  PREDICTED: uncharacterized protein LOC105034782    151   5e-41   
ref|XP_010687825.1|  PREDICTED: uncharacterized protein LOC104901900    150   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008788890.1|  PREDICTED: uncharacterized protein LOC103706534    151   6e-41   Phoenix dactylifera
ref|XP_009778673.1|  PREDICTED: uncharacterized protein LOC104227990    150   7e-41   Nicotiana sylvestris
gb|ACU19325.1|  unknown                                                 151   7e-41   Glycine max [soybeans]
ref|XP_008354346.1|  PREDICTED: uncharacterized protein LOC103417967    150   8e-41   
gb|KDP30200.1|  hypothetical protein JCGZ_16982                         150   8e-41   Jatropha curcas
emb|CBI25574.3|  unnamed protein product                                152   8e-41   Vitis vinifera
ref|XP_009611326.1|  PREDICTED: uncharacterized protein LOC104104846    150   9e-41   Nicotiana tomentosiformis
ref|XP_010691070.1|  PREDICTED: putative protein TPRXL                  150   1e-40   
gb|KHG18275.1|  hypothetical protein F383_09858                         151   1e-40   Gossypium arboreum [tree cotton]
gb|KCW80272.1|  hypothetical protein EUGRSUZ_C01627                     148   1e-40   Eucalyptus grandis [rose gum]
ref|XP_009358531.1|  PREDICTED: uncharacterized protein LOC103949156    149   1e-40   
gb|KDP37028.1|  hypothetical protein JCGZ_06084                         150   1e-40   Jatropha curcas
ref|XP_009363915.1|  PREDICTED: uncharacterized protein LOC103953846    150   2e-40   Pyrus x bretschneideri [bai li]
emb|CDO98193.1|  unnamed protein product                                149   2e-40   Coffea canephora [robusta coffee]
ref|XP_009338399.1|  PREDICTED: uncharacterized protein LOC103930750    149   2e-40   
ref|XP_010050691.1|  PREDICTED: uncharacterized protein LOC104439311    150   2e-40   
ref|XP_009798216.1|  PREDICTED: uncharacterized protein LOC104244483    149   2e-40   Nicotiana sylvestris
ref|XP_004498757.1|  PREDICTED: vitellogenin-2-like                     149   3e-40   
ref|XP_010048163.1|  PREDICTED: uncharacterized protein LOC104437010    149   3e-40   Eucalyptus grandis [rose gum]
ref|XP_009799051.1|  PREDICTED: uncharacterized protein LOC104245184    148   3e-40   Nicotiana sylvestris
ref|XP_002271365.1|  PREDICTED: uncharacterized protein LOC100242170    149   3e-40   Vitis vinifera
ref|XP_006450364.1|  hypothetical protein CICLE_v10009513mg             149   3e-40   Citrus clementina [clementine]
ref|XP_006483414.1|  PREDICTED: uncharacterized protein DDB_G0271...    149   3e-40   Citrus sinensis [apfelsine]
ref|XP_010099865.1|  hypothetical protein L484_008522                   149   4e-40   Morus notabilis
ref|XP_003533861.1|  PREDICTED: uncharacterized protein LOC100794542    148   4e-40   Glycine max [soybeans]
gb|AFK38729.1|  unknown                                                 149   4e-40   Medicago truncatula
ref|XP_011458842.1|  PREDICTED: putative protein TPRXL                  149   5e-40   Fragaria vesca subsp. vesca
gb|EYU32362.1|  hypothetical protein MIMGU_mgv1a014368mg                147   8e-40   Erythranthe guttata [common monkey flower]
ref|XP_003546585.1|  PREDICTED: putative protein TPRXL-like             147   8e-40   Glycine max [soybeans]
ref|XP_002531449.1|  conserved hypothetical protein                     148   8e-40   Ricinus communis
ref|XP_006465228.1|  PREDICTED: vitellogenin-2-like                     147   1e-39   Citrus sinensis [apfelsine]
ref|XP_010323270.1|  PREDICTED: uncharacterized protein LOC101254911    147   1e-39   Solanum lycopersicum
gb|ABA40431.1|  unknown                                                 148   1e-39   Solanum tuberosum [potatoes]
ref|XP_008336956.1|  PREDICTED: putative protein TPRXL                  147   1e-39   
ref|XP_003603342.1|  hypothetical protein MTR_3g106530                  149   2e-39   
ref|XP_004287242.1|  PREDICTED: uncharacterized protein LOC101298453    147   2e-39   Fragaria vesca subsp. vesca
gb|KDP33557.1|  hypothetical protein JCGZ_07128                         146   3e-39   Jatropha curcas
ref|XP_006427484.1|  hypothetical protein CICLE_v10027309mg             146   3e-39   Citrus clementina [clementine]
gb|EYU25275.1|  hypothetical protein MIMGU_mgv1a014625mg                145   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_009407367.1|  PREDICTED: mucin-1-like                            146   5e-39   
ref|XP_011020249.1|  PREDICTED: uncharacterized protein LOC105122688    146   6e-39   Populus euphratica
ref|XP_010555066.1|  PREDICTED: uncharacterized protein PB18E9.04...    145   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010557627.1|  PREDICTED: uncharacterized protein LOC104826566    145   8e-39   Tarenaya hassleriana [spider flower]
ref|XP_008452898.1|  PREDICTED: putative protein TPRXL                  145   9e-39   Cucumis melo [Oriental melon]
ref|XP_002309648.1|  serine-rich family protein                         145   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006356235.1|  PREDICTED: uncharacterized protein LOC102603646    144   1e-38   Solanum tuberosum [potatoes]
ref|XP_010927347.1|  PREDICTED: uncharacterized protein LOC105049415    145   1e-38   Elaeis guineensis
ref|XP_006381071.1|  hypothetical protein POPTR_0006s05980g             145   1e-38   
ref|XP_002515469.1|  conserved hypothetical protein                     144   2e-38   
ref|XP_011078547.1|  PREDICTED: uncharacterized protein LOC105162252    144   3e-38   Sesamum indicum [beniseed]
gb|AAN62344.1|AF506028_11  CTV.15                                       144   3e-38   Citrus trifoliata [hardy orange]
ref|XP_010033986.1|  PREDICTED: uncharacterized protein LOC104423200    144   3e-38   Eucalyptus grandis [rose gum]
ref|XP_006350113.1|  PREDICTED: uncharacterized protein LOC102599166    142   4e-38   Solanum tuberosum [potatoes]
ref|XP_004507199.1|  PREDICTED: uncharacterized protein LOC101499615    142   4e-38   
ref|XP_008813132.1|  PREDICTED: uncharacterized protein LOC103723846    143   6e-38   
ref|XP_004251739.1|  PREDICTED: uncharacterized protein LOC101264293    141   1e-37   Solanum lycopersicum
ref|XP_004157087.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   1e-37   
ref|XP_007224858.1|  hypothetical protein PRUPE_ppa022839mg             140   1e-37   
ref|XP_011017923.1|  PREDICTED: uncharacterized protein LOC105121103    142   2e-37   Populus euphratica
gb|EYU25274.1|  hypothetical protein MIMGU_mgv1a014567mg                141   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_006394776.1|  hypothetical protein EUTSA_v10004807mg             143   2e-37   
ref|XP_004145523.1|  PREDICTED: uncharacterized protein LOC101218391    141   3e-37   Cucumis sativus [cucumbers]
ref|XP_007138468.1|  hypothetical protein PHAVU_009G211700g             141   3e-37   Phaseolus vulgaris [French bean]
ref|XP_010097160.1|  hypothetical protein L484_025705                   140   4e-37   Morus notabilis
ref|XP_011073376.1|  PREDICTED: uncharacterized protein LOC105158345    141   4e-37   Sesamum indicum [beniseed]
ref|XP_009596910.1|  PREDICTED: uncharacterized protein LOC104092917    140   4e-37   Nicotiana tomentosiformis
ref|XP_011039624.1|  PREDICTED: uncharacterized serine-rich prote...    140   5e-37   Populus euphratica
ref|XP_002519910.1|  conserved hypothetical protein                     140   7e-37   Ricinus communis
ref|XP_010665660.1|  PREDICTED: uncharacterized serine-rich prote...    140   1e-36   
ref|XP_009616804.1|  PREDICTED: uncharacterized protein LOC104109268    139   1e-36   Nicotiana tomentosiformis
emb|CDX87091.1|  BnaC09g04060D                                          139   2e-36   
ref|XP_006852817.1|  hypothetical protein AMTR_s00033p00173430          137   2e-36   
gb|KFK27780.1|  hypothetical protein AALP_AA8G427900                    139   3e-36   Arabis alpina [alpine rockcress]
ref|XP_002324583.1|  hypothetical protein POPTR_0018s12410g             138   5e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008445241.1|  PREDICTED: uncharacterized protein LOC103488327    137   6e-36   Cucumis melo [Oriental melon]
ref|XP_008775758.1|  PREDICTED: uncharacterized protein LOC103696036    137   6e-36   Phoenix dactylifera
ref|XP_010421380.1|  PREDICTED: hypha-specific G1 cyclin-related ...    138   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004488522.1|  PREDICTED: uncharacterized protein LOC101494844    137   8e-36   Cicer arietinum [garbanzo]
ref|XP_009125255.1|  PREDICTED: putative protein TPRXL                  137   9e-36   Brassica rapa
ref|XP_010493781.1|  PREDICTED: squamosa promoter-binding-like pr...    137   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004241685.1|  PREDICTED: uncharacterized protein LOC101259944    136   1e-35   Solanum lycopersicum
ref|XP_008228742.1|  PREDICTED: uncharacterized serine-rich prote...    136   2e-35   Prunus mume [ume]
ref|XP_009401387.1|  PREDICTED: uncharacterized protein LOC103985422    135   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006288644.1|  hypothetical protein CARUB_v10001949mg             135   5e-35   
ref|XP_006399610.1|  hypothetical protein EUTSA_v10014629mg             135   5e-35   Eutrema salsugineum [saltwater cress]
emb|CDX70380.1|  BnaC03g04640D                                          135   1e-34   
ref|XP_007014526.1|  Serine-rich protein-related                        134   1e-34   
ref|XP_008454197.1|  PREDICTED: putative protein TPRXL                  134   1e-34   Cucumis melo [Oriental melon]
gb|EYU21687.1|  hypothetical protein MIMGU_mgv1a024748mg                131   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_008364364.1|  PREDICTED: uncharacterized serine-rich prote...    134   1e-34   Malus domestica [apple tree]
ref|XP_010454851.1|  PREDICTED: putative protein TPRXL                  134   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009131193.1|  PREDICTED: cell wall integrity and stress re...    134   3e-34   Brassica rapa
ref|XP_009151048.1|  PREDICTED: uncharacterized protein LOC103874389    133   3e-34   Brassica rapa
ref|XP_007023329.1|  Serine-rich protein-related, putative              133   5e-34   Theobroma cacao [chocolate]
ref|XP_009111663.1|  PREDICTED: uncharacterized protein LOC103837086    132   8e-34   
ref|XP_010040344.1|  PREDICTED: uncharacterized protein LOC104429140    132   8e-34   
gb|ABL97972.1|  serine-rich protein                                     132   9e-34   Brassica rapa
ref|XP_002872151.1|  hypothetical protein ARALYDRAFT_489379             132   9e-34   
gb|EPS66146.1|  hypothetical protein M569_08632                         130   2e-33   Genlisea aurea
emb|CDX97080.1|  BnaC09g45450D                                          131   2e-33   
ref|XP_009121994.1|  PREDICTED: putative protein TPRXL                  131   2e-33   Brassica rapa
ref|XP_006288623.1|  hypothetical protein CARUB_v10001925mg             131   3e-33   Capsella rubella
ref|NP_197910.1|  serine-rich protein-like protein                      131   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AFB32810.1|  hypothetical protein 0_3046_01                          128   4e-33   Pinus mugo [mountain pine]
ref|XP_010419664.1|  PREDICTED: putative protein TPRXL                  130   4e-33   Camelina sativa [gold-of-pleasure]
gb|AAM67211.1|  serine-rich protein                                     130   5e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69786.1|  BnaA10g21350D                                          130   5e-33   
ref|XP_009338490.1|  PREDICTED: putative protein TPRXL                  131   6e-33   Pyrus x bretschneideri [bai li]
gb|AFG60223.1|  hypothetical protein 0_3046_01                          128   6e-33   Pinus taeda
emb|CDX88167.1|  BnaA06g27580D                                          129   8e-33   
emb|CDX85730.1|  BnaA02g00830D                                          130   1e-32   
gb|AFB32809.1|  hypothetical protein 0_3046_01                          127   1e-32   Pinus mugo [mountain pine]
ref|NP_196670.1|  serine-rich protein-like protein                      129   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152334.1|  PREDICTED: uncharacterized protein LOC101207294    128   2e-32   Cucumis sativus [cucumbers]
gb|AFG60224.1|  hypothetical protein 0_3046_01                          126   3e-32   Pinus taeda
ref|XP_010491804.1|  PREDICTED: putative protein TPRXL                  128   4e-32   Camelina sativa [gold-of-pleasure]
emb|CDX80497.1|  BnaC07g29470D                                          127   6e-32   
ref|XP_010456484.1|  PREDICTED: putative protein TPRXL                  128   6e-32   Camelina sativa [gold-of-pleasure]
gb|AEW07499.1|  hypothetical protein 0_3046_01                          125   8e-32   Pinus radiata
ref|XP_002871454.1|  hypothetical protein ARALYDRAFT_487941             127   1e-31   
emb|CDY51107.1|  BnaCnng20100D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_002530465.1|  conserved hypothetical protein                     125   2e-31   Ricinus communis
gb|EYU34940.1|  hypothetical protein MIMGU_mgv1a024024mg                126   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_004138717.1|  PREDICTED: uncharacterized protein LOC101214709    125   3e-31   Cucumis sativus [cucumbers]
gb|AEW07500.1|  hypothetical protein 0_3046_01                          122   1e-30   Pinus lambertiana
ref|XP_011084060.1|  PREDICTED: uncharacterized protein LOC105166416    124   1e-30   
gb|ABK21216.1|  unknown                                                 122   2e-30   Picea sitchensis
gb|KCW81351.1|  hypothetical protein EUGRSUZ_C02733                     122   5e-30   Eucalyptus grandis [rose gum]
gb|ABR18379.1|  unknown                                                 121   6e-30   Picea sitchensis
ref|XP_010051172.1|  PREDICTED: forkhead box protein C1-like            122   1e-29   
ref|XP_010097175.1|  hypothetical protein L484_025721                   119   3e-29   
ref|XP_010097173.1|  hypothetical protein L484_025719                   118   1e-28   
ref|XP_010097172.1|  hypothetical protein L484_025718                   118   1e-28   
ref|XP_007150776.1|  hypothetical protein PHAVU_005G179600g             116   7e-28   Phaseolus vulgaris [French bean]
gb|ABR17408.1|  unknown                                                 115   1e-27   Picea sitchensis
gb|ADE76856.1|  unknown                                                 115   1e-27   Picea sitchensis
gb|KEH37892.1|  hypothetical protein MTR_2g450700                       113   3e-27   Medicago truncatula
ref|XP_009793128.1|  PREDICTED: uncharacterized protein LOC104240041    114   3e-27   Nicotiana sylvestris
ref|XP_011467044.1|  PREDICTED: uncharacterized protein LOC105352242    114   5e-27   Fragaria vesca subsp. vesca
gb|KHN22423.1|  hypothetical protein glysoja_024932                     112   9e-27   Glycine soja [wild soybean]
ref|XP_009600832.1|  PREDICTED: uncharacterized protein LOC104096200    111   3e-26   Nicotiana tomentosiformis
gb|ABK26255.1|  unknown                                                 110   2e-25   Picea sitchensis
gb|ABK27079.1|  unknown                                                 106   4e-24   Picea sitchensis
ref|XP_011468518.1|  PREDICTED: uncharacterized protein LOC105352658    105   1e-23   Fragaria vesca subsp. vesca
ref|XP_004486636.1|  PREDICTED: probable serine/threonine-protein...    103   1e-22   Cicer arietinum [garbanzo]
ref|XP_010236437.1|  PREDICTED: uncharacterized protein LOC104584037    101   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_010109762.1|  hypothetical protein L484_008438                 95.1    3e-20   
gb|AEX12199.1|  hypothetical protein 0_7218_01                        91.7    8e-20   Pinus taeda
gb|AEX12200.1|  hypothetical protein 0_7218_01                        90.1    3e-19   Pinus taeda
ref|XP_003597954.1|  hypothetical protein MTR_2g104380                90.1    4e-18   Medicago truncatula
gb|EAZ05724.1|  hypothetical protein OsI_27951                        88.2    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010520684.1|  PREDICTED: uncharacterized protein LOC104799741  86.7    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_009131795.1|  PREDICTED: uncharacterized protein LOC103856443  86.7    3e-17   Brassica rapa
gb|AFK36164.1|  unknown                                               86.7    5e-17   Medicago truncatula
gb|AFW57201.1|  hypothetical protein ZEAMMB73_692989                  84.7    1e-16   
emb|CDY51848.1|  BnaA03g56150D                                        83.2    5e-16   Brassica napus [oilseed rape]
ref|XP_004954250.1|  PREDICTED: uncharacterized protein LOC101761531  82.8    8e-16   Setaria italica
gb|KFK26276.1|  hypothetical protein AALP_AA8G225800                  82.4    9e-16   Arabis alpina [alpine rockcress]
ref|XP_002873994.1|  hypothetical protein ARALYDRAFT_910077           80.9    3e-15   Arabidopsis lyrata subsp. lyrata
gb|AEX12216.1|  hypothetical protein 0_7218_01                        78.2    6e-15   Pinus radiata
ref|XP_006400605.1|  hypothetical protein EUTSA_v10015868mg           79.7    8e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010493142.1|  PREDICTED: uncharacterized protein LOC104770417  79.7    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002443921.1|  hypothetical protein SORBIDRAFT_07g004400        79.0    1e-14   
ref|NP_197537.1|  serine-rich protein-like protein                    77.8    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29077.1|  hypothetical protein AALP_AA7G085900                  77.0    4e-14   Arabis alpina [alpine rockcress]
ref|XP_010454341.1|  PREDICTED: uncharacterized protein LOC104736112  77.4    5e-14   Camelina sativa [gold-of-pleasure]
gb|KJB53962.1|  hypothetical protein B456_009G013600                  75.9    5e-14   Gossypium raimondii
ref|XP_007202930.1|  hypothetical protein PRUPE_ppa016664mg           74.3    2e-13   
emb|CDX70925.1|  BnaC03g10090D                                        75.5    2e-13   
ref|XP_006286710.1|  hypothetical protein CARUB_v10002860mg           76.3    2e-13   Capsella rubella
emb|CDY68410.1|  BnaAnng27180D                                        73.9    6e-13   Brassica napus [oilseed rape]
ref|XP_010244874.1|  PREDICTED: uncharacterized protein LOC104588580  72.4    9e-13   
gb|AEW08800.1|  hypothetical protein CL1668Contig1_02                 70.9    9e-13   Pinus radiata
ref|XP_009126442.1|  PREDICTED: uncharacterized protein LOC103851346  73.2    1e-12   Brassica rapa
ref|NP_001237708.1|  uncharacterized protein LOC100306623             72.0    1e-12   
gb|AFG50839.1|  hypothetical protein CL1668Contig1_02                 70.1    2e-12   Pinus taeda
gb|KHN47128.1|  hypothetical protein glysoja_022429                   71.2    2e-12   Glycine soja [wild soybean]
ref|NP_001048411.1|  Os02g0799700                                     71.6    5e-12   
gb|EAZ24963.1|  hypothetical protein OsJ_08744                        71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87888.1|  hypothetical protein OsI_09309                        71.6    5e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009760525.1|  PREDICTED: uncharacterized protein LOC104212863  68.9    7e-12   Nicotiana sylvestris
ref|XP_007013642.1|  Serine-rich protein-related                      70.1    7e-12   
ref|XP_010250390.1|  PREDICTED: uncharacterized protein LOC104592655  69.7    8e-12   Nelumbo nucifera [Indian lotus]
gb|KHN18609.1|  hypothetical protein glysoja_007022                   69.7    9e-12   Glycine soja [wild soybean]
emb|CDP06279.1|  unnamed protein product                              68.9    1e-11   Coffea canephora [robusta coffee]
ref|XP_002531450.1|  conserved hypothetical protein                   69.3    1e-11   
ref|XP_011020364.1|  PREDICTED: uncharacterized protein LOC105122774  69.3    1e-11   Populus euphratica
ref|XP_004158821.1|  PREDICTED: uncharacterized protein LOC101225219  68.6    2e-11   
gb|ADR71309.1|  hypothetical protein 31                               68.6    2e-11   Hevea brasiliensis [jebe]
gb|KHN18312.1|  hypothetical protein glysoja_042632                   68.2    3e-11   Glycine soja [wild soybean]
ref|XP_004974402.1|  PREDICTED: uncharacterized protein DKFZp434B...  69.3    3e-11   Setaria italica
ref|XP_006381070.1|  hypothetical protein POPTR_0006s05970g           67.8    4e-11   
ref|XP_010541934.1|  PREDICTED: uncharacterized protein LOC104815293  67.0    8e-11   Tarenaya hassleriana [spider flower]
ref|XP_006588084.1|  PREDICTED: uncharacterized protein LOC102666822  68.6    9e-11   
ref|XP_008461151.1|  PREDICTED: uncharacterized protein LOC103499822  66.2    1e-10   Cucumis melo [Oriental melon]
ref|NP_001147376.1|  serine-rich protein                              67.4    1e-10   Zea mays [maize]
ref|XP_007023339.1|  Uncharacterized protein TCM_027325               65.5    3e-10   
ref|XP_009782553.1|  PREDICTED: uncharacterized protein LOC104231284  64.3    5e-10   Nicotiana sylvestris
gb|KJB23692.1|  hypothetical protein B456_004G110100                  64.7    5e-10   Gossypium raimondii
ref|XP_002324582.1|  hypothetical protein POPTR_0018s12400g           64.7    6e-10   
ref|XP_009792193.1|  PREDICTED: uncharacterized protein LOC104239287  64.7    9e-10   Nicotiana sylvestris
ref|XP_011073608.1|  PREDICTED: uncharacterized protein LOC105158524  63.9    9e-10   Sesamum indicum [beniseed]
ref|XP_008809760.1|  PREDICTED: uncharacterized protein LOC103721363  63.9    1e-09   
ref|NP_001152496.1|  serine-rich protein                              65.1    1e-09   
ref|XP_010323269.1|  PREDICTED: uncharacterized protein LOC104648150  63.5    1e-09   
ref|XP_008228767.1|  PREDICTED: uncharacterized protein LOC103328152  63.5    2e-09   Prunus mume [ume]
gb|EAZ41642.1|  hypothetical protein OsJ_26176                        64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008360803.1|  PREDICTED: putative protein TPRXL                64.7    2e-09   
ref|XP_007216798.1|  hypothetical protein PRUPE_ppa023541mg           63.2    3e-09   
ref|XP_006852816.1|  hypothetical protein AMTR_s00033p00172620        62.0    4e-09   
emb|CAN74150.1|  hypothetical protein VITISV_023981                   48.9    5e-09   Vitis vinifera
dbj|BAJ96323.1|  predicted protein                                    62.4    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007138467.1|  hypothetical protein PHAVU_009G211600g           62.0    6e-09   
ref|XP_009385099.1|  PREDICTED: uncharacterized protein LOC103972467  61.6    7e-09   
ref|XP_006465240.1|  PREDICTED: uncharacterized protein LOC102617517  62.0    7e-09   
ref|XP_006427503.1|  hypothetical protein CICLE_v10027369mg           61.6    9e-09   
gb|KJB64617.1|  hypothetical protein B456_010G057500                  61.2    9e-09   
ref|XP_003570325.1|  PREDICTED: uncharacterized protein LOC100836253  62.8    1e-08   
ref|XP_010050329.1|  PREDICTED: uncharacterized protein LOC104438870  60.1    3e-08   
ref|XP_008456582.1|  PREDICTED: putative protein TPRXL                60.5    3e-08   
ref|XP_004146739.1|  PREDICTED: uncharacterized protein LOC101204798  60.1    3e-08   
gb|KJB56576.1|  hypothetical protein B456_009G126000                  60.1    3e-08   
ref|XP_009397724.1|  PREDICTED: uncharacterized protein LOC103982505  62.4    4e-08   
ref|XP_004139264.1|  PREDICTED: uncharacterized protein LOC101209...  60.5    4e-08   
gb|EMT18951.1|  hypothetical protein F775_11958                       60.5    5e-08   
ref|XP_008377776.1|  PREDICTED: uncharacterized protein LOC103440850  58.9    5e-08   
ref|XP_008802029.1|  PREDICTED: uncharacterized protein LOC103715988  57.8    2e-07   
ref|XP_008443918.1|  PREDICTED: uncharacterized protein LOC103487396  57.0    4e-07   
gb|AFW64127.1|  hypothetical protein ZEAMMB73_142867                  56.6    5e-07   
ref|XP_010040345.1|  PREDICTED: uncharacterized protein LOC104429141  56.2    6e-07   
ref|XP_008679215.1|  PREDICTED: uncharacterized protein LOC103654170  55.8    2e-06   
gb|AAP12938.1|  hypothetical protein Os03g28100                       57.8    2e-06   
gb|ABF96447.1|  hypothetical protein LOC_Os03g28100                   57.8    3e-06   
ref|XP_004954249.1|  PREDICTED: uncharacterized protein LOC101761145  53.9    5e-06   
dbj|BAC99537.1|  hypothetical protein                                 55.8    9e-06   
ref|XP_008356661.1|  PREDICTED: uncharacterized protein LOC103420373  53.1    1e-05   
ref|NP_001147141.1|  serine-rich protein                              53.5    1e-05   
ref|XP_002454719.1|  hypothetical protein SORBIDRAFT_04g036170        53.5    1e-05   
gb|EEC75489.1|  hypothetical protein OsI_12085                        53.1    2e-05   
ref|XP_009362621.1|  PREDICTED: uncharacterized protein LOC103952691  51.6    3e-05   
ref|XP_004508408.1|  PREDICTED: uncharacterized protein LOC101509340  52.0    4e-05   
gb|EMS49515.1|  hypothetical protein TRIUR3_11808                     52.0    6e-05   
gb|AFW57202.1|  hypothetical protein ZEAMMB73_979990                  50.4    8e-05   
ref|XP_006448005.1|  hypothetical protein CICLE_v10017139mg           49.7    2e-04   
ref|XP_007160342.1|  hypothetical protein PHAVU_002G313700g           48.9    2e-04   
ref|XP_008646399.1|  PREDICTED: uncharacterized protein LOC103627864  49.3    2e-04   
gb|EMS46172.1|  hypothetical protein TRIUR3_29521                     50.8    4e-04   
ref|XP_009770895.1|  PREDICTED: uncharacterized protein LOC104221523  48.1    4e-04   



>ref|XP_009602281.1| PREDICTED: uncharacterized protein LOC104097433 [Nicotiana tomentosiformis]
Length=213

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LHGFA   PTPSV+FSIDRSISPHRS++VS RDQVVRKQ   NPL  LPK+TC+CSPT
Sbjct  70   VNLHGFAPLAPTPSVKFSIDRSISPHRSMAVSSRDQVVRKQN-NNPLTKLPKRTCMCSPT  128

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCSLHKNMN+ PS+  PS RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS
Sbjct  129  THPGSFRCSLHKNMNTAPSMYSPS-RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  187

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH QRRR DFQPRPSRLSRMSKAE+
Sbjct  188  SHHQRRRADFQPRPSRLSRMSKAED  212



>ref|XP_009800007.1| PREDICTED: uncharacterized protein LOC104245986 [Nicotiana sylvestris]
Length=213

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LHGFA   PTPSV+FSIDRSISPHRS++VS RDQVVRKQ   NPL  LPK+TC+CSPT
Sbjct  70   VNLHGFAPLAPTPSVKFSIDRSISPHRSMAVSSRDQVVRKQN-NNPLTKLPKRTCMCSPT  128

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCSLHKNMN+ PS+  PS RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS
Sbjct  129  THPGSFRCSLHKNMNTAPSMYSPS-RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  187

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH QRRR DFQPRPSRLSRMSKAE+
Sbjct  188  SHHQRRRADFQPRPSRLSRMSKAED  212



>ref|XP_006353669.1| PREDICTED: uncharacterized protein LOC102581215 [Solanum tuberosum]
Length=204

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 122/145 (84%), Gaps = 8/145 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LH  A    TPSVRFSIDRSISP RS++VS+RDQVVRKQ        +PK+TCLCSPT
Sbjct  67   VNLHALAPVNSTPSVRFSIDRSISPRRSMAVSQRDQVVRKQ--------IPKRTCLCSPT  118

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCS+HKN+ + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPS
Sbjct  119  THPGSFRCSMHKNVKNIPSISYSPSRLNARRSAMTNSLVRIWSVEGDLVKRALAALIRPS  178

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH QRRRGDFQPRPSRLSRMSKA+ 
Sbjct  179  SHHQRRRGDFQPRPSRLSRMSKADN  203



>ref|XP_010322724.1| PREDICTED: uncharacterized protein LOC101265245 [Solanum lycopersicum]
Length=204

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 8/145 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LH  A    +PSVRFSIDRSISP RS++VS+RDQVVRKQ        +PK+TCLCSPT
Sbjct  67   VNLHALAPVNSSPSVRFSIDRSISPRRSMAVSQRDQVVRKQ--------IPKRTCLCSPT  118

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCS+HKN+ + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPS
Sbjct  119  THPGSFRCSMHKNVKNTPSISYSPSRLNARRSAMTNSLVRICSVEGDLVKRALAALIRPS  178

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH QRRRGDFQPRPSRLSRMSKA+ 
Sbjct  179  SHHQRRRGDFQPRPSRLSRMSKADN  203



>ref|XP_009624814.1| PREDICTED: uncharacterized protein LOC104115808 [Nicotiana tomentosiformis]
 ref|XP_009624815.1| PREDICTED: uncharacterized protein LOC104115808 [Nicotiana tomentosiformis]
Length=194

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 118/142 (83%), Gaps = 8/142 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LH  A    TPSV+F IDRS SP RSV+VS+RDQVVRKQ        +PK+TCLCSPT
Sbjct  60   VNLHALAPVNSTPSVKFFIDRSSSPRRSVAVSQRDQVVRKQ--------IPKRTCLCSPT  111

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCS+HKNM + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPS
Sbjct  112  THPGSFRCSMHKNMRNTPSISYSPSRLNARRSAMTNSLVRIWSVEGDLVKRALAALIRPS  171

Query  328  SHQQRRRGDFQPRPSRLSRMSK  263
            SH QRRRGDFQPRPSRLSRMSK
Sbjct  172  SHHQRRRGDFQPRPSRLSRMSK  193



>ref|XP_010244875.1| PREDICTED: uncharacterized protein LOC104588581 [Nelumbo nucifera]
Length=210

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 6/146 (4%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCS  515
            V L+G A   P+PSVRFSI RSISP RS++VS R+QVV+KQ   NPL+  +  KKTC+CS
Sbjct  67   VNLYGPA--PPSPSVRFSIGRSISPSRSIAVSPRNQVVKKQS--NPLSGPSSQKKTCMCS  122

Query  514  PTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            PT+HPGSFRCSLHKN N+  ++SYPSNRLNARRSAMTNSLVRIGTVEGD VKRALAALIR
Sbjct  123  PTTHPGSFRCSLHKNFNNHHAVSYPSNRLNARRSAMTNSLVRIGTVEGDWVKRALAALIR  182

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAE  257
            PSSH QRRR  FQPRPSRLS MSKAE
Sbjct  183  PSSHHQRRRAAFQPRPSRLSFMSKAE  208



>ref|XP_010250328.1| PREDICTED: uncharacterized protein LOC104592576 [Nelumbo nucifera]
Length=207

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 7/147 (5%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCS  515
            V L+G  S    PSVRFS+DRSISP+RS++V+ R+QVVRK  + NPL+  +  K+TCLCS
Sbjct  65   VNLYG--SHPCAPSVRFSLDRSISPNRSIAVAPRNQVVRK--LSNPLSAPSSQKRTCLCS  120

Query  514  PTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            PTSHPGSFRCSLHKNMN++ ++SYPSNRLNARRSAMTNSLVRIGTVEG+ VKRALAALIR
Sbjct  121  PTSHPGSFRCSLHKNMNNQ-AVSYPSNRLNARRSAMTNSLVRIGTVEGEWVKRALAALIR  179

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  180  PSSHQQRRRAAFQPRPSRLSIMSKAED  206



>ref|XP_003633146.1| PREDICTED: putative protein TPRXL [Vitis vinifera]
Length=201

 Score =   176 bits (446),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCS  515
            V L+G A S+P  SVRFS+DR ISP RS+S + R QVV+K    NPL+  + PK++C+CS
Sbjct  59   VNLYGSAPSSP--SVRFSLDRPISPSRSISATPRTQVVKKHT--NPLSAPSTPKRSCMCS  114

Query  514  PTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            PT+HPGSFRCSLHK  N+  S  Y SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR
Sbjct  115  PTTHPGSFRCSLHKGFNNH-SAPYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  173

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  174  PSSHQQRRRSGFQPRPSRLSNMSKAED  200



>ref|XP_010648721.1| PREDICTED: uncharacterized protein LOC100266438 [Vitis vinifera]
Length=207

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 120/147 (82%), Gaps = 13/147 (9%)
 Frame = -1

Query  688  VELHGFASSTP-TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            V L+G   STP   SVRFSIDRSISP RS++V RRDQ+VRK        + PKK C+CSP
Sbjct  71   VNLYG---STPLASSVRFSIDRSISPSRSIAVPRRDQIVRK--------STPKKRCMCSP  119

Query  511  TSHPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            T+HPGSFRCSLHKN N S  +ISY SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR
Sbjct  120  TTHPGSFRCSLHKNFNNSSHTISYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  179

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  180  PSSHQQRRRAAFQPRPSRLSIMSKAED  206



>emb|CAN72752.1| hypothetical protein VITISV_030561 [Vitis vinifera]
Length=269

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 120/147 (82%), Gaps = 13/147 (9%)
 Frame = -1

Query  688  VELHGFASSTP-TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            V L+G   STP   SVRFSIDRSISP RS++V RRDQ+VRK        + PKK C+CSP
Sbjct  71   VNLYG---STPLASSVRFSIDRSISPSRSIAVPRRDQIVRK--------STPKKRCMCSP  119

Query  511  TSHPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            T+HPGSFRCSLHKN N S  +ISY SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR
Sbjct  120  TTHPGSFRCSLHKNFNNSSHTISYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  179

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  180  PSSHQQRRRAAFQPRPSRLSIMSKAED  206



>gb|AFK41588.1| unknown [Medicago truncatula]
 gb|KEH32154.1| plant/F18G18-20 protein [Medicago truncatula]
Length=203

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 113/146 (77%), Gaps = 9/146 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT
Sbjct  65   VSLYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPT  116

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRP
Sbjct  117  THPGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRP  176

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQ+RRGDF PRPSRLS M+KA++
Sbjct  177  SSHQQKRRGDFHPRPSRLSVMTKAQD  202



>gb|ACJ83954.1| unknown [Medicago truncatula]
Length=203

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 113/146 (77%), Gaps = 9/146 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT
Sbjct  65   VSLYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPT  116

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRP
Sbjct  117  THPGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRP  176

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQ+RRGDF P+PSRLS M+KA++
Sbjct  177  SSHQQKRRGDFHPKPSRLSVMTKAQD  202



>gb|AFK45204.1| unknown [Medicago truncatula]
Length=202

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 9/146 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT
Sbjct  64   VSLYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPT  115

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR +++ Y  NR NARRSAMTNSLVRI  VEGDLVKRALAALIRP
Sbjct  116  THPGSFRCSLHKGFGSRAAVTPYSQNRFNARRSAMTNSLVRIRGVEGDLVKRALAALIRP  175

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQ+RRGDF PRPSRLS M+KA++
Sbjct  176  SSHQQKRRGDFHPRPSRLSVMTKAQD  201



>ref|XP_009387687.1| PREDICTED: uncharacterized protein LOC103974562 [Musa acuminata 
subsp. malaccensis]
Length=193

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 108/153 (71%), Gaps = 27/153 (18%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK-------  530
            V L G A  TP P VRF+IDRS SP                  G  LA   K+       
Sbjct  59   VHLLGTAY-TPAPGVRFTIDRSTSP------------------GRSLATANKRSSASVHR  99

Query  529  TCLCSPTSHPGSFRCSLHKNMNSR-PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  353
            TCLCSPT+HPGSFRCSLHK ++SR  ++S PSN LNARRSAMTNSLVRIGTVEGD VKRA
Sbjct  100  TCLCSPTTHPGSFRCSLHKGLSSRSAAVSAPSNCLNARRSAMTNSLVRIGTVEGDWVKRA  159

Query  352  LAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            LAALIRPSSHQQRRR DFQPRPSRLSRMSKA++
Sbjct  160  LAALIRPSSHQQRRRVDFQPRPSRLSRMSKADD  192



>gb|ACJ84160.1| unknown [Medicago truncatula]
Length=202

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 9/146 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+ C+CSPT
Sbjct  64   VSLYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRICMCSPT  115

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRP
Sbjct  116  THPGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRP  175

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQ+RRGDF PRPSRLS M+KA++
Sbjct  176  SSHQQKRRGDFHPRPSRLSVMTKAQD  201



>gb|ACJ86153.1| unknown [Medicago truncatula]
Length=203

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 9/146 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT
Sbjct  65   VSLYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPT  116

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLV I  VEGDLVKRALAALIRP
Sbjct  117  THPGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVGIRGVEGDLVKRALAALIRP  176

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQ+RRGDF PRPSRLS M+KA++
Sbjct  177  SSHQQKRRGDFHPRPSRLSVMTKAQD  202



>ref|XP_004508409.1| PREDICTED: putative protein TPRXL-like [Cicer arietinum]
Length=201

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 113/146 (77%), Gaps = 7/146 (5%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G + S    SVRFS+DRSISP+RS+SV+       + G     ++  K+TC+CSPT
Sbjct  61   VSLYGSSPSVSASSVRFSLDRSISPNRSISVTP------RTGGKKQSSSQQKRTCMCSPT  114

Query  508  SHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRCSLHK   SR S + Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRP
Sbjct  115  THPGSFRCSLHKGFGSRASTTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRP  174

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQRRRGDF+PRPSRLS MSKAE+
Sbjct  175  SSHQQRRRGDFRPRPSRLSVMSKAED  200



>ref|XP_009355793.1| PREDICTED: uncharacterized protein LOC103946738 [Pyrus x bretschneideri]
Length=226

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 8/142 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPG
Sbjct  91   YTSSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPG  144

Query  496  SFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            SFRCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQ
Sbjct  145  SFRCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQ  204

Query  319  QRRRGDFQPRPSRLSRMSKAEE  254
            QRRR  FQPRPSRLS MS A+E
Sbjct  205  QRRRAGFQPRPSRLSVMSTAQE  226



>ref|XP_008394152.1| PREDICTED: dual specificity tyrosine-phosphorylation-regulated 
kinase 1A-like [Malus domestica]
Length=224

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 109/142 (77%), Gaps = 8/142 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPG
Sbjct  89   YTSSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KSG---PIS-MPKKTCMCSPTSHPG  142

Query  496  SFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            SFRCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQ
Sbjct  143  SFRCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQ  202

Query  319  QRRRGDFQPRPSRLSRMSKAEE  254
            QRRR  FQPRPSRLS MS A +
Sbjct  203  QRRRAGFQPRPSRLSVMSTAHD  224



>ref|XP_007155099.1| hypothetical protein PHAVU_003G173100g [Phaseolus vulgaris]
 gb|ESW27093.1| hypothetical protein PHAVU_003G173100g [Phaseolus vulgaris]
Length=196

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 107/137 (78%), Gaps = 10/137 (7%)
 Frame = -1

Query  664  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  485
            S+  PSVRFS+DRS+SP+RS++ +       +QG   P  + PK+TC+CSPT+HPGSFRC
Sbjct  69   SSAAPSVRFSLDRSVSPNRSIAAAS------RQGSIKP--HQPKRTCMCSPTTHPGSFRC  120

Query  484  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  305
            SLHK   S     Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQ+RRG
Sbjct  121  SLHKK--SHAPAPYSPNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQKRRG  178

Query  304  DFQPRPSRLSRMSKAEE  254
            DF PRPSRLS M+KAE+
Sbjct  179  DFHPRPSRLSVMTKAED  195



>ref|XP_007013641.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY31260.1| Serine-rich protein-related [Theobroma cacao]
Length=206

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            SVRFS+D R ISP+RS++  RR+     + + N  +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  75   SVRFSLDNRPISPNRSITTVRRNT----EALKNLQSKQPKRTCMCSPTTHPGSFRCSLHK  130

Query  472  NMNSRPSI-SY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
              NS  ++ SY PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F
Sbjct  131  GFNSSHAVTSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAF  190

Query  298  QPRPSRLSRMSKAEE  254
            QPRPSRLS MSKAE+
Sbjct  191  QPRPSRLSLMSKAED  205



>ref|XP_003542665.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Glycine max]
Length=204

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -1

Query  652  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            PSVRFS+DRS+SP+RS+SV+ R  V R+ G   P  +  K+TC+CSPT+HPGSFRCSLHK
Sbjct  73   PSVRFSLDRSVSPNRSISVAPRTGVSRQSG--GPHHHQQKRTCMCSPTTHPGSFRCSLHK  130

Query  472  NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  293
              ++     Y  +RLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQRRRGDF P
Sbjct  131  KSHAPAPAPYSPHRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQRRRGDFHP  190

Query  292  RPSRLSRMSKAEE  254
            RPSRLS MSKAE+
Sbjct  191  RPSRLSVMSKAED  203



>gb|EPS66288.1| hypothetical protein M569_08491 [Genlisea aurea]
Length=214

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 106/144 (74%), Gaps = 12/144 (8%)
 Frame = -1

Query  658  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            PT SVRFSIDRSISP RS++       V ++  G   +++ K+TCLCSPT+HPGSFRCSL
Sbjct  70   PTSSVRFSIDRSISPSRSIAAPPPRNPVIQRSCG---SSIQKRTCLCSPTTHPGSFRCSL  126

Query  478  HKNMNS---------RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            H+N              SI Y  NRLN RRSAMTNSLVRIGTVEGDLVKRALAALI PSS
Sbjct  127  HRNSYGSSSGGGRGGEQSIPYSPNRLNMRRSAMTNSLVRIGTVEGDLVKRALAALIHPSS  186

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQQRRR DFQ RPSRLS MSKA+E
Sbjct  187  HQQRRRVDFQARPSRLSVMSKADE  210



>ref|XP_004139263.1| PREDICTED: uncharacterized protein LOC101209679 isoform 1 [Cucumis 
sativus]
 ref|XP_004159410.1| PREDICTED: uncharacterized protein LOC101229451 isoform 1 [Cucumis 
sativus]
 gb|KGN60756.1| hypothetical protein Csa_2G009440 [Cucumis sativus]
Length=202

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LHG + S   PSVRFS+DR+ SP+RSVSVS        + V    +   K+TC+CSPT
Sbjct  58   VNLHG-SPSVSVPSVRFSLDRATSPNRSVSVSSSRSGGTNRVVQRQSST--KRTCMCSPT  114

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCSLHK + S+P   Y  +RLNARRSAMTNSLVRIG VEGDLVKRALAALIRPS
Sbjct  115  THPGSFRCSLHKGIISQPPALYSPSRLNARRSAMTNSLVRIGGVEGDLVKRALAALIRPS  174

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR DF+P+ SRLS MSKA+E
Sbjct  175  SHQQRRRVDFRPKRSRLSIMSKADE  199



>ref|XP_007202593.1| hypothetical protein PRUPE_ppa011611mg [Prunus persica]
 gb|EMJ03792.1| hypothetical protein PRUPE_ppa011611mg [Prunus persica]
Length=203

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = -1

Query  676  GFASSTPTP-SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  500
              ASS+P+  SVRFS+DR ISP RS+SV+          V +   +  K+TC+CSPT+HP
Sbjct  60   NLASSSPSAQSVRFSLDRPISPSRSISVTPHGNSNHHNAVKSRQISNQKRTCMCSPTNHP  119

Query  499  GSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            GSFRCSLHKN +S  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSS
Sbjct  120  GSFRCSLHKNFSSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSS  179

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            H QRRR DF+PRPSRLS MSK+ E
Sbjct  180  HSQRRRADFRPRPSRLSTMSKSHE  203



>ref|XP_007226111.1| hypothetical protein PRUPE_ppa011080mg [Prunus persica]
 gb|EMJ27310.1| hypothetical protein PRUPE_ppa011080mg [Prunus persica]
Length=224

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 109/145 (75%), Gaps = 15/145 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS P+PSVRFSID RSISP+ S       +   K G   P++ +PKKTC+CSPTSHPG
Sbjct  90   YTSSAPSPSVRFSIDHRSISPNHSNRSITVSK---KNG---PIS-MPKKTCMCSPTSHPG  142

Query  496  SFRCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN+    N+ P   YP+NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP 
Sbjct  143  SFRCSLHKNIGGGHNAAP---YPTNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPC  199

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            +HQQRRR  FQPRPSRLS MS A++
Sbjct  200  AHQQRRRAGFQPRPSRLSAMSTADK  224



>gb|KJB64619.1| hypothetical protein B456_010G057600 [Gossypium raimondii]
Length=205

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 110/143 (77%), Gaps = 7/143 (5%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            +  S+  PSVRFS+D R ISP+RS++  R++       V N      K+TC+CSPT+HPG
Sbjct  66   YNHSSSAPSVRFSLDNRPISPNRSIATIRKNT----DAVQNLEKRQQKRTCMCSPTTHPG  121

Query  496  SFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            SFRCSLHK  N+  ++S   PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSH
Sbjct  122  SFRCSLHKGFNNSNAVSSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSH  181

Query  322  QQRRRGDFQPRPSRLSRMSKAEE  254
            QQRRR  FQPRPSRLS MSKAE+
Sbjct  182  QQRRRSAFQPRPSRLSVMSKAED  204



>ref|XP_009393722.1| PREDICTED: uncharacterized protein LOC103979335 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 110/145 (76%), Gaps = 9/145 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L G A S  TP+VRFS+DRS SP RS++ + +       G   P+    ++TCLC+PT
Sbjct  58   VHLVGAAPSQ-TPAVRFSLDRSTSPGRSLAAADKRSPSTTAG---PV----RRTCLCAPT  109

Query  508  SHPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRC LHK ++    ++S PSNRLNARRSAMTNSLVRIG VEG+ VKRALAALIRP
Sbjct  110  NHPGSFRCRLHKGLHIHHAAVSSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALAALIRP  169

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAE  257
            SSHQQRRR DF PRPSRLSRMSKA+
Sbjct  170  SSHQQRRRADFHPRPSRLSRMSKAD  194



>gb|AGV54226.1| hypothetical protein [Phaseolus vulgaris]
Length=228

 Score =   161 bits (408),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 112/156 (72%), Gaps = 16/156 (10%)
 Frame = -1

Query  664  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  485
            S+  PSVRFS+DRS+SP+RS++ +       +QG   P  + PK+TC+CSPT+HPGSFRC
Sbjct  69   SSAAPSVRFSLDRSVSPNRSIAAAS------RQGSIKP-HHQPKRTCMCSPTTHPGSFRC  121

Query  484  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  305
            SLHK   S     Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQ+RRG
Sbjct  122  SLHKK--SHAPAPYSPNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQKRRG  179

Query  304  DFQPRPSRLSRMSKAEEDl*vlll*VCIDYSVWIPA  197
            DF PRPSRLS M+KAE              ++W+P+
Sbjct  180  DFHPRPSRLSVMTKAERGPLN-------STTLWLPS  208



>ref|XP_009362322.1| PREDICTED: uncharacterized protein JIP4-like [Pyrus x bretschneideri]
Length=226

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 8/141 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPG
Sbjct  91   YTSSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPG  144

Query  496  SFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            SFRCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRP +HQ
Sbjct  145  SFRCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPCAHQ  204

Query  319  QRRRGDFQPRPSRLSRMSKAE  257
            QRRR  FQPRPSRLS MS A 
Sbjct  205  QRRRAGFQPRPSRLSAMSTAH  225



>gb|KJB53963.1| hypothetical protein B456_009G013700 [Gossypium raimondii]
Length=205

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 108/135 (80%), Gaps = 7/135 (5%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            SVRFS+D R ISP+RS+S  RR+     + + N  +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  75   SVRFSLDSRPISPNRSISAVRRNT----EALRNLQSKQPKRTCMCSPTTHPGSFRCSLHK  130

Query  472  NMN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
              N S  S  Y PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F
Sbjct  131  GFNNSHASSGYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAF  190

Query  298  QPRPSRLSRMSKAEE  254
            QPRPSRLS MSKAE+
Sbjct  191  QPRPSRLSVMSKAED  205



>ref|XP_008219542.1| PREDICTED: putative protein TPRXL [Prunus mume]
Length=225

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS P+PSVRFSID RSISP+ S       +   K G   P++ +PKKTC+CSPTSHPG
Sbjct  90   YTSSAPSPSVRFSIDHRSISPNHSNRSITVSK---KNG---PIS-MPKKTCMCSPTSHPG  142

Query  496  SFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            SFRCSLHKN+    + + YP+NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQ
Sbjct  143  SFRCSLHKNVGGGHNAAPYPTNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQ  202

Query  319  QRRRGDFQPRPSRLSRMSKAEE  254
            QRRR  FQPRPSRLS MS  ++
Sbjct  203  QRRRAGFQPRPSRLSAMSTTDD  224



>ref|XP_008242917.1| PREDICTED: putative protein TPRXL [Prunus mume]
Length=203

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = -1

Query  667  SSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  488
            SS+   SVRFS+DR ISP RS+SV+          V +   +  K+TC+CSPT+HPGSFR
Sbjct  64   SSSSAQSVRFSLDRPISPSRSISVTPHGNGNHHNAVKSRQISNQKRTCMCSPTNHPGSFR  123

Query  487  CSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
            CSLHKN +S  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH QR
Sbjct  124  CSLHKNFSSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHSQR  183

Query  313  RRGDFQPRPSRLSRMSKAEE  254
            RR DF+PRPSRLS MSK+ E
Sbjct  184  RRADFRPRPSRLSTMSKSHE  203



>ref|XP_003544605.1| PREDICTED: uncharacterized protein LOC100814735 [Glycine max]
Length=196

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 8/137 (6%)
 Frame = -1

Query  658  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            P+ SVRF++DRSISP+RS  ++       ++   +      KKTC+CSPT+HPGSFRCSL
Sbjct  66   PSHSVRFALDRSISPNRSHVIA-------RKHQHHRHVTAQKKTCMCSPTTHPGSFRCSL  118

Query  478  HKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            HKN N      S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  
Sbjct  119  HKNNNQNAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSA  178

Query  301  FQPRPSRLSRMSKAEED  251
            F+PRPSRLS MSKAEE+
Sbjct  179  FEPRPSRLSIMSKAEEE  195



>ref|XP_009769290.1| PREDICTED: uncharacterized protein LOC104220170 [Nicotiana sylvestris]
Length=203

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+   SS+P  SVRFS+DRS SP RS+S   R+ VV+ +   +  +++ KKTC+CSPT
Sbjct  56   VNLYSSRSSSPASSVRFSLDRSTSPSRSISALNRNHVVQNRSYKSLPSSVQKKTCMCSPT  115

Query  508  SHPGSFRCSLHKNMNSRPSISYPS---NRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            +HPGSFRCSLHKN+ +  S + PS   N+L+ RRSAMTNSLVRIGTVEGDLVKRALAALI
Sbjct  116  NHPGSFRCSLHKNIAASGSRA-PSCNPNQLHMRRSAMTNSLVRIGTVEGDLVKRALAALI  174

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSSHQQRRRGDFQ RPSRLS MSKAE+
Sbjct  175  RPSSHQQRRRGDFQHRPSRLSVMSKAED  202



>emb|CDP18810.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 111/154 (72%), Gaps = 16/154 (10%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsr----rdqvvRKQGVGNPLANLPKKTCL  521
            V LH  A  +PTPSVR SIDRSISP RSV++S       QVVRKQ          K+TCL
Sbjct  67   VNLHRLAPISPTPSVRMSIDRSISPRRSVAMSSPRDHHHQVVRKQSSC-------KRTCL  119

Query  520  CSPTSHPGSFRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            CSPTSHPGSFRCSLHKN+N+ P     S SY    L  +RSAM NSLVRIGTVEGDLVKR
Sbjct  120  CSPTSHPGSFRCSLHKNLNNAPPPQQQSPSYSLKNLTIQRSAMKNSLVRIGTVEGDLVKR  179

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALAALIRPSSHQ RRR DFQ RPSRLS MSKA +
Sbjct  180  ALAALIRPSSHQIRRRSDFQRRPSRLSAMSKAGD  213



>gb|EYU20232.1| hypothetical protein MIMGU_mgv1a018309mg [Erythranthe guttata]
Length=221

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LH  +   P+PSVRFSIDRSISP RS++ + R+QVV+++G  N   N+ K+TCLCSP+
Sbjct  78   VNLHALSPPPPSPSVRFSIDRSISPRRSIAATPRNQVVQRKGGNN---NIQKRTCLCSPS  134

Query  508  SHPGSFRCSLHKNMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            +HPGSFRC+LHK+       ++   NRLN RRSAMTNSLVRIGTVEGDLVKRALA+LIRP
Sbjct  135  THPGSFRCALHKSSFGGVGGNHSVPNRLNMRRSAMTNSLVRIGTVEGDLVKRALASLIRP  194

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQQRRR +F+ RPSRLS M+KAE+
Sbjct  195  SSHQQRRRVNFRARPSRLSVMTKAED  220



>ref|XP_009403190.1| PREDICTED: uncharacterized protein LOC103986811 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            A+  PTPSVR S DRS SP       R      K+ V    A   ++TCLCSP++HPGSF
Sbjct  65   AAHPPTPSVRLSFDRSTSP------GRSLAAPDKRSVAPAAAPA-RRTCLCSPSTHPGSF  117

Query  490  RCSLHKNMN----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            RCSLHK +N       + S PSNRLNARRSAMTNSLVRIG VEG+ VKRALAALIRPSSH
Sbjct  118  RCSLHKGLNLHHHGHVAASSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALAALIRPSSH  177

Query  322  QQRRRGDFQPRPSRLSRMSKAEE  254
            QQRRR  FQPRPSRLSRMSKA++
Sbjct  178  QQRRRAGFQPRPSRLSRMSKADD  200



>ref|XP_008802034.1| PREDICTED: uncharacterized protein LOC103715996, partial [Phoenix 
dactylifera]
Length=199

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = -1

Query  652  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP----KKTCLCSPTSHPGSFRC  485
            PSVRFSIDR  SP    S++   Q    Q V  P+ +      +KTC+CSPT+HPGSFRC
Sbjct  64   PSVRFSIDRPTSP--GRSLAVDRQHQHHQAVRQPIPSASGGGQRKTCMCSPTTHPGSFRC  121

Query  484  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  305
            SLHK      ++S  SNRLNARRSAMTNSLVRIGTVEG+ V+RALAALIRPSSHQQRRR 
Sbjct  122  SLHKGFGHNHAVSSSSNRLNARRSAMTNSLVRIGTVEGEWVRRALAALIRPSSHQQRRRE  181

Query  304  DFQPRPSRLSRMSKA  260
             FQPRPSRLS MSKA
Sbjct  182  AFQPRPSRLSIMSKA  196



>ref|XP_004146710.1| PREDICTED: uncharacterized protein LOC101217053 isoform 1 [Cucumis 
sativus]
 ref|XP_004146711.1| PREDICTED: uncharacterized protein LOC101217053 isoform 2 [Cucumis 
sativus]
 ref|XP_004165350.1| PREDICTED: uncharacterized protein LOC101229924 isoform 1 [Cucumis 
sativus]
 ref|XP_004165351.1| PREDICTED: uncharacterized protein LOC101229924 isoform 2 [Cucumis 
sativus]
 gb|KGN65199.1| hypothetical protein Csa_1G264020 [Cucumis sativus]
Length=203

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            VRFS+DRSISP+R +SV  R      Q V     +  K+TC+CSPT+HPGSFRCSLHK +
Sbjct  75   VRFSLDRSISPNRPISVLSRASGN-HQVVKK--QSQQKRTCMCSPTTHPGSFRCSLHKGV  131

Query  466  NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRP  287
             S+PS  Y SNRLNARRSAMTNSLVRIG VEGD+++RALA+LIRPSSH QRRR DF PRP
Sbjct  132  QSQPSTPYSSNRLNARRSAMTNSLVRIGGVEGDILRRALASLIRPSSHSQRRRVDFCPRP  191

Query  286  SRLSRMSKAEE  254
            SRLS MSKA++
Sbjct  192  SRLSIMSKADD  202



>ref|XP_010533108.1| PREDICTED: uncharacterized protein LOC104808950 [Tarenaya hassleriana]
Length=214

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            +VRFSIDR  SP RS+S          Q V N + +  K+TC+CSPT+HPGSFRCSLHK 
Sbjct  76   TVRFSIDRPTSPGRSISAVGHSPRTAGQIVRNQIPSQQKRTCMCSPTNHPGSFRCSLHKA  135

Query  469  MNSR----PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
              +R    PS   P+NRL+ARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQRRR D
Sbjct  136  AAARGSHAPSSYSPNNRLHARRSAMTNSLVRICGVEGDLVKRALAALIRPSSHQQRRRAD  195

Query  301  FQPRPSRLSRMSKAEE  254
            F+PR SRLS MSKA+E
Sbjct  196  FRPRQSRLSVMSKADE  211



>ref|XP_008366660.1| PREDICTED: putative protein TPRXL [Malus domestica]
Length=225

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 106/141 (75%), Gaps = 8/141 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS+P+  VRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPG
Sbjct  90   YTSSSPSRYVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPG  143

Query  496  SFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            SFRCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRP +HQ
Sbjct  144  SFRCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPCAHQ  203

Query  319  QRRRGDFQPRPSRLSRMSKAE  257
            QRRR  FQPRPSRLS MS A+
Sbjct  204  QRRRAGFQPRPSRLSAMSTAD  224



>ref|XP_010913363.1| PREDICTED: uncharacterized protein LOC105039072 [Elaeis guineensis]
Length=218

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 108/143 (76%), Gaps = 9/143 (6%)
 Frame = -1

Query  658  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP----KKTCLCSPTSHPGSF  491
            P PSVRFSIDR  SP RS++V R+ Q    Q V  P+ + P    +KTC+CSPT+HPGSF
Sbjct  74   PKPSVRFSIDRPTSPGRSLAVERQHQQQHHQAVRQPIPSAPGGGKRKTCMCSPTTHPGSF  133

Query  490  RCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            RC+LHK   +       ++S PS RLNARRSAMTNSLVRIGTVEG+ ++RALAALIRPSS
Sbjct  134  RCNLHKGFAAHGGGHNHAVSSPSYRLNARRSAMTNSLVRIGTVEGEWLRRALAALIRPSS  193

Query  325  HQQRRRGDFQPRPSRLSRMSKAE  257
            HQQRRR  FQPRPSRLS MSKA+
Sbjct  194  HQQRRRAAFQPRPSRLSIMSKAD  216



>emb|CDP10497.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 108/146 (74%), Gaps = 15/146 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            ++S+    +VRFS+DR ISP+RS+S+  +   V ++          K+TC+CSPT+HPGS
Sbjct  69   YSSAPSAATVRFSLDRPISPNRSISMVNKKNQVVQKS--------QKRTCMCSPTNHPGS  120

Query  493  FRCSLHKNMNSRPSIS-------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            FRCSLHK++    S S       Y +NRLN RRSAMTNSLVRIGTVEGDLVKRALAALIR
Sbjct  121  FRCSLHKSIGHSSSSSSHTQTAPYNANRLNMRRSAMTNSLVRIGTVEGDLVKRALAALIR  180

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAE  257
            PSSH QRRRGDF PRPSRLS MSKAE
Sbjct  181  PSSHHQRRRGDFHPRPSRLSAMSKAE  206



>ref|XP_008443919.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
 ref|XP_008443920.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
Length=203

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 11/135 (8%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGN----PLANLPKKTCLCSPTSHPGSFRCSL  479
            VRFS+DRSISP+R +SV         +  GN       +  K+TC+CSPT+HPGSFRCSL
Sbjct  75   VRFSLDRSISPNRPISVLS-------RATGNHQVVKKQSHQKRTCMCSPTTHPGSFRCSL  127

Query  478  HKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            HK + S PS  Y SNRLNARRSAMTNSLVRIG VEGD+++RALA+LIRPSSH QRRR DF
Sbjct  128  HKGVQSHPSTPYSSNRLNARRSAMTNSLVRIGGVEGDILRRALASLIRPSSHSQRRRVDF  187

Query  298  QPRPSRLSRMSKAEE  254
             PRPSRLS MSKA++
Sbjct  188  CPRPSRLSIMSKADD  202



>ref|XP_002324885.1| hypothetical protein POPTR_0018s02140g [Populus trichocarpa]
 gb|EEF03450.1| hypothetical protein POPTR_0018s02140g [Populus trichocarpa]
Length=208

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 117/160 (73%), Gaps = 15/160 (9%)
 Frame = -1

Query  718  DNIQQGVXFAVELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL  539
             N  Q       ++ +++ST +PS RFSIDRSISP+RS+SVS       K+   +P++  
Sbjct  58   QNSHQRSASPTRVNLYSTSTLSPSFRFSIDRSISPNRSISVS-------KKNHSHPIS-A  109

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS----NRLNARRSAMTNSLVRIGTVEG  371
            PK+TC+CSPT+H GSFRCSLHKN    PS + P+    NRLN RRSAMTNSLVRIG VEG
Sbjct  110  PKRTCMCSPTTHRGSFRCSLHKNT---PSSANPAPFTPNRLNMRRSAMTNSLVRIGGVEG  166

Query  370  DLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            + VKRAL ALIRPSSHQQRRRG FQPRPSRLS +S A+++
Sbjct  167  EWVKRALTALIRPSSHQQRRRGAFQPRPSRLSIISNADDE  206



>ref|XP_009622884.1| PREDICTED: uncharacterized protein LOC104114205 isoform X1 [Nicotiana 
tomentosiformis]
Length=203

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+   SS+P  SVRFS+DRS SP RS+S   R+ VV+ +   +  ++  KKTC+CSPT
Sbjct  56   VNLYSSRSSSPASSVRFSLDRSTSPSRSISALNRNHVVQNRSYKSLPSSGQKKTCMCSPT  115

Query  508  SHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            +HPGSFRCSLHKN+   +SR     P N+L+ RRSAMTNSLVRIGTVEGDLVKRALAALI
Sbjct  116  NHPGSFRCSLHKNIVASSSRAPSCNP-NQLHMRRSAMTNSLVRIGTVEGDLVKRALAALI  174

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSSHQQRRRGDFQ RPSRLS MSK E+
Sbjct  175  RPSSHQQRRRGDFQHRPSRLSVMSKVED  202



>gb|AFK42940.1| unknown [Lotus japonicus]
Length=189

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 15/139 (11%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA-----NLPKKTCLCSPTSHPGSFRC  485
            S+RFS+DRS+SP+RS+SV+         G G   A     N  K+TC+C+PTSHPGSFRC
Sbjct  57   SLRFSLDRSVSPNRSISVA---------GTGAVPAVTRKNNQQKRTCMCAPTSHPGSFRC  107

Query  484  SLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  308
            SLHK+  SR   + Y  NRLNARRSAMTNSLVRI  VEG+LVK+ALAALIRPSSHQQRRR
Sbjct  108  SLHKSSGSRVVAAPYSPNRLNARRSAMTNSLVRIRGVEGELVKKALAALIRPSSHQQRRR  167

Query  307  GDFQPRPSRLSRMSKAEED  251
            G+F+PRPSRL+ MSKAE +
Sbjct  168  GEFRPRPSRLAAMSKAEGE  186



>gb|KJB23691.1| hypothetical protein B456_004G110000 [Gossypium raimondii]
Length=208

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 104/134 (78%), Gaps = 7/134 (5%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            VRFS+D R ISP+RS++  RR      + + N  +   K+TC+CSPT+HPGSFRCSLHK+
Sbjct  78   VRFSLDNRPISPNRSITTVRRTT----EALKNLQSKQTKRTCMCSPTTHPGSFRCSLHKS  133

Query  469  MN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  296
             N S P   Y PSNRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSHQQRRR  F 
Sbjct  134  FNTSHPGTGYAPSNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHQQRRREAFH  193

Query  295  PRPSRLSRMSKAEE  254
            PRPSRLS MSKAE 
Sbjct  194  PRPSRLSVMSKAEN  207



>ref|XP_010047203.1| PREDICTED: homeobox protein Nkx-6.1-like [Eucalyptus grandis]
 gb|KCW79031.1| hypothetical protein EUGRSUZ_C00453 [Eucalyptus grandis]
Length=217

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 112/155 (72%), Gaps = 15/155 (10%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvR-------KQGVGNPLANLPKK  530
            V LH  A   P+PS+RF++DR  SP RS+SVS++ +          + G   P    P++
Sbjct  67   VNLHSPA--QPSPSIRFALDRPTSPSRSISVSQQQRRGGTGGGQLVRSGGQKPA---PRR  121

Query  529  TCLCSPTSHPGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            TC+CSPT+HPGSFRCSLHK   S PS S  Y  NRLNARRSAMTNSLVRIG VEGDLVKR
Sbjct  122  TCMCSPTNHPGSFRCSLHKGCGS-PSASAGYAPNRLNARRSAMTNSLVRIGGVEGDLVKR  180

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            ALAALIRPSSHQQRRR  FQPR SRLS MSKA E+
Sbjct  181  ALAALIRPSSHQQRRRAAFQPRQSRLSIMSKAAEE  215



>ref|XP_003550193.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=204

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            A+  P+ SVRF++DRSISP+R+VS     +               KK+C+CSPT+HPGSF
Sbjct  69   AAPLPSHSVRFALDRSISPNRTVSSHVIAKHRH--------VTAQKKSCMCSPTTHPGSF  120

Query  490  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  311
            RCSLHKN +S  + S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRR
Sbjct  121  RCSLHKNSHSAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRR  180

Query  310  RGDFQPRPSRLSRMSKAEED  251
            R  F+PR SRLS MSKA+++
Sbjct  181  RTAFEPRQSRLSIMSKADDE  200



>gb|KHN48540.1| hypothetical protein glysoja_041593 [Glycine soja]
Length=205

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            A+  P+ SVRF++DRSISP+R+VS     +               KK+C+CSPT+HPGSF
Sbjct  70   AAPLPSHSVRFALDRSISPNRTVSSHVIAKHRH--------VTAQKKSCMCSPTTHPGSF  121

Query  490  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  311
            RCSLHKN +S  + S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRR
Sbjct  122  RCSLHKNSHSAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRR  181

Query  310  RGDFQPRPSRLSRMSKAEED  251
            R  F+PR SRLS MSKA+++
Sbjct  182  RTAFEPRQSRLSIMSKADDE  201



>ref|XP_011036619.1| PREDICTED: putative protein TPRXL [Populus euphratica]
Length=209

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 117/164 (71%), Gaps = 16/164 (10%)
 Frame = -1

Query  727  TGGDNIQQGVXFAVELHGFASSTP-TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNP  551
            T   N  Q       ++ +++S P +PS RFSIDRSISP+RS+SVS       K+   +P
Sbjct  55   TFFQNSHQRSASPTRVNLYSTSPPLSPSFRFSIDRSISPNRSISVS-------KKNHSHP  107

Query  550  LANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS----NRLNARRSAMTNSLVRIG  383
            ++  PK+TC+CSPT+H GSFRCSLHKN    PS + P+    NRLN RRSAMTNSLVRIG
Sbjct  108  IS-APKRTCMCSPTTHRGSFRCSLHKNT---PSSTNPAPFTPNRLNMRRSAMTNSLVRIG  163

Query  382  TVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
             VEG+ VKRAL ALIRPSSHQ RRRG FQPRPSRLS MS A++D
Sbjct  164  GVEGEWVKRALTALIRPSSHQLRRRGAFQPRPSRLSIMSNADDD  207



>ref|XP_007136989.1| hypothetical protein PHAVU_009G090900g [Phaseolus vulgaris]
 gb|ESW08983.1| hypothetical protein PHAVU_009G090900g [Phaseolus vulgaris]
Length=220

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 106/143 (74%), Gaps = 10/143 (7%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            ++ + P+ +VRFSID RSISP+RS+S     +        N   +  KKTC+CSPTSHPG
Sbjct  84   YSPAPPSSAVRFSIDPRSISPNRSISNQIITK-------NNRPISAHKKTCMCSPTSHPG  136

Query  496  SFRCSLHKNM--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            SFRCSLHKN   N   + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSH
Sbjct  137  SFRCSLHKNAGNNHHHADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSH  196

Query  322  QQRRRGDFQPRPSRLSRMSKAEE  254
            QQRRR  F+PRPSRLS MSKA++
Sbjct  197  QQRRRAAFEPRPSRLSVMSKAQD  219



>ref|XP_003522528.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=218

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            VRFSID RSISP+RS+S         +   G       KKTC+CSPT HPGSFRCSLHKN
Sbjct  90   VRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTMHPGSFRCSLHKN  143

Query  469  M--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  296
            +  N+  S SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+
Sbjct  144  IGNNNHHSDSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGFE  203

Query  295  PRPSRLSRMSKAEE  254
            PRPSRLS MSKA++
Sbjct  204  PRPSRLSVMSKAQD  217



>ref|XP_006359514.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Solanum 
tuberosum]
Length=206

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 111/151 (74%), Gaps = 14/151 (9%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+   SS+P  SVRFS+DRS SP RS+S   R+ VV+ +          KK+C+CSPT
Sbjct  63   VNLYSSRSSSPASSVRFSLDRSTSPSRSISAVNRNHVVQNRS--------QKKSCMCSPT  114

Query  508  SHPGSFRCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            +HPGSFRCSLHKN        SR + +Y  N+L  RRSAMTNSLVRIGTVEGDLVKRALA
Sbjct  115  THPGSFRCSLHKNRSGSGSTGSRTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVKRALA  174

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALIRPSSHQQRRR DFQ RPSRLS MSKA++
Sbjct  175  ALIRPSSHQQRRRADFQRRPSRLSAMSKADD  205



>ref|XP_007161188.1| hypothetical protein PHAVU_001G049400g [Phaseolus vulgaris]
 gb|ESW33182.1| hypothetical protein PHAVU_001G049400g [Phaseolus vulgaris]
Length=197

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = -1

Query  664  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  485
            + P+PSVRF++DRSISP RSVS     +   +         + KKTC+CSPT+HPGSFRC
Sbjct  64   TAPSPSVRFALDRSISPSRSVSSHVIVKKHHRH------VTVQKKTCMCSPTNHPGSFRC  117

Query  484  SLHKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  308
            SLHKN +   S  S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR
Sbjct  118  SLHKNNHHHASAGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRR  177

Query  307  GDFQPRPSRLSRMSKAEED  251
              F+PRPSRLS MS +EED
Sbjct  178  SAFEPRPSRLSIMSNSEED  196



>gb|KHN07053.1| hypothetical protein glysoja_023236 [Glycine soja]
Length=208

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRCSLHK
Sbjct  79   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCSLHK  132

Query  472  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  133  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  192

Query  298  QPRPSRLSRMSKAEE  254
            +PRPSRLS MSKA++
Sbjct  193  EPRPSRLSVMSKAQD  207



>ref|XP_004235914.1| PREDICTED: uncharacterized protein LOC101263595 [Solanum lycopersicum]
Length=148

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 102/145 (70%), Gaps = 20/145 (14%)
 Frame = -1

Query  667  SSTPTPSVRFSID--RSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  500
            S +P+P+VRFS    RSIS  PH+            ++    PL +  KKTC+CSPT+HP
Sbjct  15   SVSPSPNVRFSTSAGRSISVYPHQ------------QKQTSRPLPSHQKKTCMCSPTTHP  62

Query  499  GSFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            GSFRCSLHKNM+       S    S  LN RRSAMTNSLVRIGTVEG+LVKRALAALIRP
Sbjct  63   GSFRCSLHKNMSQNRSHSNSSYRSSYHLNMRRSAMTNSLVRIGTVEGELVKRALAALIRP  122

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAE  257
            SSHQ RRR DFQPRPSRLS MSKAE
Sbjct  123  SSHQLRRRDDFQPRPSRLSVMSKAE  147



>ref|XP_010519639.1| PREDICTED: putative protein TPRXL [Tarenaya hassleriana]
Length=208

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 13/144 (9%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + ++ PT S RFSID RSISP+RS++ S+       +         P+K C+CSPT+HPG
Sbjct  73   YTTAPPTQSFRFSIDTRSISPNRSIAFSKPSSHQISE---------PRKRCMCSPTTHPG  123

Query  496  SFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            SFRCSLHKN+   + + S SYPSNRLN RRSAMTNSLVRIG VEG+ V+RAL ALIRPSS
Sbjct  124  SFRCSLHKNLANPHGQGSASYPSNRLNMRRSAMTNSLVRIGGVEGEWVRRALTALIRPSS  183

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQ RRR  FQPRPSRLS MSKA+ 
Sbjct  184  HQLRRRAAFQPRPSRLSVMSKADN  207



>gb|KHG27589.1| Vitamin K-dependent S [Gossypium arboreum]
Length=223

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 105/138 (76%), Gaps = 7/138 (5%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            +  S+  PSVRFS+D R ISP+RS++  RR+       V N      K+TC+CSPT+HPG
Sbjct  68   YNHSSSAPSVRFSLDNRPISPNRSIATIRRNT----DAVQNLEKRQQKRTCMCSPTTHPG  123

Query  496  SFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            SFRCSLHK  N+  ++S   PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSH
Sbjct  124  SFRCSLHKGFNNSNAVSSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSH  183

Query  322  QQRRRGDFQPRPSRLSRM  269
            QQRRR  FQPRPSRLS M
Sbjct  184  QQRRRAAFQPRPSRLSVM  201



>ref|XP_003526301.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=215

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRCSLHK
Sbjct  86   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCSLHK  139

Query  472  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  140  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  199

Query  298  QPRPSRLSRMSKAEE  254
            +PRPSRLS MSKA++
Sbjct  200  EPRPSRLSVMSKAQD  214



>ref|XP_003549713.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Glycine max]
Length=203

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+G    +  PSVRFS+DRS+SP+RS+SV+ R    R+    +   +  K+TC+CSPT
Sbjct  64   VNLYG----STAPSVRFSLDRSVSPNRSISVAPRTGASRQSSSPH---HQQKRTCMCSPT  116

Query  508  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            +HPGSFRCSLHK   S     Y  +RLNARRSAMTNSLVRI  VEGDLVKRALAALIRPS
Sbjct  117  THPGSFRCSLHKK--SHAPAPYSPHRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPS  174

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRRGDF PRPSRLS MS AE 
Sbjct  175  SHQQRRRGDFYPRPSRLSVMSMAER  199



>ref|XP_006341382.1| PREDICTED: uncharacterized protein LOC102606030 [Solanum tuberosum]
Length=148

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 20/146 (14%)
 Frame = -1

Query  667  SSTPTPSVRFSID--RSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  500
            S +P+P+VRFS    RSIS  PH+            ++    PL +  KKTC+CSPT+HP
Sbjct  15   SVSPSPNVRFSASAGRSISVYPHQ------------QKQTSRPLPSNQKKTCMCSPTTHP  62

Query  499  GSFRCSLHKNMNSRPSISYPSNR----LNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            GSFRCS HKNM+   S S  S R    LN RRSAMTNSLVRIGTVEGDLVKRALAALIRP
Sbjct  63   GSFRCSFHKNMSQNRSHSNSSYRSSYHLNMRRSAMTNSLVRIGTVEGDLVKRALAALIRP  122

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQ RRR DFQPRPSRLS MSKAE 
Sbjct  123  SSHQLRRRDDFQPRPSRLSVMSKAEN  148



>ref|XP_004501356.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501357.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501358.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501359.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X4 [Cicer arietinum]
Length=219

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 101/133 (76%), Gaps = 8/133 (6%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            VRFSID RSISP+R +S         +     P++   KKTC+CSPT+HPGSFRCSLHKN
Sbjct  92   VRFSIDSRSISPNRPISNQIITTKKNR-----PIS-AQKKTCMCSPTNHPGSFRCSLHKN  145

Query  469  M-NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  293
              N+  + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+P
Sbjct  146  NGNNNSADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSAFEP  205

Query  292  RPSRLSRMSKAEE  254
            RPSRLS MSKAE+
Sbjct  206  RPSRLSVMSKAED  218



>ref|XP_010908362.1| PREDICTED: uncharacterized protein LOC105034782 [Elaeis guineensis]
Length=205

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 26/153 (17%)
 Frame = -1

Query  670  ASSTPTPSVRFSID----RSISPHrsvsvsrrdqvvRKQGVGNPLANLP-------KKTC  524
            AS +P PSVRFS+D    R  SP             R   V + L++ P       ++TC
Sbjct  64   ASPSPVPSVRFSLDHHRHRPTSP------------GRSLAVADHLSSRPIASPAPQRRTC  111

Query  523  LCSPTSHPGSFRCSLHKNMN---SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  353
            +CSPT+HPGSFRCSLHK ++   +  ++S PSNRLNARRSAM NSLVRIGTVEG+ VKRA
Sbjct  112  MCSPTTHPGSFRCSLHKGLHLQHNHNAVSSPSNRLNARRSAMANSLVRIGTVEGEWVKRA  171

Query  352  LAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            L ALIRPSSHQQRRR  FQPRPSRLS MSKA++
Sbjct  172  LTALIRPSSHQQRRRAAFQPRPSRLSVMSKADD  204



>ref|XP_010687825.1| PREDICTED: uncharacterized protein LOC104901900 [Beta vulgaris 
subsp. vulgaris]
Length=193

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = -1

Query  553  PLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGT  380
            P     K+TC+CSPT+HPGSFRCSLHKN  +R   +  Y SNRL ARRSAMTNSLVRIGT
Sbjct  94   PTTTGQKRTCMCSPTNHPGSFRCSLHKNSANRTVSAQPYQSNRLFARRSAMTNSLVRIGT  153

Query  379  VEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  260
            VEGDLVKRALAALIRPSSHQQ+RRGDFQPR SRLS MS A
Sbjct  154  VEGDLVKRALAALIRPSSHQQKRRGDFQPRKSRLSNMSAA  193



>ref|XP_008788890.1| PREDICTED: uncharacterized protein LOC103706534 [Phoenix dactylifera]
Length=213

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 108/159 (68%), Gaps = 18/159 (11%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP----KKTCL  521
            V   GFA   PT SVRFSIDR  SP RS++ +   +    Q    P+   P    +KTC+
Sbjct  58   VNFVGFA--PPTSSVRFSIDRPTSPGRSLAFASPRKHHSPQR--RPITAAPAGGQRKTCM  113

Query  520  CSPTSHPGSFRCSLHKNMNS----------RPSISYPSNRLNARRSAMTNSLVRIGTVEG  371
            CSPT+HPGSFRC+LHK   +          R ++S PSNRLNARRSAMTNSLVRIGTVEG
Sbjct  114  CSPTNHPGSFRCNLHKGFAAHGVGGRHHYHRQAVSSPSNRLNARRSAMTNSLVRIGTVEG  173

Query  370  DLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            + V+RALAALI PSSH QRRR  F PRPSRLS MSKA++
Sbjct  174  EWVRRALAALIHPSSHHQRRRAAFHPRPSRLSIMSKADD  212



>ref|XP_009778673.1| PREDICTED: uncharacterized protein LOC104227990 [Nicotiana sylvestris]
Length=201

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 104/145 (72%), Gaps = 17/145 (12%)
 Frame = -1

Query  667  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            S++P+PSVRFS    RSIS + S            Q    PLA+  KK C+CSPT+HPGS
Sbjct  66   SASPSPSVRFSTSPGRSISAYPSY----------PQQNRRPLASNQKKHCMCSPTTHPGS  115

Query  493  FRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            FRC+LHKN       SR S  + S++LN RRSAMTNSLVRIGTVEGDL+KRALAALIRPS
Sbjct  116  FRCNLHKNTTQNRGQSRTSSYHSSHQLNMRRSAMTNSLVRIGTVEGDLLKRALAALIRPS  175

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQ RRR DFQPR SRLS MSKA++
Sbjct  176  SHQLRRRDDFQPRLSRLSAMSKAQD  200



>gb|ACU19325.1| unknown [Glycine max]
Length=215

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRC LHK
Sbjct  86   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCGLHK  139

Query  472  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  140  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  199

Query  298  QPRPSRLSRMSKAEE  254
            +PRPSRLS MSKA++
Sbjct  200  EPRPSRLSVMSKAQD  214



>ref|XP_008354346.1| PREDICTED: uncharacterized protein LOC103417967 [Malus domestica]
Length=208

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 98/142 (69%), Gaps = 14/142 (10%)
 Frame = -1

Query  649  SVRFSIDR--------SISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            SVRFS DR        S+SP  +           K G      + PK+ C+CSPT+HPGS
Sbjct  71   SVRFSFDRPTSPSRSISVSPRGTGGHHHHHHTAVKSGRN---ISQPKRXCMCSPTTHPGS  127

Query  493  FRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            FRCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH 
Sbjct  128  FRCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHS  186

Query  319  QRRRGDFQPRPSRLSRMSKAEE  254
            QRRR DF+PRPSRLS MSK+ E
Sbjct  187  QRRRADFRPRPSRLSTMSKSNE  208



>gb|KDP30200.1| hypothetical protein JCGZ_16982 [Jatropha curcas]
Length=211

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 9/147 (6%)
 Frame = -1

Query  688  VELHGFASSTPT-PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            V L+G   +TP+ PSVR S+DR  SP+RS+S     +    Q V    ++ PK+TC+CSP
Sbjct  70   VNLYG---NTPSAPSVRISLDRPSSPNRSISTINPSRG--HQVVRK--SSTPKRTCMCSP  122

Query  511  TSHPGSFRCSLHKNMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            TSHPGSFRCSLHK  N+  S +Y S  RLNARRSAMTNSLVRIG VEGDLVKRAL+ALIR
Sbjct  123  TSHPGSFRCSLHKGFNNSSSANYSSNTRLNARRSAMTNSLVRIGGVEGDLVKRALSALIR  182

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQQRRRG FQPRPSRLS MSKAE+
Sbjct  183  PSSHQQRRRGAFQPRPSRLSVMSKAED  209



>emb|CBI25574.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            C+CSPT+HPGSFRCSLHK  N+  S  Y SNRLNARRSAMTNSLVRIGTVEGDLVKRALA
Sbjct  84   CMCSPTTHPGSFRCSLHKGFNNH-SAPYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  142

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALIRPSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  143  ALIRPSSHQQRRRSGFQPRPSRLSNMSKAED  173



>ref|XP_009611326.1| PREDICTED: uncharacterized protein LOC104104846 [Nicotiana tomentosiformis]
Length=202

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 104/147 (71%), Gaps = 21/147 (14%)
 Frame = -1

Query  667  SSTPTPSVRFS--IDRSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  500
            S +P+P+VRFS    RSIS  PH+            KQ    PL +  KKTC+CSPT+HP
Sbjct  67   SVSPSPNVRFSASTSRSISVYPHQQ-----------KQN-SRPLQSNQKKTCMCSPTTHP  114

Query  499  GSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            GSFRCSLHKNMN     S  S    S+ LN RRSAMTNSLVRIGTVEG+LVKRALAALIR
Sbjct  115  GSFRCSLHKNMNQNRGHSNSSSYRSSHHLNMRRSAMTNSLVRIGTVEGELVKRALAALIR  174

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSH  RRR DFQPRPSRLS MSKAE+
Sbjct  175  PSSHHLRRRDDFQPRPSRLSVMSKAED  201



>ref|XP_010691070.1| PREDICTED: putative protein TPRXL [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 111/151 (74%), Gaps = 13/151 (9%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCS  515
            + ++G +  T + SVRFSI+  R+ SP+RS S   R++        NP     KKTC+CS
Sbjct  53   ISIYGSSPQTTSSSVRFSINNNRNTSPNRSFSAVNRNR--------NPFPAGKKKTCMCS  104

Query  514  PTSHPGSFRCSLHKNMNSR--PSISYPSNRLNARRSAMTNSLVRIGTVEG-DLVKRALAA  344
            PT+HPGSFRC+ HKN+ S+   + SY  NRLN RRSAMTNSLVRIG+VEG + VKRAL+ 
Sbjct  105  PTTHPGSFRCNFHKNLESKRQNTPSYQPNRLNMRRSAMTNSLVRIGSVEGGESVKRALSM  164

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            LIRP +HQQRRRGDFQPRPSRLS MSKAE++
Sbjct  165  LIRPCAHQQRRRGDFQPRPSRLSVMSKAEDE  195



>gb|KHG18275.1| hypothetical protein F383_09858 [Gossypium arboreum]
Length=227

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 108/141 (77%), Gaps = 9/141 (6%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            V ++  A S+   SVRFS+D R ISP+RS+S  RR+     + + N  +  PK+TC+CSP
Sbjct  64   VNVYNHAQSSQ--SVRFSLDSRPISPNRSISAVRRNT----EALRNLQSKQPKRTCMCSP  117

Query  511  TSHPGSFRCSLHKNMN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            T+HPGSFRCSLHK  N S  S  Y PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALI
Sbjct  118  TTHPGSFRCSLHKGFNNSHASSGYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALI  177

Query  337  RPSSHQQRRRGDFQPRPSRLS  275
            RPSSHQQRRR  FQPRPSRLS
Sbjct  178  RPSSHQQRRRAAFQPRPSRLS  198



>gb|KCW80272.1| hypothetical protein EUGRSUZ_C01627 [Eucalyptus grandis]
Length=137

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 104/140 (74%), Gaps = 12/140 (9%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            +PSVRFSIDRS SP RS++V  R  V+R+QG         KKTC+CSPTSHPGSFRCSLH
Sbjct  2    SPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG------GPAKKTCMCSPTSHPGSFRCSLH  55

Query  475  KN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
            KN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPSSH  R
Sbjct  56   KNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPSSHHLR  115

Query  313  RRGDFQPRPSRLSRMSKAEE  254
            RRG F+ RPSRLS MSKAE+
Sbjct  116  RRGAFETRPSRLSVMSKAED  135



>ref|XP_009358531.1| PREDICTED: uncharacterized protein LOC103949156 [Pyrus x bretschneideri]
Length=196

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 99/134 (74%), Gaps = 11/134 (8%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL-PKKTCLCSPTSHPGSFRCSLHK  473
            SVRFS DR  SP        R   V  +G G+   +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  71   SVRFSFDRPTSP-------SRSISVAPRGTGSHHHHTAPKRTCMCSPTTHPGSFRCSLHK  123

Query  472  NMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            N NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALA+LIRPSSH QRRR DF
Sbjct  124  N-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALASLIRPSSHSQRRRADF  182

Query  298  QPRPSRLSRMSKAE  257
             PRPSRLS MSK++
Sbjct  183  CPRPSRLSAMSKSD  196



>gb|KDP37028.1| hypothetical protein JCGZ_06084 [Jatropha curcas]
Length=211

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 105/141 (74%), Gaps = 13/141 (9%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            TPS+RFSIDR ISP+RS+S+ R          GN ++N  K+TC CSPT+HPGSFRC+ H
Sbjct  78   TPSLRFSIDRPISPNRSLSMKRNASN------GNAVSN-QKRTCACSPTTHPGSFRCAFH  130

Query  475  K-----NMNSRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
            +     N  S  S SY  S+RLN RRSAMTNSLVRIG VEG+LVKRAL+ALIRPSSHQ R
Sbjct  131  RALMRNNGYSTQSASYHSSSRLNFRRSAMTNSLVRIGGVEGELVKRALSALIRPSSHQLR  190

Query  313  RRGDFQPRPSRLSRMSKAEED  251
            RR DFQPRPSRLS MSKA + 
Sbjct  191  RRADFQPRPSRLSVMSKASDS  211



>ref|XP_009363915.1| PREDICTED: uncharacterized protein LOC103953846 [Pyrus x bretschneideri]
Length=207

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%), Gaps = 13/141 (9%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvs-------rrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            SVRFS DR  SP RS+SVS              K G      + PK+TC+CSPT+HPGSF
Sbjct  71   SVRFSFDRPTSPSRSISVSPRGTGAHHHHHTAVKSGRN---ISQPKRTCMCSPTTHPGSF  127

Query  490  RCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  317
            RCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH Q
Sbjct  128  RCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHSQ  186

Query  316  RRRGDFQPRPSRLSRMSKAEE  254
            RRR DF+PRPSRLS MSK+ E
Sbjct  187  RRRADFRPRPSRLSTMSKSNE  207



>emb|CDO98193.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 99/144 (69%), Gaps = 16/144 (11%)
 Frame = -1

Query  667  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            S +PTPSVRFS    RSI               + +    P+ +  KKTCLCSPT+HPGS
Sbjct  61   SVSPTPSVRFSTSPGRSI----------VVSPRQSRQSNRPVPSNQKKTCLCSPTTHPGS  110

Query  493  FRCSLHKNMNSRP----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            FRCSLHKN N       S +  S++LN RRSAMTNSLVRIGTVEGDLVKRAL ALIRPSS
Sbjct  111  FRCSLHKNTNRNDHHTGSYNRSSHQLNMRRSAMTNSLVRIGTVEGDLVKRALTALIRPSS  170

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            H  RRRGDF PRPSRLS MSKAE+
Sbjct  171  HNLRRRGDFHPRPSRLSIMSKAED  194



>ref|XP_009338399.1| PREDICTED: uncharacterized protein LOC103930750 [Pyrus x bretschneideri]
Length=205

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA---NLPKKTCLCSPTSHPGSFRCSL  479
            SVRFS DR  SP RS+SV+ R           P     + PK+TC+CSPT+HPGSFRCSL
Sbjct  71   SVRFSFDRPTSPSRSISVAPRGTGSHHHHTAVPSGRNISQPKRTCMCSPTTHPGSFRCSL  130

Query  478  HKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  305
            HKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALA+LIRPSSH QRRR 
Sbjct  131  HKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALASLIRPSSHSQRRRA  189

Query  304  DFQPRPSRLSRMSKAE  257
            DF PRPSRLS MSK++
Sbjct  190  DFCPRPSRLSAMSKSD  205



>ref|XP_010050691.1| PREDICTED: uncharacterized protein LOC104439311 [Eucalyptus grandis]
Length=247

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 12/145 (8%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            +SS  +PSVRFSIDRS SP RS++V  R  V+R+QG   P     KKTC+CSPTSHPGSF
Sbjct  107  SSSQMSPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG--GP----AKKTCMCSPTSHPGSF  160

Query  490  RCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            RCSLHKN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPS
Sbjct  161  RCSLHKNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPS  220

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH  RRRG F+ RPSRLS MSKAE+
Sbjct  221  SHHLRRRGAFETRPSRLSVMSKAED  245



>ref|XP_009798216.1| PREDICTED: uncharacterized protein LOC104244483 [Nicotiana sylvestris]
Length=202

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 100/143 (70%), Gaps = 17/143 (12%)
 Frame = -1

Query  661  TPTPSVRFS--IDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  488
            +P+P+VRFS    RSIS H             KQ    PL +  KKTC+CSPT+HPGSFR
Sbjct  69   SPSPNVRFSASTSRSISVHPHQQ---------KQN-SRPLQSNQKKTCMCSPTTHPGSFR  118

Query  487  CSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            CSLHKNM     +S  S    S  LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSH
Sbjct  119  CSLHKNMSQNRGHSNSSSYRSSYHLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSH  178

Query  322  QQRRRGDFQPRPSRLSRMSKAEE  254
              RRR DFQPRPSRLS MSKAE+
Sbjct  179  HLRRRDDFQPRPSRLSVMSKAED  201



>ref|XP_004498757.1| PREDICTED: vitellogenin-2-like [Cicer arietinum]
Length=205

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
             RFSID RSISP+R+V      Q        +    + KKTC+CSPT+HPGSFRCSLHKN
Sbjct  75   FRFSIDHRSISPNRTVPSHVISQKNHHHNHNS----IQKKTCMCSPTTHPGSFRCSLHKN  130

Query  469  MNSRP---SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
              S     S SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQ+RR  F
Sbjct  131  SGSNSIHHSDSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQKRRSAF  190

Query  298  QPRPSRLSRMSKAEE  254
            + RPSRLS MSKA+E
Sbjct  191  ESRPSRLSVMSKADE  205



>ref|XP_010048163.1| PREDICTED: uncharacterized protein LOC104437010 [Eucalyptus grandis]
 gb|KCW80339.1| hypothetical protein EUGRSUZ_C01705 [Eucalyptus grandis]
 gb|KCW80340.1| hypothetical protein EUGRSUZ_C01705 [Eucalyptus grandis]
Length=216

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 12/145 (8%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  491
            +SS  +PSVRFSIDRS SP RS++V  R  V+R+QG         KKTC+CSPTSHPGSF
Sbjct  76   SSSQMSPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG------GPAKKTCMCSPTSHPGSF  129

Query  490  RCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            RCSLHKN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPS
Sbjct  130  RCSLHKNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPS  189

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SH  RRRG F+ RPSRLS MSKAE+
Sbjct  190  SHHLRRRGAFETRPSRLSVMSKAED  214



>ref|XP_009799051.1| PREDICTED: uncharacterized protein LOC104245184 [Nicotiana sylvestris]
Length=172

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            S RFS+DR IS   S S+S  ++          +++  K TC+CSPT+HPGSFRCS+HK 
Sbjct  35   SKRFSLDREISTSPSRSISVMNRESTTNRQYKSMSSQKKMTCMCSPTTHPGSFRCSMHKK  94

Query  469  MNSRPSISYPSNR--LNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  296
            M+ R SI   S+   LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR  FQ
Sbjct  95   MDVRRSIQTASSSYSLNTRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRYGFQ  154

Query  295  PRPSRLSRMSKAEE  254
             RPSRLS MS+ ++
Sbjct  155  RRPSRLSNMSRTDD  168



>ref|XP_002271365.1| PREDICTED: uncharacterized protein LOC100242170 [Vitis vinifera]
Length=203

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  643  RFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNMN  464
            RFSI+   SP RS+SVS RDQVVRKQ  G   ++  K+TCLCSPT+HPGSFRCS+HKN N
Sbjct  70   RFSIEPQTSPRRSISVSPRDQVVRKQNTG---SSRQKRTCLCSPTTHPGSFRCSMHKNAN  126

Query  463  SRPSIS----YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  296
            +         Y SNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F+
Sbjct  127  TGAGSGSGGAYQSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAFE  186

Query  295  PRPSRLSRMSKAEED  251
            PR SRLS MS A  D
Sbjct  187  PRLSRLSIMSMAGSD  201



>ref|XP_006450364.1| hypothetical protein CICLE_v10009513mg [Citrus clementina]
 gb|ESR63604.1| hypothetical protein CICLE_v10009513mg [Citrus clementina]
 gb|KDO61818.1| hypothetical protein CISIN_1g028670mg [Citrus sinensis]
 gb|KDO61819.1| hypothetical protein CISIN_1g028670mg [Citrus sinensis]
Length=205

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 104/144 (72%), Gaps = 14/144 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            + S++PTPS RFSIDRSISP+RS+SV        KQ   N   +  KKTC+CSPT+HPGS
Sbjct  71   YTSASPTPSFRFSIDRSISPNRSISVP-------KQ---NNHISFQKKTCMCSPTTHPGS  120

Query  493  FRCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            FRCSLHKN     +S  + SY SN LN RRSAMTNSLVRIG VEG+ +KR+L  LIRPSS
Sbjct  121  FRCSLHKNSGVNSHSNGTGSYQSNSLNMRRSAMTNSLVRIGGVEGEWMKRSLRDLIRPSS  180

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            H QRRR  FQPRPSRL   SK E+
Sbjct  181  HHQRRRSAFQPRPSRLCITSKYED  204



>ref|XP_006483414.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=205

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 104/144 (72%), Gaps = 14/144 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            + S++PTPS RFSIDRSISP+RS+SV        KQ   N   +  KKTC+CSPT+HPGS
Sbjct  71   YTSASPTPSFRFSIDRSISPNRSISVP-------KQ---NNHISFQKKTCMCSPTTHPGS  120

Query  493  FRCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            FRCSLHKN     +S  + SY SN LN RRSAMTNSLVRIG VEG+ +KR+L  LIRPSS
Sbjct  121  FRCSLHKNSGVNGHSNGTGSYQSNSLNMRRSAMTNSLVRIGGVEGEWMKRSLRDLIRPSS  180

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            H QRRR  FQPRPSRL   SK E+
Sbjct  181  HHQRRRSAFQPRPSRLCITSKYED  204



>ref|XP_010099865.1| hypothetical protein L484_008522 [Morus notabilis]
 gb|EXB80742.1| hypothetical protein L484_008522 [Morus notabilis]
Length=214

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 107/136 (79%), Gaps = 15/136 (11%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            SVRFSID RSISP+RS++VS       KQ    P++ + K+TC+CSPT+HPGSFRCSLHK
Sbjct  89   SVRFSIDHRSISPNRSITVS-------KQ---RPIS-MTKRTCMCSPTTHPGSFRCSLHK  137

Query  472  NMNSRPS---ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N++S  S    SYPSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  
Sbjct  138  NVSSGGSHNAASYPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSA  197

Query  301  FQPRPSRLSRMSKAEE  254
            FQP  SRLS MSKA++
Sbjct  198  FQPTRSRLSVMSKADD  213



>ref|XP_003533861.1| PREDICTED: uncharacterized protein LOC100794542 [Glycine max]
Length=191

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 2/96 (2%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP--SNRLNARRSAMTNSLVRIGTVEGDLV  362
            K+TC+CSPTSHPGSFRCSLHK+  SR ++S    SNRLNARRSAMTNSLVRI  VEG+LV
Sbjct  96   KRTCMCSPTSHPGSFRCSLHKSFGSRSAVSAAPASNRLNARRSAMTNSLVRIRGVEGELV  155

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            KRALAALIRPSSHQQRRRGDF+PRPSRLS M  A++
Sbjct  156  KRALAALIRPSSHQQRRRGDFRPRPSRLSVMFTAKD  191



>gb|AFK38729.1| unknown [Medicago truncatula]
 gb|AES73593.2| plant/F18G18-20 protein [Medicago truncatula]
Length=223

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + +++ +  VRFSID RSISP+RS+S               P+    KKTC+CSPT+HPG
Sbjct  88   YTTNSRSSGVRFSIDSRSISPNRSISNHVITTK------NRPIP-AQKKTCMCSPTNHPG  140

Query  496  SFRCSLHKNM--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            SFRCSLHKN   NS  + SYPS RLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSH
Sbjct  141  SFRCSLHKNNGNNSSNADSYPSTRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSH  200

Query  322  QQRRRGDFQPRPSRLSRMSKAE  257
            QQRRR  F+PRPSRLS MSKAE
Sbjct  201  QQRRRSAFEPRPSRLSVMSKAE  222



>ref|XP_011458842.1| PREDICTED: putative protein TPRXL [Fragaria vesca subsp. vesca]
Length=224

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 101/144 (70%), Gaps = 15/144 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + SS  +P+VRFSI+ RSISP      +R     +K G   P+A   +KTC+CSPT+HPG
Sbjct  90   YTSSALSPAVRFSIEHRSISP------NRSITASKKNG---PIA-ASRKTCMCSPTTHPG  139

Query  496  SFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN  S         YP+NRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRPS
Sbjct  140  SFRCSLHKNQGSSNQHHNHTPYPNNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPS  199

Query  328  SHQQRRRGDFQPRPSRLSRMSKAE  257
            SHQQRRR  FQPR SRLS MSKA 
Sbjct  200  SHQQRRRAGFQPRQSRLSVMSKAN  223



>gb|EYU32362.1| hypothetical protein MIMGU_mgv1a014368mg [Erythranthe guttata]
Length=192

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 5/101 (5%)
 Frame = -1

Query  541  LPKKTCLCSPTSHPGSFRCSLHKNMNSR-----PSISYPSNRLNARRSAMTNSLVRIGTV  377
            L K+TC+CSPT+HPGSFRC+LHKN ++R      S+ Y  NRLN RRSAMTNSLVRIGTV
Sbjct  90   LHKRTCMCSPTTHPGSFRCALHKNSSTRRGSSDHSLPYSPNRLNMRRSAMTNSLVRIGTV  149

Query  376  EGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            EGDL+KRALAALIRPSSHQQRRR  FQ +PSRLS MSKAE+
Sbjct  150  EGDLMKRALAALIRPSSHQQRRRAGFQSQPSRLSVMSKAED  190



>ref|XP_003546585.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=190

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVK  359
            K+TC+CSPTSHPGSFRCSLHK+  SR +++  S NRLNARRSAMTNSLVRI  VEG+LVK
Sbjct  96   KRTCMCSPTSHPGSFRCSLHKSFGSRSAVAAASPNRLNARRSAMTNSLVRIRGVEGELVK  155

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RALAALIRPSSHQQRRRGDF+PRPSRLS M  A++
Sbjct  156  RALAALIRPSSHQQRRRGDFRPRPSRLSIMFTAKD  190



>ref|XP_002531449.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30936.1| conserved hypothetical protein [Ricinus communis]
Length=203

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 106/144 (74%), Gaps = 10/144 (7%)
 Frame = -1

Query  676  GFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            G A++    SVRFS+DR ISP+RS++ S        Q V  P     KKTC+CSPT+HPG
Sbjct  63   GSATTRSASSVRFSLDRPISPNRSITSSVSRAP--HQVVRKP----SKKTCMCSPTTHPG  116

Query  496  SFRCSLHKNMNSRPSISY----PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN N+  S S     PS RLNARRSAMTNSLVRI  VEGDLVKRAL++LIRPS
Sbjct  117  SFRCSLHKNFNNNNSNSVNYPSPSTRLNARRSAMTNSLVRICGVEGDLVKRALSSLIRPS  176

Query  328  SHQQRRRGDFQPRPSRLSRMSKAE  257
            SHQQ+RR  FQPRPSRLS MSKAE
Sbjct  177  SHQQKRRAAFQPRPSRLSVMSKAE  200



>ref|XP_006465228.1| PREDICTED: vitellogenin-2-like [Citrus sinensis]
 gb|KDO52317.1| hypothetical protein CISIN_1g048815mg [Citrus sinensis]
Length=206

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  655  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPSRSISYTRQISKSNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  478  HKNMNSRPSIS------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  317
            HK  NS  S        + S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYNSHKTASCSHHSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  316  RRRGDFQPRPSRLSRMSKAEE  254
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSNMSKADD  205



>ref|XP_010323270.1| PREDICTED: uncharacterized protein LOC101254911 [Solanum lycopersicum]
Length=206

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 110/151 (73%), Gaps = 14/151 (9%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+   SS+P  SVRFS++RS SP RS++   R+ VV+ +          KK+C+CSPT
Sbjct  63   VNLYSSRSSSPASSVRFSLERSTSPSRSIAAVNRNHVVQNRS--------QKKSCMCSPT  114

Query  508  SHPGSFRCSLHKNMNSRPSI------SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            +HPGSFRCSLHKN +   S       +Y  N+L  RRSAMTNSLVRIGTVEGDLVKRALA
Sbjct  115  THPGSFRCSLHKNKSGSGSTGRGTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVKRALA  174

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALIRPSSHQQRRR DFQ RPSRLS MSKA++
Sbjct  175  ALIRPSSHQQRRRADFQCRPSRLSVMSKADD  205



>gb|ABA40431.1| unknown [Solanum tuberosum]
Length=242

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 109/151 (72%), Gaps = 14/151 (9%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L+   SS+P  SVRFS+DRS SP RS+S   R+ VV+ +          KK+C+CSPT
Sbjct  63   VNLYSSRSSSPASSVRFSLDRSTSPSRSISAVNRNHVVQNRS--------QKKSCMCSPT  114

Query  508  SHPGSFRCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            +HPGSFRCSLHKN        SR + +Y  N+L  RRSAMTNSLVRIGTVEGDLV+RALA
Sbjct  115  THPGSFRCSLHKNRSGSGSTGSRTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVRRALA  174

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALIRPSSHQQRRR DFQ RPSRLS M KA+ 
Sbjct  175  ALIRPSSHQQRRRADFQRRPSRLSAMFKADN  205



>ref|XP_008336956.1| PREDICTED: putative protein TPRXL [Malus domestica]
Length=207

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 98/144 (68%), Gaps = 21/144 (15%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA-----------NLPKKTCLCSPTSH  503
            SVRFS DR  SP        R   V  +G G               + PK+TC+CSPT+H
Sbjct  72   SVRFSFDRPTSP-------SRSISVSPRGTGXHHHHHTAVPSGRNISQPKRTCMCSPTTH  124

Query  502  PGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            PGSFRCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALAALIRPS
Sbjct  125  PGSFRCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALAALIRPS  183

Query  328  SHQQRRRGDFQPRPSRLSRMSKAE  257
            SH QRRR DF PRPSRLS MSK++
Sbjct  184  SHSQRRRADFCPRPSRLSAMSKSD  207



>ref|XP_003603342.1| hypothetical protein MTR_3g106530 [Medicago truncatula]
Length=275

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            + +++ +  VRFSID RSISP+RS+S               P+    KKTC+CSPT+HPG
Sbjct  88   YTTNSRSSGVRFSIDSRSISPNRSISNHVITTK------NRPIP-AQKKTCMCSPTNHPG  140

Query  496  SFRCSLHKNM--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            SFRCSLHKN   NS  + SYPS RLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSH
Sbjct  141  SFRCSLHKNNGNNSSNADSYPSTRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSH  200

Query  322  QQRRRGDFQPRPSRLSRMSKAE  257
            QQRRR  F+PRPSRLS MSKAE
Sbjct  201  QQRRRSAFEPRPSRLSVMSKAE  222



>ref|XP_004287242.1| PREDICTED: uncharacterized protein LOC101298453 [Fragaria vesca 
subsp. vesca]
Length=205

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  649  SVRFSI-DRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            SVRFS+ DR  SP RS+SVS        +       N  K+TC+CSPTSHPGSFRCSLHK
Sbjct  74   SVRFSLLDRPTSPSRSISVSPHGSGCHHRSAMKKQINTTKRTCMCSPTSHPGSFRCSLHK  133

Query  472  NMNSRPS--ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            N ++  S  + Y  NRLNARRSAMTNSLVRIG VEG+++KRALAALIRPSSH QRRR DF
Sbjct  134  NTSASSSSAVPYSQNRLNARRSAMTNSLVRIGGVEGEIMKRALAALIRPSSHSQRRRADF  193

Query  298  QPRPSRLSRMSK  263
            +PRPSRLS+ S+
Sbjct  194  RPRPSRLSKCSE  205



>gb|KDP33557.1| hypothetical protein JCGZ_07128 [Jatropha curcas]
Length=209

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 100/131 (76%), Gaps = 14/131 (11%)
 Frame = -1

Query  634  IDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRP  455
            IDRSISP+RS+SVS++          NP++ L KKTC+CSPT+HPGSFRCSLHKN+ S+ 
Sbjct  88   IDRSISPNRSISVSKK---------NNPIS-LSKKTCMCSPTTHPGSFRCSLHKNIGSQS  137

Query  454  ----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRP  287
                S  Y  NRLN  RSAM NSLVRIG VEG+ VKRAL ALIRPSSH QRRR DFQPRP
Sbjct  138  HGSSSAPYTPNRLNMMRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHHQRRRADFQPRP  197

Query  286  SRLSRMSKAEE  254
            SRLS MSKA++
Sbjct  198  SRLSIMSKADD  208



>ref|XP_006427484.1| hypothetical protein CICLE_v10027309mg [Citrus clementina]
 gb|ESR40724.1| hypothetical protein CICLE_v10027309mg [Citrus clementina]
Length=206

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  655  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPGRSISYTRQISKCNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  478  HKNMNSRPSIS------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  317
            HK  NS  S        + S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYNSHKTASCSHHSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  316  RRRGDFQPRPSRLSRMSKAEE  254
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSNMSKADD  205



>gb|EYU25275.1| hypothetical protein MIMGU_mgv1a014625mg [Erythranthe guttata]
Length=184

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 11/135 (8%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            +PS+RFS+DR  SP+RS+S + R         G P A   K+TC+CSPT+HPGSFRCSLH
Sbjct  58   SPSLRFSMDRPGSPNRSISFTTRS--------GKPAAAPQKRTCMCSPTNHPGSFRCSLH  109

Query  475  KN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  305
            K      SR +    S+RLN RRSAM NSLVRIGTVEGDLV RALAALIRPSSH QRRRG
Sbjct  110  KANKPTASRTASCGSSSRLNMRRSAMKNSLVRIGTVEGDLVTRALAALIRPSSHNQRRRG  169

Query  304  DFQPRPSRLSRMSKA  260
            +F+PRPSRLS M+K+
Sbjct  170  EFRPRPSRLSAMAKS  184



>ref|XP_009407367.1| PREDICTED: mucin-1-like [Musa acuminata subsp. malaccensis]
Length=214

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 104/151 (69%), Gaps = 11/151 (7%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V L G   S  TPSV FS+DRS SP           V R++      A   ++TC+CSPT
Sbjct  68   VYLVGSTPSPRTPSVHFSLDRSTSP-----GRSLAVVDRRRPASASAAAPARRTCMCSPT  122

Query  508  SHPGSFRCSLHKNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            +HPGSFRCSLHK +      N   + S PSNRLNARRSAMTNSLVRIG VEG+ VKRALA
Sbjct  123  THPGSFRCSLHKGLRFPPHHNQHAASSSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALA  182

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            +LIRPSSHQQRRR DF+PR SRLS MS+A++
Sbjct  183  SLIRPSSHQQRRRADFRPRLSRLSVMSRADD  213



>ref|XP_011020249.1| PREDICTED: uncharacterized protein LOC105122688 [Populus euphratica]
Length=212

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 109/150 (73%), Gaps = 10/150 (7%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V ++G  S + +PSVR +   +ISP+RS+S     +    Q V     + PK+TC+CSPT
Sbjct  68   VNMYGHTSQSSSPSVRLN---AISPNRSISTVNPSRSHHHQVVKK--QSTPKRTCMCSPT  122

Query  508  SHPGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAA  344
            +HPGSFRCSLHK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALA+
Sbjct  123  THPGSFRCSLHKGVGFGSSPSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALAS  182

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            LIRPSSHQQRRR  FQPRPSRLS MSK+E+
Sbjct  183  LIRPSSHQQRRRSAFQPRPSRLSVMSKSED  212



>ref|XP_010555066.1| PREDICTED: uncharacterized protein PB18E9.04c-like [Tarenaya 
hassleriana]
Length=202

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 109/151 (72%), Gaps = 15/151 (10%)
 Frame = -1

Query  685  ELHGFASST--PTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCS  515
            + H F  +T  PT S RFSID RSISP+RS++VS+  +    +          +K C+CS
Sbjct  61   DQHDFKYTTAPPTQSFRFSIDSRSISPNRSIAVSKPSRHQISEQ---------RKRCMCS  111

Query  514  PTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAA  344
            PT+HPGSFRCSLHKN+   + + + SYPSNRLN RRSAMTNSLVRIG VEG+ V+RAL A
Sbjct  112  PTTHPGSFRCSLHKNVANPHGQGAASYPSNRLNMRRSAMTNSLVRIGGVEGEWVRRALTA  171

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            LIRPSSH  RRR  FQPRPS+LS MS+A++ 
Sbjct  172  LIRPSSHHLRRRAAFQPRPSKLSVMSQADDQ  202



>ref|XP_010557627.1| PREDICTED: uncharacterized protein LOC104826566 [Tarenaya hassleriana]
Length=206

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            +VRFS++R  SP      +        Q V +      K+TCLCSPT+HPGSFRCSLHK 
Sbjct  70   TVRFSLERPTSP-GRSISAVGHSPRAGQIVRSQTPPQQKRTCLCSPTNHPGSFRCSLHKA  128

Query  469  MNSRPS---ISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
              +R S    SY P+NRL+ARRSAMTNSLVRI  VEG+LVKRALAALIRPSSH QRRR D
Sbjct  129  AAARGSHAQTSYSPNNRLHARRSAMTNSLVRICGVEGELVKRALAALIRPSSHHQRRRAD  188

Query  301  FQPRPSRLSRMSKAEED  251
            F PRPSRLS MSKAE+ 
Sbjct  189  FHPRPSRLSVMSKAEDS  205



>ref|XP_008452898.1| PREDICTED: putative protein TPRXL [Cucumis melo]
 gb|ADN34124.1| serine-rich protein [Cucumis melo subsp. melo]
Length=213

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 109/145 (75%), Gaps = 15/145 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            ++S + TPSVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPG
Sbjct  78   YSSPSLTPSVRFFIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPG  127

Query  496  SFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPS
Sbjct  128  SFRCSLHKNVSSGGGHSQMVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPS  187

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR  FQPR SRLS MSKA++
Sbjct  188  SHQQRRRAAFQPRSSRLSVMSKADD  212



>ref|XP_002309648.1| serine-rich family protein [Populus trichocarpa]
 gb|ABK95959.1| unknown [Populus trichocarpa]
 gb|EEE93171.1| serine-rich family protein [Populus trichocarpa]
Length=210

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 11/137 (8%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            +PS RFSIDRS SP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSFRCSLH
Sbjct  81   SPSFRFSIDRSTSPNRSISVS-------KKNHSHPIS-APKRTCMCSPTTHRGSFRCSLH  132

Query  475  KNMNSR--PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            KN +S   P++  P +RLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRRG 
Sbjct  133  KNSSSSSNPAMFTP-HRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRGA  191

Query  301  FQPRPSRLSRMSKAEED  251
            FQPR SRLS MSKA+++
Sbjct  192  FQPRQSRLSIMSKADDE  208



>ref|XP_006356235.1| PREDICTED: uncharacterized protein LOC102603646 [Solanum tuberosum]
Length=189

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 102/144 (71%), Gaps = 16/144 (11%)
 Frame = -1

Query  667  SSTPTPSVRF--SIDRSISPHrsvsvsrrdqvvRKQGVGNPL--ANLPKKTCLCSPTSHP  500
            S +P+PSVRF  S  RSIS              + Q   +PL  A+  KK C CSPT+HP
Sbjct  56   SVSPSPSVRFFSSPSRSIS----------VFPRKPQQNSHPLPSASNQKKHCTCSPTTHP  105

Query  499  GSFRCSLHKNMN--SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            GSFRCSLHKN    SR    + S++LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSS
Sbjct  106  GSFRCSLHKNTTNRSRGQSYHSSHQLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSS  165

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQ RRR DFQP+PSRLS MSKAE+
Sbjct  166  HQLRRRCDFQPKPSRLSVMSKAED  189



>ref|XP_010927347.1| PREDICTED: uncharacterized protein LOC105049415 [Elaeis guineensis]
Length=218

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHr-svsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            AS  P PSVRFS+D+   P     S++  D  +  + + +P     ++TC+CSPT+HPGS
Sbjct  75   ASPAPVPSVRFSLDQHRRPTSPGRSLAVADHHLSPRPIASPAPQ--RRTCMCSPTNHPGS  132

Query  493  FRCSLHKNMNSRPS----ISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            FRCSLHK ++  P      S+ PSNRLNARRSAMTNSLVRIGTVEG+ VKRAL ALIRPS
Sbjct  133  FRCSLHKGLHLHPHHQNHASFSPSNRLNARRSAMTNSLVRIGTVEGEWVKRALTALIRPS  192

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR  FQPR SRLS MSKA++
Sbjct  193  SHQQRRRAAFQPRRSRLSVMSKADD  217



>ref|XP_006381071.1| hypothetical protein POPTR_0006s05980g [Populus trichocarpa]
 gb|ERP58868.1| hypothetical protein POPTR_0006s05980g [Populus trichocarpa]
Length=212

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 10/149 (7%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V ++G  S + +PSVR +   +ISP+RS+S     +    Q V     + PK+TC+CSPT
Sbjct  68   VNMYGHTSQSSSPSVRLN---AISPNRSISTVNPSRSHHHQVVKK--QSTPKRTCMCSPT  122

Query  508  SHPGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAA  344
            +HPGSFRCSLHK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALA+
Sbjct  123  THPGSFRCSLHKGVGFGGSPSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALAS  182

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            LIRPSSHQQRRR  FQPRPSRLS MSK+E
Sbjct  183  LIRPSSHQQRRRSAFQPRPSRLSVMSKSE  211



>ref|XP_002515469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46918.1| conserved hypothetical protein [Ricinus communis]
Length=205

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 100/144 (69%), Gaps = 16/144 (11%)
 Frame = -1

Query  673  FASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            F +S PT S R SI RS SP+RS++            V     N  KKTC+CSPT HPGS
Sbjct  72   FTTSIPTTSFRVSIGRSSSPNRSIT------------VTKQHQNNNKKTCMCSPTMHPGS  119

Query  493  FRCSLHKNMNSRPS----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            FRCSLHKN N+  S     SY  NRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSS
Sbjct  120  FRCSLHKNSNNNNSHSGLDSYTPNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSS  179

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQQRRR DFQPRPSRLS M+KA++
Sbjct  180  HQQRRRCDFQPRPSRLSIMAKADD  203



>ref|XP_011078547.1| PREDICTED: uncharacterized protein LOC105162252 [Sesamum indicum]
Length=203

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 17/142 (12%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRCS  482
            +PS+ FS+DR  SP+RS+S+S R +        +P +  P  K+TC+CSPT+HPGSFRCS
Sbjct  69   SPSLSFSLDRPGSPNRSISMSTRVE-------NSPASTAPSQKRTCMCSPTNHPGSFRCS  121

Query  481  LHKN---MNSRPSISYP-----SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            LHK     N  PS S       S+RLN RRSAMTNSLVRIGTVEGDLV+RALAALIRPSS
Sbjct  122  LHKAGFANNGVPSSSQAATCGSSSRLNMRRSAMTNSLVRIGTVEGDLVRRALAALIRPSS  181

Query  325  HQQRRRGDFQPRPSRLSRMSKA  260
            HQQRRRG+F+PRPSRLS MSKA
Sbjct  182  HQQRRRGEFRPRPSRLSVMSKA  203



>gb|AAN62344.1|AF506028_11 CTV.15 [Citrus trifoliata]
Length=206

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  655  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPGRSISYTRQISKSNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  478  HKNMNSRPS------ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  317
            HK  NS  S        Y S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYSSHKTASSSHYSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  316  RRRGDFQPRPSRLSRMSKAEE  254
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSIMSKADD  205



>ref|XP_010033986.1| PREDICTED: uncharacterized protein LOC104423200 [Eucalyptus grandis]
 gb|KCW53871.1| hypothetical protein EUGRSUZ_J03089 [Eucalyptus grandis]
Length=204

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 4/98 (4%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRP---SISYPSNR-LNARRSAMTNSLVRIGTVEGD  368
            KKTC+CSPTSHPGSFRC+LHKN  S P   S +Y S+R LN RRSAMTNSLVRIG VEGD
Sbjct  106  KKTCMCSPTSHPGSFRCALHKNSRSNPQHHSGTYNSSRSLNFRRSAMTNSLVRIGGVEGD  165

Query  367  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            LVKRALAALIRPSSHQ RRR DF+PRPSRLS MS AE+
Sbjct  166  LVKRALAALIRPSSHQLRRRADFKPRPSRLSTMSSAED  203



>ref|XP_006350113.1| PREDICTED: uncharacterized protein LOC102599166 [Solanum tuberosum]
Length=164

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 14/132 (11%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            +RF++DR  SP RS+SV  R +          +A+  KKTC+CSPT+HPGSFRCS+HK M
Sbjct  37   IRFTLDRETSPSRSISVMNRQKT---------MASSQKKTCMCSPTNHPGSFRCSMHKKM  87

Query  466  NSRPS-----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            ++R S      +  S RL+ RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR D
Sbjct  88   DNRRSSNTSQTASNSIRLHMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRSD  147

Query  301  FQPRPSRLSRMS  266
            FQ RPSRLS +S
Sbjct  148  FQRRPSRLSVIS  159



>ref|XP_004507199.1| PREDICTED: uncharacterized protein LOC101499615, partial [Cicer 
arietinum]
Length=175

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 98/145 (68%), Gaps = 10/145 (7%)
 Frame = -1

Query  691  AVELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL---PKKTCL  521
            A   H    S    SV FS D  +SP+ S+S +         G G  +  L    K+TC+
Sbjct  37   ATFFHRSTFSVQASSVLFSFDSCVSPNSSISFTV-------SGTGETVKRLNHRKKRTCM  89

Query  520  CSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  341
            CSP++HPGSFRCS HK++ S  +++Y  NRLNARRSAMTNSLVRI  VEG+LVK+ALA+L
Sbjct  90   CSPSTHPGSFRCSFHKSLGSGAAVTYAPNRLNARRSAMTNSLVRIRGVEGELVKKALASL  149

Query  340  IRPSSHQQRRRGDFQPRPSRLSRMS  266
            IRPSSH QRRR DFQPRPS+ S M+
Sbjct  150  IRPSSHNQRRRYDFQPRPSQKSLMT  174



>ref|XP_008813132.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
 ref|XP_008813133.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
 ref|XP_008813135.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
Length=218

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 102/145 (70%), Gaps = 8/145 (6%)
 Frame = -1

Query  670  ASSTPTPSVRFSIDRSISPHr-svsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            AS  P PSVRFS+D+   P     S++  D  +  + + +P     ++TC+CSPT+HPGS
Sbjct  75   ASPAPVPSVRFSLDQHRRPTSPGRSLAVADHHLSPRPISSPAPQ--RRTCMCSPTNHPGS  132

Query  493  FRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            FRCSLHK +   P     +   PSNRLNARRSAMTNSLVRIGTVEG+ VKRAL ALIRPS
Sbjct  133  FRCSLHKGIQLHPYRQNHAAFSPSNRLNARRSAMTNSLVRIGTVEGEWVKRALTALIRPS  192

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR  F PR SRLS MSKA++
Sbjct  193  SHQQRRRAAFHPRQSRLSVMSKADD  217



>ref|XP_004251739.1| PREDICTED: uncharacterized protein LOC101264293 [Solanum lycopersicum]
Length=164

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 96/132 (73%), Gaps = 14/132 (11%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            +RF++DR  SP RS+SV  R            LA+  KK C+CSPT+HPGSFRCS+HK M
Sbjct  37   IRFTLDRETSPSRSISVMNRQ---------KTLASSQKKRCMCSPTNHPGSFRCSMHKKM  87

Query  466  NSRPSISYP-----SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            + R S S       S RL+ RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR D
Sbjct  88   DIRRSSSTSQTASNSIRLHMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRSD  147

Query  301  FQPRPSRLSRMS  266
            FQ RPSRLS +S
Sbjct  148  FQRRPSRLSVIS  159



>ref|XP_004157087.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218391 
[Cucumis sativus]
Length=214

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 15/145 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            ++S + T SVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPG
Sbjct  78   YSSPSLTSSVRFXIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPG  127

Query  496  SFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPS
Sbjct  128  SFRCSLHKNVSSGGGHSQVVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPS  187

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR  FQPR SRLS MSKA +
Sbjct  188  SHQQRRRASFQPRSSRLSVMSKAAD  212



>ref|XP_007224858.1| hypothetical protein PRUPE_ppa022839mg, partial [Prunus persica]
 gb|EMJ26057.1| hypothetical protein PRUPE_ppa022839mg, partial [Prunus persica]
Length=146

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -1

Query  541  LPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDL  365
            +PKKTC+CSP SHPGSFRCSLHKN+    + + YP+NRLN RRS MTNSLVRIG VEG+ 
Sbjct  50   MPKKTCMCSPMSHPGSFRCSLHKNIGGGHNAAPYPTNRLNMRRSTMTNSLVRIGGVEGEW  109

Query  364  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            VK+AL ALIRP +HQQRRR  FQPRPSRLS MS A++
Sbjct  110  VKQALTALIRPCAHQQRRRAGFQPRPSRLSAMSTADK  146



>ref|XP_011017923.1| PREDICTED: uncharacterized protein LOC105121103 [Populus euphratica]
Length=212

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 10/150 (7%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V ++G ++ +P+ SVR +   ++SP+RS+S     +    Q V  P  + PK+TC+CSPT
Sbjct  68   VNMYGHSTPSPSSSVRLN---AVSPNRSISTVNPSRSHHHQVVRKP--STPKQTCMCSPT  122

Query  508  SHPGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAA  344
            +HPGSFRCS HK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALAA
Sbjct  123  THPGSFRCSRHKGIGLGSSTSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALAA  182

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            LIRPSSHQQRRR  FQ RPSRLS MSKAE 
Sbjct  183  LIRPSSHQQRRRSAFQSRPSRLSVMSKAES  212



>gb|EYU25274.1| hypothetical protein MIMGU_mgv1a014567mg [Erythranthe guttata]
Length=185

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK-TCLCSPTSHPGSFRCSL  479
            +PS+RFS+DR  SP+RS+S + R         G P A   KK TC+CSPT+HPGSFRCSL
Sbjct  58   SPSLRFSMDRPGSPNRSISFTTRS--------GKPAAAPQKKQTCMCSPTNHPGSFRCSL  109

Query  478  HKN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  308
            HK      SR +    S+RLN RRSAM NSLVRIGTVEGDLV RALAALIRPSSH QRRR
Sbjct  110  HKPNKPTASRTASCGSSSRLNMRRSAMKNSLVRIGTVEGDLVTRALAALIRPSSHNQRRR  169

Query  307  GDFQPRPSRLSRMSKA  260
            G+F+PRPSRLS M+K+
Sbjct  170  GEFRPRPSRLSAMAKS  185



>ref|XP_006394776.1| hypothetical protein EUTSA_v10004807mg [Eutrema salsugineum]
 gb|ESQ32062.1| hypothetical protein EUTSA_v10004807mg [Eutrema salsugineum]
Length=253

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 19/147 (13%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTS  506
            F S+  T S R+SID RSISP+RS+             V  P +N +P  ++ C+CSPT+
Sbjct  118  FKSAPLTQSFRYSIDNRSISPNRSI------------AVSKPSSNKIPDSRRRCMCSPTT  165

Query  505  HPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            HPGSFRCSLHKN+   + + +++YP+N LN RRSAMTNSLVRIG VEG+ V+RAL ALIR
Sbjct  166  HPGSFRCSLHKNVANPHGQGAVTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTALIR  225

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  226  PSSHQLKRRSAYQPRPSRLSSMSKADD  252



>ref|XP_004145523.1| PREDICTED: uncharacterized protein LOC101218391 [Cucumis sativus]
 gb|KGN55469.1| hypothetical protein Csa_4G652810 [Cucumis sativus]
Length=214

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 15/145 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
            ++S + T SVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPG
Sbjct  78   YSSPSLTSSVRFFIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPG  127

Query  496  SFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            SFRCSLHKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPS
Sbjct  128  SFRCSLHKNVSSGGGHSQVVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPS  187

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQQRRR  FQPR SRLS MSKA +
Sbjct  188  SHQQRRRASFQPRSSRLSVMSKAAD  212



>ref|XP_007138468.1| hypothetical protein PHAVU_009G211700g [Phaseolus vulgaris]
 gb|ESW10462.1| hypothetical protein PHAVU_009G211700g [Phaseolus vulgaris]
Length=196

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            K+TC+CSPT+HPGSFRCSLHKN  SRP+   Y  N  N RRSAMTNSLVRI  VEGDLVK
Sbjct  100  KRTCMCSPTTHPGSFRCSLHKNFASRPTPPQYSPNGFNVRRSAMTNSLVRIRGVEGDLVK  159

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RALA+LIRPSSHQQRRRGDF+   SRLS MSKAEE
Sbjct  160  RALASLIRPSSHQQRRRGDFRQLRSRLSLMSKAEE  194



>ref|XP_010097160.1| hypothetical protein L484_025705 [Morus notabilis]
 gb|EXB67227.1| hypothetical protein L484_025705 [Morus notabilis]
Length=199

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISP-HrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            V ++G +SS  + SVRF++DR+ISP  RS+SV+++       G GN   +  +KTC+CSP
Sbjct  48   VTMYGGSSSPSSRSVRFAVDRTISPGRRSMSVTKQRNGGAGNGNGNGTVSKQRKTCMCSP  107

Query  511  TSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  347
            T+HPGSFRCSLHK+          S++  S RLN  RSAM NSL+RIG VEGDL+KR+L+
Sbjct  108  TTHPGSFRCSLHKSSPRGGGLQTSSLNSNSRRLNLMRSAMVNSLIRIGVVEGDLMKRSLS  167

Query  346  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ALIRPSSHQQRRR  FQPRPSRLS MS+AE+
Sbjct  168  ALIRPSSHQQRRRAAFQPRPSRLSVMSRAED  198



>ref|XP_011073376.1| PREDICTED: uncharacterized protein LOC105158345 [Sesamum indicum]
Length=203

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = -1

Query  550  LANLPKKTCLCSPTSHPGSFRCSLHKN----------MNSRPSISYPSNRLNARRSAMTN  401
            L + PKKTC+CSPT+HPGSFRCSLHKN            S  S    S+ LN RRSAMTN
Sbjct  94   LNSGPKKTCMCSPTTHPGSFRCSLHKNSIVPGYGTGNHTSSSSSYRSSHHLNMRRSAMTN  153

Query  400  SLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SLVRIGTVEGDLVKRALAALIRPSSH  RRR DFQPRPSRLS MSKAE+
Sbjct  154  SLVRIGTVEGDLVKRALAALIRPSSHSLRRRADFQPRPSRLSVMSKAED  202



>ref|XP_009596910.1| PREDICTED: uncharacterized protein LOC104092917 [Nicotiana tomentosiformis]
Length=178

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 8/107 (7%)
 Frame = -1

Query  550  LANLPKKTCLCSPTSHPGSFRCSLHKNMNSR------PSISY--PSNRLNARRSAMTNSL  395
            +++  K TC+CSPT+HPGSFRCS+HK M+ R       S+SY   SNRLN RRSAMTNSL
Sbjct  68   MSSQKKMTCMCSPTTHPGSFRCSMHKKMDVRRSSATTSSLSYGSNSNRLNTRRSAMTNSL  127

Query  394  VRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            VRI TVEG++VKRALAALIRPSSHQQRRR  FQ RPSRLS MS+ ++
Sbjct  128  VRIVTVEGEIVKRALAALIRPSSHQQRRRYGFQRRPSRLSNMSRTDD  174



>ref|XP_011039624.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Populus 
euphratica]
Length=210

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 11/137 (8%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            +PS RFSIDRS SP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSFRCSLH
Sbjct  81   SPSFRFSIDRSTSPNRSISVS-------KKNRSHPIS-APKRTCMCSPTTHRGSFRCSLH  132

Query  475  KNMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            K  +S   P +  P +RLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRRG 
Sbjct  133  KKSSSSSNPEMFTP-HRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRGA  191

Query  301  FQPRPSRLSRMSKAEED  251
            FQPR SRLS M KA+++
Sbjct  192  FQPRQSRLSIMYKADDE  208



>ref|XP_002519910.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42514.1| conserved hypothetical protein [Ricinus communis]
Length=219

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = -1

Query  529  TCLCSPTSHPGSFRCSLHKNMNSRPS---ISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            TC+CSPT+HPGSFRCSLHKN NS       SY  NRLN RRSAM NSLVRIG VEG+ VK
Sbjct  122  TCMCSPTTHPGSFRCSLHKNNNSHQGNSLHSYTPNRLNMRRSAMKNSLVRIGGVEGEWVK  181

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            RAL  LIRPSSHQQRRR DFQPRPSRLS MSKA +D
Sbjct  182  RALTTLIRPSSHQQRRRCDFQPRPSRLSIMSKAGDD  217



>ref|XP_010665660.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Beta 
vulgaris subsp. vulgaris]
Length=217

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 103/148 (70%), Gaps = 15/148 (10%)
 Frame = -1

Query  676  GFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  497
              +S+T  PS R S++RS SP+  VS+         Q V  P   + K+TC+CSPT+HPG
Sbjct  77   NLSSTTTVPSFRISLNRSHSPNSRVSIR-------DQVVSKPA--ITKRTCMCSPTNHPG  127

Query  496  SFRCSLHKNMNSRP------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            SFRC++H+N +         S+S   +RLN RRSAMTNSLVRIGTVEGD VKRAL ALIR
Sbjct  128  SFRCAIHRNNSRNGGNSNSHSVSCSPSRLNLRRSAMTNSLVRIGTVEGDWVKRALTALIR  187

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            PSSHQQ+RR DFQ RPSRLS MSKA +D
Sbjct  188  PSSHQQKRRFDFQFRPSRLSIMSKANDD  215



>ref|XP_009616804.1| PREDICTED: uncharacterized protein LOC104109268 [Nicotiana tomentosiformis]
Length=201

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 99/144 (69%), Gaps = 17/144 (12%)
 Frame = -1

Query  667  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            S++P+PSVRFS    RSIS +              Q    P A+  KK C+CSPT+HPGS
Sbjct  66   SASPSPSVRFSTSPGRSISAYPRQP----------QQNRRPFASNQKKHCMCSPTTHPGS  115

Query  493  FRCSLHKNMNSR-----PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            FRCSLHKN N        S  + S++LN RRSAM NSLVRIGTVEGDL+KRALAALIRPS
Sbjct  116  FRCSLHKNTNQNRGQSHTSSYHSSHQLNMRRSAMKNSLVRIGTVEGDLLKRALAALIRPS  175

Query  328  SHQQRRRGDFQPRPSRLSRMSKAE  257
            SH  RRR +FQPRPSRLS MSKA+
Sbjct  176  SHHLRRRDNFQPRPSRLSIMSKAQ  199



>emb|CDX87091.1| BnaC09g04060D [Brassica napus]
Length=196

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (68%), Gaps = 15/148 (10%)
 Frame = -1

Query  673  FASS-TPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  503
            FASS     S R+SID  RSISP+             K   GN + +  ++ C+CSPT+H
Sbjct  55   FASSPLKQSSFRYSIDNTRSISPNHRSIAVS------KPSGGNKIPD-SRRRCMCSPTTH  107

Query  502  PGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            PGSFRCSLHKN+         + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL ALI
Sbjct  108  PGSFRCSLHKNVANPHGQGAAAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTALI  167

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSSHQ +RR  +QPRPSRLS MSKAE+
Sbjct  168  RPSSHQLKRRSAYQPRPSRLSSMSKAED  195



>ref|XP_006852817.1| hypothetical protein AMTR_s00033p00173430 [Amborella trichopoda]
 gb|ERN14284.1| hypothetical protein AMTR_s00033p00173430 [Amborella trichopoda]
Length=139

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 11/140 (8%)
 Frame = -1

Query  652  PSVRFSIDRSISPHrsvsvsrrdq-----vvRKQGVGNPLANL-PKKTCLCSPTSHPGSF  491
            P+VRFS+DRS SP RS++             ++  +GN    L P++TCLC+PT+HPGSF
Sbjct  3    PTVRFSLDRSRSPSRSIAGVMVSTRDRVLKKQQSPIGNRTPPLQPRRTCLCAPTNHPGSF  62

Query  490  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  311
            RCSLHK           + RL+ARRS+M NSLVRIG+VEG+ V+RAL ALIRPSSH Q+R
Sbjct  63   RCSLHKG-----GFGASNARLDARRSSMVNSLVRIGSVEGEWVRRALTALIRPSSHSQKR  117

Query  310  RGDFQPRPSRLSRMSKAEED  251
            R  FQPRPSRLS MSKA++D
Sbjct  118  RMSFQPRPSRLSVMSKADDD  137



>gb|KFK27780.1| hypothetical protein AALP_AA8G427900 [Arabis alpina]
Length=218

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 19/148 (13%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTS  506
            F S   T S R+SID RSISP+RS+             V  P ++ +P  ++ C+CSPT+
Sbjct  77   FTSPPLTQSFRYSIDNRSISPNRSI------------AVSKPTSHKIPDSRRRCMCSPTT  124

Query  505  HPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            HPGSFRCSLHKN+   + + +++YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIR
Sbjct  125  HPGSFRCSLHKNVANPHGQGAVTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIR  184

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            PSSHQ +RR  +QPR SRLS MSKAEE+
Sbjct  185  PSSHQLKRRSAYQPRRSRLSSMSKAEEE  212



>ref|XP_002324583.1| hypothetical protein POPTR_0018s12410g [Populus trichocarpa]
 gb|EEF03148.1| hypothetical protein POPTR_0018s12410g [Populus trichocarpa]
Length=212

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V ++G ++ +P+ SVR +   ++SP+RS+S     +    Q V     + PK+TC+CSP+
Sbjct  68   VNMYGHSTPSPSSSVRLN---AVSPNRSISTVNPSRSHNHQVVRK--QSTPKRTCMCSPS  122

Query  508  SHPGSFRCSLHKNMNSRPSISYPSN-----RLNARRSAMTNSLVRIGTVEGDLVKRALAA  344
            +HPGSFRCSLHK      S S  +      RLNARRSAMTNSLVRIG VEGDLV+RALA+
Sbjct  123  THPGSFRCSLHKGTGFGSSTSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALAS  182

Query  343  LIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            LIRPSSHQQRRR  FQ RPSRLS MSKAE
Sbjct  183  LIRPSSHQQRRRTAFQSRPSRLSVMSKAE  211



>ref|XP_008445241.1| PREDICTED: uncharacterized protein LOC103488327 [Cucumis melo]
Length=199

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 96/145 (66%), Gaps = 22/145 (15%)
 Frame = -1

Query  667  SSTP-TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            SSTP + SVRFSI  RS SP              K    N   +LPKK C+CSPT+HPGS
Sbjct  69   SSTPLSRSVRFSIGHRSGSP--------------KLSNRNSPVSLPKKPCMCSPTTHPGS  114

Query  493  FRCSLHKNMNS------RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            FRCSLHK   S        S +Y S  LN RRSAMTNSLVRIG VEGD VKRAL ALIRP
Sbjct  115  FRCSLHKKSGSGIHQHQASSSAYSSTGLNMRRSAMTNSLVRIGGVEGDWVKRALTALIRP  174

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAE  257
            SSHQ RRR +F+P+PSRLS MSKAE
Sbjct  175  SSHQLRRRANFRPQPSRLSVMSKAE  199



>ref|XP_008775758.1| PREDICTED: uncharacterized protein LOC103696036 [Phoenix dactylifera]
Length=190

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (71%), Gaps = 9/141 (6%)
 Frame = -1

Query  661  TPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP-KKTCLCSPTSHPGSFRC  485
            +P PSVRFS DR    HR  S  R       +      +++P ++TC+CSPT+HPGSFRC
Sbjct  53   SPVPSVRFSFDR----HRPTSPGRSLAFADHRSPRPITSSVPQRRTCMCSPTTHPGSFRC  108

Query  484  SLHKNMN----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  317
            SLHK +     S  ++S  SNRLNARRSAM NSLVRIGTVEG+ VKRAL ALIRPSSHQQ
Sbjct  109  SLHKGLGQLQHSHSAVSSSSNRLNARRSAMANSLVRIGTVEGEWVKRALTALIRPSSHQQ  168

Query  316  RRRGDFQPRPSRLSRMSKAEE  254
            RRR  FQPR SRLS MSKA++
Sbjct  169  RRRAAFQPRSSRLSVMSKADD  189



>ref|XP_010421380.1| PREDICTED: hypha-specific G1 cyclin-related protein 1-like [Camelina 
sativa]
Length=224

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 11/148 (7%)
 Frame = -1

Query  673  FASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTS  506
            F S+  T S R+SID  RSISP+RS++VS                 +P  ++ C+CSPT+
Sbjct  80   FTSAPMTQSFRYSIDNSRSISPNRSIAVSSNQPSNHHHHH----HKIPDSRRRCMCSPTT  135

Query  505  HPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            HPGSFRCSLHKN+   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIR
Sbjct  136  HPGSFRCSLHKNVANPHGQGATSYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIR  195

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            PSSHQ +RR  ++PR SRL+ MSKAEED
Sbjct  196  PSSHQLKRRAAYEPRRSRLASMSKAEED  223



>ref|XP_004488522.1| PREDICTED: uncharacterized protein LOC101494844 [Cicer arietinum]
Length=187

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = -1

Query  649  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP---KKTCLCSPTSHPGSFRCSL  479
            SV FS DR +SP+ S+SV+         G G  +  L    K TC+CSP++HPGSFRCS 
Sbjct  62   SVLFSFDRCVSPNSSISVTV-------SGTGETVKRLKHRQKPTCMCSPSTHPGSFRCSF  114

Query  478  HKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            HK++ S  +++Y  NRLN RRSAMTNSLVRI  VEG+LV+RALA+LIRPSSH QRRR DF
Sbjct  115  HKSLGSGSAVTYAPNRLNVRRSAMTNSLVRIRGVEGELVRRALASLIRPSSHNQRRRYDF  174

Query  298  QPRPSRL  278
            +PRPSR 
Sbjct  175  RPRPSRF  181



>ref|XP_009125255.1| PREDICTED: putative protein TPRXL [Brassica rapa]
 ref|XP_009125256.1| PREDICTED: putative protein TPRXL [Brassica rapa]
 ref|XP_009125257.1| PREDICTED: putative protein TPRXL [Brassica rapa]
Length=190

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 11/148 (7%)
 Frame = -1

Query  679  HGFASSTPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            H  AS TP P   S R+S+D RSISP    S+S   +   K    +P     ++ C+CSP
Sbjct  46   HRSASPTPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETSP----SRRRCMCSP  101

Query  511  TSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  341
            T+HPGSFRCSLHKN+   + + + SY  N LN RRSAMTNSLVRIG VEG+ V+RAL  L
Sbjct  102  TTHPGSFRCSLHKNVANPHGQGTASYTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTL  161

Query  340  IRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            IRPSSH  +RR  FQPRPSRLS MSKAE
Sbjct  162  IRPSSHHLKRRAAFQPRPSRLSVMSKAE  189



>ref|XP_010493781.1| PREDICTED: squamosa promoter-binding-like protein 18 [Camelina 
sativa]
Length=219

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 8/145 (6%)
 Frame = -1

Query  673  FASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  500
            FAS+  T S R+SID  RSISP+RS++VS             P +   ++ C+CSPT+HP
Sbjct  76   FASAPMTQSFRYSIDNSRSISPNRSIAVSSNKPTNHHHHHKIPDS---RRRCMCSPTTHP  132

Query  499  GSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            GSFRCSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPS
Sbjct  133  GSFRCSLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPS  192

Query  328  SHQQRRRGDFQPRPSRLSRMSKAEE  254
            SHQ +RR  ++PR SRL+ MSKAEE
Sbjct  193  SHQLKRRAAYEPRRSRLASMSKAEE  217



>ref|XP_004241685.1| PREDICTED: uncharacterized protein LOC101259944 [Solanum lycopersicum]
Length=197

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 16/144 (11%)
 Frame = -1

Query  667  SSTPTPSVRFSI--DRSISPHrsvsvsrrdqvvRKQGVGNPL--ANLPKKTCLCSPTSHP  500
            S +P+PSVRFS   +RSIS              + Q   +PL  ++  KK C CSPT+HP
Sbjct  56   SVSPSPSVRFSSSNNRSIS----------VFPRKPQQNRHPLPSSSNQKKHCTCSPTTHP  105

Query  499  GSFRCSLHKNMNSRPS-ISYPSNR-LNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            GSFRCSLH+   +R    SY S+  LN RRSAMTNSLVRIG VEG+LVKRALAALIRPSS
Sbjct  106  GSFRCSLHRKTTNRSDGQSYHSSHPLNMRRSAMTNSLVRIGAVEGELVKRALAALIRPSS  165

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQ RRR DFQP+PSRLS MSKAE+
Sbjct  166  HQLRRRCDFQPKPSRLSVMSKAED  189



>ref|XP_008228742.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Prunus 
mume]
Length=212

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 79/103 (77%), Gaps = 11/103 (11%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM-----------NSRPSISYPSNRLNARRSAMTNSLVR  389
            KKTCLCSPT+HPGSFRC+LHKN            N R S  + S RLN RRSAM NSLVR
Sbjct  102  KKTCLCSPTTHPGSFRCALHKNSPSGGAAHHLNSNGRTSSYHSSIRLNYRRSAMKNSLVR  161

Query  388  IGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  260
            IG VEGDLVKRAL+ALIRPSSH Q+R+ DFQP+PSRLS MSKA
Sbjct  162  IGGVEGDLVKRALSALIRPSSHSQKRKVDFQPKPSRLSVMSKA  204



>ref|XP_009401387.1| PREDICTED: uncharacterized protein LOC103985422 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 96/142 (68%), Gaps = 24/142 (17%)
 Frame = -1

Query  658  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  479
            P P +RFS+DRSIS               K+    P     ++TCLCSP++HPGSFRCSL
Sbjct  53   PAPPLRFSLDRSIS----------YGCSLKRSPAAPA----RRTCLCSPSTHPGSFRCSL  98

Query  478  HKNMNSR-PS------ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            HK ++   PS       + PSNRLNARRSAM NSLVRIG VEG+ VKRAL   IRPSSHQ
Sbjct  99   HKGLDHHNPSHVVAAAAASPSNRLNARRSAMANSLVRIGAVEGEWVKRAL---IRPSSHQ  155

Query  319  QRRRGDFQPRPSRLSRMSKAEE  254
            QRRR +FQPRP+RLSRMSKA +
Sbjct  156  QRRRTNFQPRPTRLSRMSKAVQ  177



>ref|XP_006288644.1| hypothetical protein CARUB_v10001949mg [Capsella rubella]
 gb|EOA21542.1| hypothetical protein CARUB_v10001949mg [Capsella rubella]
Length=214

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 15/146 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSH  503
            F S+  T S R+SID RSISP+RS++VS   Q   K         +P  ++ C+CSPT+H
Sbjct  77   FTSAPMTQSFRYSIDNRSISPNRSIAVSSNKQSNHK---------IPDSRRRCMCSPTTH  127

Query  502  PGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            PGSFRCSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRP
Sbjct  128  PGSFRCSLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRP  187

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQ +RR  ++PR SRL+ MSKAE+
Sbjct  188  SSHQLKRRAAYEPRRSRLASMSKAED  213



>ref|XP_006399610.1| hypothetical protein EUTSA_v10014629mg [Eutrema salsugineum]
 gb|ESQ41063.1| hypothetical protein EUTSA_v10014629mg [Eutrema salsugineum]
Length=219

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 9/137 (7%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S R+S+D RSISP      +R   V +KQ   +   +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  88   SFRYSLDSRSISP-----TNRSISVSKKQQPSSHKISETRRRCMCSPTTHPGSFRCSLHK  142

Query  472  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N+   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  143  NVANPHGQGAASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  202

Query  301  FQPRPSRLSRMSKAEED  251
            +QPRPSRLS MSKA+++
Sbjct  203  YQPRPSRLSIMSKADDN  219



>emb|CDX70380.1| BnaC03g04640D [Brassica napus]
Length=221

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            + FS+D RSISP  +       +  +   + +P      + C+CSPT+HPGSFRCSLHKN
Sbjct  90   IAFSLDTRSISPTTTNRSISVTKKPQPSKISSP------RRCMCSPTTHPGSFRCSLHKN  143

Query  469  M---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            +   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  RRR  +
Sbjct  144  VANPHGQGTASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLRRRAAY  203

Query  298  QPRPSRLSRMSKAEED  251
            QPRPSRLS MSKA  +
Sbjct  204  QPRPSRLSTMSKAATE  219



>ref|XP_007014526.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY32145.1| Serine-rich protein-related [Theobroma cacao]
Length=208

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 12/131 (9%)
 Frame = -1

Query  643  RFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN--  470
            RFSI+RSISP+RS+SVS+           NPL+  PK+TC+CSPT+HPGSFRCSLHKN  
Sbjct  87   RFSINRSISPNRSISVSKG---------SNPLSIPPKRTCMCSPTTHPGSFRCSLHKNSQ  137

Query  469  -MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  293
              ++  + SYPSNRLN RRSAMTNSLVRIG VEGD VKRAL ALIRPSSHQQRRR  F+P
Sbjct  138  NADANYTASYPSNRLNIRRSAMTNSLVRIGGVEGDWVKRALTALIRPSSHQQRRRAAFRP  197

Query  292  RPSRLSRMSKA  260
            RPSRLS +S++
Sbjct  198  RPSRLSVLSES  208



>ref|XP_008454197.1| PREDICTED: putative protein TPRXL [Cucumis melo]
Length=199

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S+RF ID RS SP              +    N + +  +K C+CSPT HPGSFRCSLHK
Sbjct  64   SLRFQIDQRSASP-----SRSISVQKNRDSNANAVPSNKRKVCVCSPTKHPGSFRCSLHK  118

Query  472  NMNSRPSISYPSN----RLNARRSAMTNSLVRIGTVEG-DLVKRALAALIRPSSHQQRRR  308
            N      +S  S      LN RRSAMTNSLVRIG VEG DLVKRAL+ALIRPSSHQQRR 
Sbjct  119  NSTHSVDVSNGSQLRNGSLNVRRSAMTNSLVRIGCVEGADLVKRALSALIRPSSHQQRRP  178

Query  307  GDFQPRPSRLSRMSKAEED  251
              FQ RPSRLS MSKAEE+
Sbjct  179  SAFQRRPSRLSLMSKAEEE  197



>gb|EYU21687.1| hypothetical protein MIMGU_mgv1a024748mg [Erythranthe guttata]
Length=97

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 6/95 (6%)
 Frame = -1

Query  523  LCSPTSHPGSFRCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  362
            +CSPT+HPGSFRCSLHK+       ++ PS    S++LN RRSAMTNSLVRIGTVEGDLV
Sbjct  1    MCSPTTHPGSFRCSLHKSSAAAAGYSNHPSSYRSSHQLNMRRSAMTNSLVRIGTVEGDLV  60

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            +RALAALIRPSSH  RRR DFQPRPSRLS MSKA+
Sbjct  61   RRALAALIRPSSHNLRRRFDFQPRPSRLSVMSKAD  95



>ref|XP_008364364.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Malus 
domestica]
Length=190

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKN--MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  362
            K+TCLCSPT+HPGSFRC+LHKN     + S  + S  LN RRSAM NSLVRIG VEGDLV
Sbjct  92   KRTCLCSPTTHPGSFRCALHKNSPRAGQSSSYHSSISLNYRRSAMKNSLVRIGGVEGDLV  151

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            KRAL+ALIRPSSH QRRR DFQP+PSRLS MSKA +D
Sbjct  152  KRALSALIRPSSHSQRRRVDFQPKPSRLSAMSKASDD  188



>ref|XP_010454851.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=219

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 103/147 (70%), Gaps = 13/147 (9%)
 Frame = -1

Query  673  FASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTS  506
            F S+  T S R+SID  RSISP+RS++VS                 +P  ++ C+CSPT+
Sbjct  77   FTSAPMTQSFRYSIDNSRSISPNRSIAVSSNKPSNHHHH------KIPDSRRRCMCSPTT  130

Query  505  HPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            HPGSFRCSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIR
Sbjct  131  HPGSFRCSLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIR  190

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQ +RR  ++PR SRL+ MSKAEE
Sbjct  191  PSSHQLKRRAAYEPRRSRLASMSKAEE  217



>ref|XP_009131193.1| PREDICTED: cell wall integrity and stress response component 
1-like [Brassica rapa]
 emb|CDX78410.1| BnaA03g03220D [Brassica napus]
Length=222

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = -1

Query  646  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            + FS+D RSISP  +       +  +   + +P      + C+CSPT+HPGSFRCSLHKN
Sbjct  91   IAFSLDTRSISPTTTNRSISVAKKPQPSKISSP------RRCMCSPTTHPGSFRCSLHKN  144

Query  469  M---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  299
            +   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  RRR  +
Sbjct  145  VANPHGQGTASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLRRRAAY  204

Query  298  QPRPSRLSRMSKAEED  251
            QPRPSRLS MSKA  +
Sbjct  205  QPRPSRLSIMSKAATE  220



>ref|XP_009151048.1| PREDICTED: uncharacterized protein LOC103874389 [Brassica rapa]
 ref|XP_009151049.1| PREDICTED: uncharacterized protein LOC103874389 [Brassica rapa]
Length=207

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 19/147 (13%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTS  506
            F S+    S R+SID RS+SP++SV             V  P  N +P  ++ C+CSPT+
Sbjct  72   FTSTPLNQSFRYSIDNRSVSPNQSV------------AVSKPSGNKIPDSRRRCMCSPTT  119

Query  505  HPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
            HPGSFRCSLHKN+   + + + +Y +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIR
Sbjct  120  HPGSFRCSLHKNVANPHGQGAATYSTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIR  179

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            PSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  180  PSSHQLKRRSAYQPRPSRLSSMSKADD  206



>ref|XP_007023329.1| Serine-rich protein-related, putative [Theobroma cacao]
 gb|EOY25951.1| Serine-rich protein-related, putative [Theobroma cacao]
Length=216

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 93/144 (65%), Gaps = 18/144 (13%)
 Frame = -1

Query  646  VRFSI-DRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  470
            VRFSI DR ISP                 V     +   +TCLCSPT+HPGSFRCSLHK 
Sbjct  77   VRFSINDRPISP-----GRSISFNKNNNAVSTGAHHQRSRTCLCSPTTHPGSFRCSLHKG  131

Query  469  M----------NSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
            +          N +P+ S  + S+ L+ RRSAM NSLVRIG VEG+LVKRAL ALIRPSS
Sbjct  132  LSMSRDHHHQNNRQPTTSSFHSSSALHFRRSAMKNSLVRIGGVEGELVKRALTALIRPSS  191

Query  325  HQQRRRGDFQPRPSRLSRMSKAEE  254
            HQQRRR  F+PRPSRLS MSKA++
Sbjct  192  HQQRRRAAFEPRPSRLSVMSKADD  215



>ref|XP_009111663.1| PREDICTED: uncharacterized protein LOC103837086 [Brassica rapa]
Length=191

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVE  374
            ++ C+CSPT+HPGSFRCSLHKN+       +  + +YP+N LN RRSAMTNSLVRIG VE
Sbjct  91   RRRCMCSPTTHPGSFRCSLHKNVANPHGQGAATAAAYPTNSLNMRRSAMTNSLVRIGGVE  150

Query  373  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            G+ V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  151  GEWVRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  190



>ref|XP_010040344.1| PREDICTED: uncharacterized protein LOC104429140 [Eucalyptus grandis]
Length=197

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 94/148 (64%), Gaps = 21/148 (14%)
 Frame = -1

Query  688  VELHGFASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  509
            V LH  A   P+PS+RF++DR  SP        + Q   + G G                
Sbjct  67   VNLHSPA--QPSPSIRFALDRPTSP-SRSISVSQQQRRGRTGGGQ---------------  108

Query  508  SHPGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  335
             +PGSFRCSLHK   S PS S  Y  NRLNARRSAMTNSLVRIG VEGDLVKRALAALIR
Sbjct  109  LYPGSFRCSLHKGCGS-PSASAGYAPNRLNARRSAMTNSLVRIGGVEGDLVKRALAALIR  167

Query  334  PSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            PSSHQQRRR  FQPR SRLS MSKA E+
Sbjct  168  PSSHQQRRRAAFQPRQSRLSIMSKAAEE  195



>gb|ABL97972.1| serine-rich protein [Brassica rapa]
 emb|CDY19808.1| BnaA09g04610D [Brassica napus]
Length=193

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 95/140 (68%), Gaps = 22/140 (16%)
 Frame = -1

Query  649  SVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            S R+SID  RSI+             V K   GN + +  ++ C+CSPT+HPGSFRCSLH
Sbjct  67   SFRYSIDNTRSIA-------------VSKPSGGNKIPD-SRRRCMCSPTTHPGSFRCSLH  112

Query  475  KNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
            KN+       +  + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  113  KNVANPHGQGAATAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  172

Query  313  RRGDFQPRPSRLSRMSKAEE  254
            RR  +QPRPSRLS MSKA++
Sbjct  173  RRSAYQPRPSRLSSMSKADD  192



>ref|XP_002872151.1| hypothetical protein ARALYDRAFT_489379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48410.1| hypothetical protein ARALYDRAFT_489379 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 14/146 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSH  503
            F S+  T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+H
Sbjct  81   FTSAPMTQSFRYSIDNRSISPNRSIAVSSNKPSNHHK--------IPDSRRRCMCSPTTH  132

Query  502  PGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            PGSFRCSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRP
Sbjct  133  PGSFRCSLHKNVANPHGQGTGTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRP  192

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQ +RR  ++PR SRL+ MSKAE+
Sbjct  193  SSHQLKRRSAYEPRRSRLASMSKAED  218



>gb|EPS66146.1| hypothetical protein M569_08632, partial [Genlisea aurea]
Length=182

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 94/143 (66%), Gaps = 24/143 (17%)
 Frame = -1

Query  661  TPTPSVRFSIDR--SISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  488
            +P+PSVRFS  R  +I+ H                   PL +  KKTCLCSPT+HPGSFR
Sbjct  55   SPSPSVRFSASRRQTIASHHQH---------------RPLNSGGKKTCLCSPTNHPGSFR  99

Query  487  CSLHK-------NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  329
            CSLHK       N  ++ +     ++L+ +RSAMTNSLVRIGTVEGDLVKRALA+LIRPS
Sbjct  100  CSLHKKNLMPGYNHGNQTTPYRSGHQLHLQRSAMTNSLVRIGTVEGDLVKRALASLIRPS  159

Query  328  SHQQRRRGDFQPRPSRLSRMSKA  260
             H  RRR DF PRPSRLS MSKA
Sbjct  160  LHSLRRRSDFVPRPSRLSLMSKA  182



>emb|CDX97080.1| BnaC09g45450D [Brassica napus]
Length=198

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  362
            C+CSPT+HPGSFRCSLHKN+         S SYP+N LN RRSAMTNSLVRIG VEG+ V
Sbjct  101  CMCSPTTHPGSFRCSLHKNVANPHGQGAASSSYPTNSLNMRRSAMTNSLVRIGGVEGEWV  160

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            +RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  161  RRALTTLIRPSSHHLRRRAAYQPRPSRLSIMSKATE  196



>ref|XP_009121994.1| PREDICTED: putative protein TPRXL [Brassica rapa]
Length=224

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 75/98 (77%), Gaps = 5/98 (5%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD  368
            + C+CSPT+HPGSFRCSLHKN+         S SYP+N LN RRSAMTNSLVRIG VEG+
Sbjct  125  RRCMCSPTTHPGSFRCSLHKNVANPHGQGASSSSYPTNSLNMRRSAMTNSLVRIGGVEGE  184

Query  367  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
             V+RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  185  WVRRALTTLIRPSSHHLRRRAAYQPRPSRLSNMSKATE  222



>ref|XP_006288623.1| hypothetical protein CARUB_v10001925mg [Capsella rubella]
 gb|EOA21521.1| hypothetical protein CARUB_v10001925mg [Capsella rubella]
Length=219

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 95/137 (69%), Gaps = 12/137 (9%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S R+S+D RSISP        ++Q         P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  89   SFRYSLDSRSISPTNRSISVTKNQP--------PKISETRRRCMCSPTTHPGSFRCSLHK  140

Query  472  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  141  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  200

Query  301  FQPRPSRLSRMSKAEED  251
            +QPRPSRLS M+KA+E+
Sbjct  201  YQPRPSRLSIMAKADEN  217



>ref|NP_197910.1| serine-rich protein-like protein [Arabidopsis thaliana]
 ref|NP_851072.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AAK83595.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AAK97665.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AAL31101.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AED93421.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AED93422.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=220

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 14/146 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSH  503
            F S+  T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+H
Sbjct  82   FTSAPMTQSFRYSIDNRSISPNRSIAVSSNKPSNHHK--------IPDSRRRCMCSPTTH  133

Query  502  PGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            PGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRP
Sbjct  134  PGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRP  193

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQ +RR  ++PR SRL+ MSKAE+
Sbjct  194  SSHQLKRRSAYEPRRSRLASMSKAED  219



>gb|AFB32810.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
 gb|AFB32811.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
Length=143

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGGVEGEWVR  108

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RAL ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  109  RALTALIRPSSHHTRRRTSFQPRPSRLCHMTTAQD  143



>ref|XP_010419664.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=214

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S R+S+D RSISP    S+S       K      ++   ++ C+CSPT+HPGSFRCSLHK
Sbjct  86   SFRYSLDSRSISPTNHRSISVSKNQAPK------MSESSRRRCMCSPTTHPGSFRCSLHK  139

Query  472  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  140  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  199

Query  301  FQPRPSRLSRMSKAE  257
            +QPRPSRLS M+KA+
Sbjct  200  YQPRPSRLSTMAKAD  214



>gb|AAM67211.1| serine-rich protein [Arabidopsis thaliana]
Length=220

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 14/146 (10%)
 Frame = -1

Query  673  FASSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSH  503
            F S+  T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+H
Sbjct  82   FTSAPMTQSFRYSIDNRSISPNRSIAVSSNIPSNHHK--------IPDSRRRCMCSPTTH  133

Query  502  PGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  332
            PGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRP
Sbjct  134  PGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRP  193

Query  331  SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            SSHQ +RR  ++PR SRL+ MSKAE+
Sbjct  194  SSHQLKRRSAYEPRRSRLASMSKAED  219



>emb|CDX69786.1| BnaA10g21350D [Brassica napus]
Length=194

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 5/98 (5%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD  368
            + C+CSPT+HPGSFRCSLHKN+         S +YP+N LN RRSAMTNSLVRIG VEG+
Sbjct  95   RRCMCSPTTHPGSFRCSLHKNVANPHGQGASSSAYPTNSLNMRRSAMTNSLVRIGGVEGE  154

Query  367  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
             V+RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  155  WVRRALTTLIRPSSHHLRRRAAYQPRPSRLSIMSKATE  192



>ref|XP_009338490.1| PREDICTED: putative protein TPRXL [Pyrus x bretschneideri]
Length=248

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 79/106 (75%), Gaps = 11/106 (10%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKN-----------MNSRPSISYPSNRLNARRSAMTNSLVR  389
            K+TCLCSPT+HPGSFRC+LHKN              + S  + S  LN RRSAM NSLVR
Sbjct  141  KRTCLCSPTTHPGSFRCALHKNSPPGGAAHQSHCGGQSSSYHSSISLNYRRSAMKNSLVR  200

Query  388  IGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            IG VEGDLVKRAL+ALIRPSSH QRRR DFQP+PSRLS MSKA +D
Sbjct  201  IGGVEGDLVKRALSALIRPSSHSQRRRVDFQPKPSRLSVMSKASDD  246



>gb|AFG60223.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60225.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60226.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60227.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60228.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60229.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60230.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60231.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60232.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60235.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60237.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
Length=143

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG+VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGSVEGEWVR  108

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            R L ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  109  RTLTALIRPSSHNTRRRTSFQPRPSRLCHMTTAQD  143



>emb|CDX88167.1| BnaA06g27580D [Brassica napus]
Length=184

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  365
            ++ C+CSPT+HPGSFRCSLHKN+   + + + +Y +N LN RRSAMTNSLVRIG VEG+ 
Sbjct  87   RRRCMCSPTTHPGSFRCSLHKNVANPHGQGAATYSTNGLNMRRSAMTNSLVRIGGVEGEW  146

Query  364  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  147  VRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  183



>emb|CDX85730.1| BnaA02g00830D [Brassica napus]
Length=233

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = -1

Query  679  HGFASSTPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  512
            H  AS TP P   S R+S+D RSISP    S+S   +   K    +P     ++ C+CSP
Sbjct  46   HRSASPTPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETSP----SRRRCMCSP  101

Query  511  TSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  341
            T+HPGSFRCSLHKN+   + + + SY  N LN RRSAMTNSLVRIG VEG+ V+RAL  L
Sbjct  102  TTHPGSFRCSLHKNVANPHGQGTASYTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTL  161

Query  340  IRPSSHQQRRRGDFQPRPSRLSRMS  266
            IRPSSH  +RR  FQPRPSRLS M+
Sbjct  162  IRPSSHHLKRRAAFQPRPSRLSVMT  186



>gb|AFB32809.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
Length=138

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG VEG+ V+
Sbjct  45   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGGVEGEWVR  103

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            R L ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  104  RVLTALIRPSSHHTRRRTSFQPRPSRLCHMTTAQD  138



>ref|NP_196670.1| serine-rich protein-like protein [Arabidopsis thaliana]
 emb|CAC03457.1| putative protein [Arabidopsis thaliana]
 gb|AAM64778.1| serine-rich protein [Arabidopsis thaliana]
 gb|AAO44074.1| At5g11090 [Arabidopsis thaliana]
 dbj|BAE99719.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91634.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=217

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            C+CSPT+HPGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+R
Sbjct  123  CMCSPTTHPGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRR  182

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            AL  LIRPSSH  +RR  +QPRPSRLS M+KA+E+
Sbjct  183  ALTTLIRPSSHHLKRRAAYQPRPSRLSIMAKADEN  217



>ref|XP_004152334.1| PREDICTED: uncharacterized protein LOC101207294 [Cucumis sativus]
 ref|XP_004165079.1| PREDICTED: uncharacterized protein LOC101224572 [Cucumis sativus]
 gb|KGN52922.1| hypothetical protein Csa_4G006290 [Cucumis sativus]
Length=189

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S+RF  D RS SP R     ++++      V    +N  K  C+CSPT HPGSFRCSLHK
Sbjct  52   SLRFQTDQRSASPSRRSVSVQKNRDSNANAVP---SNKKKVMCMCSPTKHPGSFRCSLHK  108

Query  472  NMNSRPSISYPSN----RLNARRSAMTNSLVRIGTVEG-DLVKRALAALIRPSSHQQRRR  308
            N      IS  S      LN RRSAMTNSLVRI  VEG DLVKRAL+ALIRPSSHQQRR+
Sbjct  109  NSTHSIDISNGSQFRNVSLNIRRSAMTNSLVRIECVEGADLVKRALSALIRPSSHQQRRQ  168

Query  307  GDFQPRPSRLSRMSKAEED  251
              FQ RPS LS MSKAEE+
Sbjct  169  SAFQRRPSHLSVMSKAEEE  187



>gb|AFG60224.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60233.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60234.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60236.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
Length=143

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG+VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGSVEGEWVR  108

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            R L ALIRPSSH  RRR  FQP+PSRL  M+ A++
Sbjct  109  RTLTALIRPSSHNTRRRTSFQPQPSRLCHMTTAQD  143



>ref|XP_010491804.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=216

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 11/135 (8%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S R+S+D RSISP    S+S             P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  89   SFRYSLDSRSISPTNHRSISVSKNQP-------PKISESRRRCMCSPTTHPGSFRCSLHK  141

Query  472  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  142  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  201

Query  301  FQPRPSRLSRMSKAE  257
            +QPRPSRLS M+KA+
Sbjct  202  YQPRPSRLSSMAKAD  216



>emb|CDX80497.1| BnaC07g29470D [Brassica napus]
Length=206

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD  368
            ++ C+CSPT+HPGSFRCSLHKN+        + +Y +N LN RRSAMTNSLVRIG VEG+
Sbjct  108  RRRCMCSPTTHPGSFRCSLHKNVANPHGQGSAATYSTNGLNMRRSAMTNSLVRIGGVEGE  167

Query  367  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
             V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  168  WVRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  205



>ref|XP_010456484.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=229

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 11/135 (8%)
 Frame = -1

Query  649  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  473
            S R+S+D RSISP    S+S             P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  102  SFRYSLDSRSISPTNHRSISVSKNQP-------PKMSESRRRCMCSPTTHPGSFRCSLHK  154

Query  472  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  302
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  155  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  214

Query  301  FQPRPSRLSRMSKAE  257
            +QPRPSRLS M+KA+
Sbjct  215  YQPRPSRLSAMAKAD  229



>gb|AEW07499.1| hypothetical protein 0_3046_01, partial [Pinus radiata]
Length=143

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRI +VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIRSVEGEWVR  108

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            R LAALIRPSSH  RRR  FQPRP+RL  M+ A++
Sbjct  109  RTLAALIRPSSHNTRRRTSFQPRPNRLCHMTTAQD  143



>ref|XP_002871454.1| hypothetical protein ARALYDRAFT_487941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47713.1| hypothetical protein ARALYDRAFT_487941 [Arabidopsis lyrata subsp. 
lyrata]
Length=223

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  365
            ++ C+CSPT+HPGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ 
Sbjct  125  RRRCMCSPTTHPGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEW  184

Query  364  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            V+RAL  LIRPSSH  +RR  +QPRPSRLS M+K++++
Sbjct  185  VRRALTTLIRPSSHHLKRRAAYQPRPSRLSIMAKSDDE  222



>emb|CDY51107.1| BnaCnng20100D [Brassica napus]
Length=228

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 93/139 (67%), Gaps = 7/139 (5%)
 Frame = -1

Query  661  TPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  494
            TP P   S R+S+D RSISP    S+S   +   K       +   ++ C+CSPT+HPGS
Sbjct  52   TPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETTTASPSRRRRCMCSPTTHPGS  111

Query  493  FRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            FRCSLHKN+   + + + S+  N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH
Sbjct  112  FRCSLHKNVANPHGQGTASFTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSH  171

Query  322  QQRRRGDFQPRPSRLSRMS  266
              RRR  FQPRPSRLS M+
Sbjct  172  HLRRRAAFQPRPSRLSVMT  190



>ref|XP_002530465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31935.1| conserved hypothetical protein [Ricinus communis]
Length=194

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 7/97 (7%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSR-----PSISY--PSNRLNARRSAMTNSLVRIGTV  377
            K+TC CSPT+HPGSFRC+ H+ M +R     P+ SY   S+RLN RRSAMTNSLVRIG V
Sbjct  96   KRTCACSPTNHPGSFRCAFHRAMTARNNSSTPTASYQHSSSRLNFRRSAMTNSLVRIGGV  155

Query  376  EGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMS  266
            EG+LVKRAL+ALIRPSSHQ RR   F+PRPSRLS MS
Sbjct  156  EGELVKRALSALIRPSSHQLRRCAAFEPRPSRLSVMS  192



>gb|EYU34940.1| hypothetical protein MIMGU_mgv1a024024mg [Erythranthe guttata]
Length=225

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -1

Query  529  TCLCSPTSHPGSFRCSLHKN-----------MNSRPSISYPSNRLNARRSAMTNSLVRIG  383
            TC+CSPT+HPGSFRCSLHK              +R      S+ LN RRSAM NSLVRIG
Sbjct  104  TCMCSPTNHPGSFRCSLHKGGLAGSGVVSGGGPARTVSCGSSSGLNMRRSAMKNSLVRIG  163

Query  382  TVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEEDl*vlll*VCIDYSVWI  203
            TVEG+L KRALAALIRPSSHQQRRRG+F+PRPSRLS MS+      +L   VC  Y+   
Sbjct  164  TVEGELEKRALAALIRPSSHQQRRRGEFRPRPSRLSVMSRNNRSNTILSNRVCCVYNFEF  223



>ref|XP_004138717.1| PREDICTED: uncharacterized protein LOC101214709 [Cucumis sativus]
 ref|XP_004159260.1| PREDICTED: uncharacterized LOC101214709 [Cucumis sativus]
 gb|KGN62968.1| hypothetical protein Csa_2G382420 [Cucumis sativus]
Length=201

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 80/106 (75%), Gaps = 6/106 (6%)
 Frame = -1

Query  556  NPLANLPKKTCLCSPTSHPGSFRCSLHKNMNS------RPSISYPSNRLNARRSAMTNSL  395
            N   +LPKK C CSPT+HPGSFRCSLHK   S        S +Y S+ LN RRSAMTNSL
Sbjct  96   NSPVSLPKKPCTCSPTTHPGSFRCSLHKKSGSGIHQHQASSSAYSSSGLNMRRSAMTNSL  155

Query  394  VRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            VRIG VEG+ VKRAL ALIRPSSHQ RRR +F+P+PSRLS MSKA+
Sbjct  156  VRIGGVEGEWVKRALTALIRPSSHQLRRRANFRPQPSRLSVMSKAD  201



>gb|AEW07500.1| hypothetical protein 0_3046_01, partial [Pinus lambertiana]
Length=144

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -1

Query  553  PLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  374
            P +  P+KTC+CSPT+HPGSFRCSLHKN ++  S +   ++LNARRSAM NSLVRIG VE
Sbjct  46   PCSVPPRKTCMCSPTNHPGSFRCSLHKNTSNSSSSTM-QSQLNARRSAMKNSLVRIGGVE  104

Query  373  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            G+ V+RAL ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  105  GEWVRRALTALIRPSSHHMRRRSSFQPRPSRLCHMTTAQD  144



>ref|XP_011084060.1| PREDICTED: uncharacterized protein LOC105166416 [Sesamum indicum]
Length=201

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 90/127 (71%), Gaps = 16/127 (13%)
 Frame = -1

Query  655  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  476
            +PS+ FS+DR  SP+RS+S S          V  P A   K+TC+CSPT+HPGSFRCSLH
Sbjct  70   SPSLSFSLDRPGSPNRSISFSGP--------VQKPAAASQKRTCMCSPTNHPGSFRCSLH  121

Query  475  KNM--------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  320
            K +        +S+ +    S+RLN RRSAM NSLVRIGTVEGDLVKRALAALIRPSSHQ
Sbjct  122  KGVASNSRVSSSSQSASYGSSSRLNMRRSAMKNSLVRIGTVEGDLVKRALAALIRPSSHQ  181

Query  319  QRRRGDF  299
            QRRRG F
Sbjct  182  QRRRGAF  188



>gb|ABK21216.1| unknown [Picea sitchensis]
Length=180

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC LH+N N+  S +  S  LNARRSAMTNSLVRIG VEG+ V+
Sbjct  85   PRKTCMCSPTNHPGSFRCKLHRNSNNSSSSTMHSQ-LNARRSAMTNSLVRIGGVEGEWVR  143

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            RAL ALIRPSSH  RRR  FQ RPSRL  M+ AE
Sbjct  144  RALTALIRPSSHHMRRRASFQLRPSRLCHMTTAE  177



>gb|KCW81351.1| hypothetical protein EUGRSUZ_C02733 [Eucalyptus grandis]
Length=220

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 15/140 (11%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            VRFSIDR  SP +S + S R  V+ ++G  N      K++C+CSPT+HPGSFRCSLHK+ 
Sbjct  86   VRFSIDRPASPKQSFAASPRQPVIHRRGNSN------KQSCMCSPTTHPGSFRCSLHKHS  139

Query  466  NSRP---------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
             S           S S+  NRL   RSAM N +V IG VEGDL+ RAL ALIRPSSHQQ+
Sbjct  140  GSGGGGGGGGNGHSDSFVPNRLIMLRSAMRNRIVSIGGVEGDLMIRALTALIRPSSHQQK  199

Query  313  RRGDFQPRPSRLSRMSKAEE  254
            RR  FQ RPSRLS MSKA +
Sbjct  200  RRAAFQSRPSRLSAMSKAGD  219



>gb|ABR18379.1| unknown [Picea sitchensis]
Length=180

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P+KTC+CSPT+HPGSFRC+LH+N N+  S +  S  LNARRSAMTNSLVRIG VEG+ V+
Sbjct  85   PRKTCMCSPTNHPGSFRCNLHRNSNNSSSSTMHSQ-LNARRSAMTNSLVRIGGVEGEWVR  143

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RAL ALIRPSSH  RRR  FQ RPSRL  M+ A++
Sbjct  144  RALTALIRPSSHHMRRRASFQLRPSRLCHMTTAKD  178



>ref|XP_010051172.1| PREDICTED: forkhead box protein C1-like [Eucalyptus grandis]
Length=251

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 15/140 (11%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            VRFSIDR  SP +S + S R  V+ ++G  N      K++C+CSPT+HPGSFRCSLHK+ 
Sbjct  117  VRFSIDRPASPKQSFAASPRQPVIHRRGNSN------KQSCMCSPTTHPGSFRCSLHKHS  170

Query  466  NSRP---------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  314
             S           S S+  NRL   RSAM N +V IG VEGDL+ RAL ALIRPSSHQQ+
Sbjct  171  GSGGGGGGGGNGHSDSFVPNRLIMLRSAMRNRIVSIGGVEGDLMIRALTALIRPSSHQQK  230

Query  313  RRGDFQPRPSRLSRMSKAEE  254
            RR  FQ RPSRLS MSKA +
Sbjct  231  RRAAFQSRPSRLSAMSKAGD  250



>ref|XP_010097175.1| hypothetical protein L484_025721 [Morus notabilis]
 gb|EXB67242.1| hypothetical protein L484_025721 [Morus notabilis]
Length=190

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 5/101 (5%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  374
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  373  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            G+L+KR+L+ALIRPSS+QQR R  FQP+PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPKPSRLSVMSRAQDS  190



>ref|XP_010097173.1| hypothetical protein L484_025719 [Morus notabilis]
 gb|EXB67240.1| hypothetical protein L484_025719 [Morus notabilis]
Length=190

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  374
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  373  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            G+L+KR+L+ALIRPSS+QQR R  FQP PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPMPSRLSVMSRAQDS  190



>ref|XP_010097172.1| hypothetical protein L484_025718 [Morus notabilis]
 gb|EXB67239.1| hypothetical protein L484_025718 [Morus notabilis]
Length=190

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  374
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  373  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            G+L+KR+L+ALIRPSS+QQR R  FQP PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPMPSRLSVMSRAQDS  190



>ref|XP_007150776.1| hypothetical protein PHAVU_005G179600g [Phaseolus vulgaris]
 gb|ESW22770.1| hypothetical protein PHAVU_005G179600g [Phaseolus vulgaris]
Length=200

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEG  371
            K+TC+CSPT+HPGSFRC+ HK +  R      + S    +LN  RSAM NS+VRIG VEG
Sbjct  95   KRTCMCSPTTHPGSFRCAYHKQLAERQQQRQQTASSSGRKLNLLRSAMKNSVVRIGGVEG  154

Query  370  DLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            ++V+R L  LIRPSSH   RR  FQPRP+RLS MSKA++
Sbjct  155  EIVRRGLTTLIRPSSHHLHRRVGFQPRPTRLSLMSKAQD  193



>gb|ABR17408.1| unknown [Picea sitchensis]
Length=166

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            +K C+CSPT+HPGSFRC LH+  N+  S S P+++LN RRSAM NSLV+IG+VEGD V+R
Sbjct  71   RKACMCSPTNHPGSFRCRLHRKSNT--SSSSPNSQLNVRRSAMANSLVKIGSVEGDWVRR  128

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            ++ ALIRPSSH  RR+  FQPRPSRL  M+ A+ D
Sbjct  129  SITALIRPSSHHMRRKTSFQPRPSRLRHMTTAQVD  163



>gb|ADE76856.1| unknown [Picea sitchensis]
Length=197

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            +KTC CSPT+HPGSFRCSLH+N N+  S +  S +LNARRSAMTNSLVRI  VEG+ V+R
Sbjct  103  RKTCTCSPTNHPGSFRCSLHRNSNNSSSSTMCS-QLNARRSAMTNSLVRISGVEGEWVRR  161

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            AL A IRPSSH+ RRR  FQPRPSRL   + A++
Sbjct  162  ALTATIRPSSHRMRRRTSFQPRPSRLCHTTTAQD  195



>gb|KEH37892.1| hypothetical protein MTR_2g450700 [Medicago truncatula]
Length=149

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            K+TC+CSP++HPGSFRC LHKN  S  S +  SNR N RRSAM NSLVRI  +EG+LVKR
Sbjct  56   KRTCMCSPSTHPGSFRCRLHKNSTS--SKTSTSNRHNVRRSAMANSLVRISRLEGELVKR  113

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            AL ALIR  S+ QRRR +FQPRPSR S MSK EE
Sbjct  114  ALEALIRRCSYNQRRRCNFQPRPSRFSVMSKVEE  147



>ref|XP_009793128.1| PREDICTED: uncharacterized protein LOC104240041 [Nicotiana sylvestris]
Length=171

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 99/139 (71%), Gaps = 18/139 (13%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK--TCLCSPTSHPGSFRCSLHK  473
            ++FS+DR +SP+RS+SV  R+    +Q       +LP+K   C+CSPT+HPGSFRCS+HK
Sbjct  37   IQFSLDREMSPNRSISVMNRESTRNRQ-----YKSLPQKKAACMCSPTTHPGSFRCSMHK  91

Query  472  NMNSRPSISYPSN-----------RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  326
             M+ R S S  +            RLN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSS
Sbjct  92   KMDVRRSSSSSTQTVSSSYNSNSNRLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSS  151

Query  325  HQQRRRGDFQPRPSRLSRM  269
            HQQRRR  FQ RPSRLS M
Sbjct  152  HQQRRRFGFQRRPSRLSNM  170



>ref|XP_011467044.1| PREDICTED: uncharacterized protein LOC105352242, partial [Fragaria 
vesca subsp. vesca]
Length=199

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 12/102 (12%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM-----------NSRPSISYPSNRLNARRSAMTNSLVR  389
            KK CLCSP++HPG+FRC+ H+N            +   S  + S RLN RRSAM NSLVR
Sbjct  94   KKACLCSPSTHPGAFRCARHRNAPRVGASESNSSSKTASSYHSSVRLNCRRSAMINSLVR  153

Query  388  IGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSK  263
            IG VEGDLVKRALAAL+RPS++ QR R DF+P+PSRLS MSK
Sbjct  154  IG-VEGDLVKRALAALVRPSAYNQRHRADFKPKPSRLSVMSK  194



>gb|KHN22423.1| hypothetical protein glysoja_024932 [Glycine soja]
Length=159

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD-  368
            K+TC+CSPT+HPGSFRC+ HK +     + + S    RLN  RSAM NS+VRIG VEGD 
Sbjct  60   KRTCMCSPTNHPGSFRCAYHKQLAEKQKQQTTSLSCRRLNLLRSAMKNSVVRIGGVEGDQ  119

Query  367  LVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            +V+RAL   LIRPSSH  RRR  FQPRP+RLS MSKA++
Sbjct  120  IVRRALTTTLIRPSSHHLRRRETFQPRPTRLSLMSKAQD  158



>ref|XP_009600832.1| PREDICTED: uncharacterized protein LOC104096200 [Nicotiana tomentosiformis]
Length=180

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 15/143 (10%)
 Frame = -1

Query  646  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  467
            ++FS+DR +SP+RS+S+  R+    +Q          K  C+CSPT+HPGSFRCS+HK M
Sbjct  37   IQFSLDREMSPNRSISIMNRENTRNRQYKS---LRQKKAACMCSPTTHPGSFRCSMHKKM  93

Query  466  NSR------------PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  323
            + R             S +  SNRL  RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSH
Sbjct  94   DVRRSSSSSSSQTVSSSYNSNSNRLIMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSH  153

Query  322  QQRRRGDFQPRPSRLSRMSKAEE  254
            QQRRR  FQ RPSRLS M + +E
Sbjct  154  QQRRRFGFQRRPSRLSNMFRTDE  176



>gb|ABK26255.1| unknown [Picea sitchensis]
Length=199

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  359
            P++TC+CSPT+HPGSFRCSLH+N +     S   ++LNARRSAMTNSLVRIG VEG+ V+
Sbjct  106  PRQTCMCSPTNHPGSFRCSLHRNSSH---SSSTHSQLNARRSAMTNSLVRIGGVEGEWVR  162

Query  358  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RAL +LIRPSSH  RRR  FQ RPSRL  M+ A++
Sbjct  163  RALTSLIRPSSHHMRRRSSFQRRPSRLCHMTTAQD  197



>gb|ABK27079.1| unknown [Picea sitchensis]
Length=199

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 13/133 (10%)
 Frame = -1

Query  640  FSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL----PKKTCLCSPTSHPGSFRCSLHK  473
            FS+DRS S      V    + +  +G   P+ ++    P++ C+CSPT+HPGSFRCSLH+
Sbjct  74   FSLDRSAS-----RVRSARRPITPKGDA-PMKSVPCAPPRQMCMCSPTNHPGSFRCSLHR  127

Query  472  NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  293
            N +     S   ++LNARRSAMTNSLVRIG VEG+ V+RAL +LIRPSSH  RRR  FQP
Sbjct  128  NSS---HSSSTHSQLNARRSAMTNSLVRIGGVEGEWVRRALTSLIRPSSHHMRRRSSFQP  184

Query  292  RPSRLSRMSKAEE  254
            +PSRL  M+ A++
Sbjct  185  QPSRLCHMTTAQD  197



>ref|XP_011468518.1| PREDICTED: uncharacterized protein LOC105352658 [Fragaria vesca 
subsp. vesca]
Length=205

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 12/104 (12%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMN-----------SRPSISYPSNRLNARRSAMTNSLVR  389
            +K CLCSP++HPG+FRC++H+N                S  + S RL  RR+AM NSLVR
Sbjct  93   QKACLCSPSTHPGAFRCAMHRNAQRGGASQSKSSSKTTSSYHSSIRLKYRRAAMNNSLVR  152

Query  388  IGTVEGDL-VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  260
            IG V G+L VK+A AALIRPS+H +RRR DFQP+PSRLS MSKA
Sbjct  153  IGGVLGELLVKQASAALIRPSAHNRRRRADFQPKPSRLSVMSKA  196



>ref|XP_004486636.1| PREDICTED: probable serine/threonine-protein kinase fhkB-like 
[Cicer arietinum]
Length=222

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 70/118 (59%), Gaps = 26/118 (22%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYP-------------------------SNRL  428
            + C+CSPT+H GSFRC+ HK M  +                               S +L
Sbjct  106  RKCMCSPTTHAGSFRCAYHKRMAEQEQQRREKQQQKQQQVQQQQQQQVHQQTAWSRSRKL  165

Query  427  NARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            N RRSAM NSLVRIG VEG++VKR L  LIRPSSH+ RRR  FQP+PSRLS MSKA++
Sbjct  166  NLRRSAMKNSLVRIG-VEGEIVKRTLTTLIRPSSHELRRREAFQPKPSRLSIMSKAQD  222



>ref|XP_010236437.1| PREDICTED: uncharacterized protein LOC104584037 [Brachypodium 
distachyon]
Length=167

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-RLNARRSAMTNSLVRIGTVEG-DLV  362
            K+ C+CSPT+HPGSFRC+LH+  +S P  +       +ARRSAM NSLVRI  VEG D V
Sbjct  64   KRACMCSPTTHPGSFRCALHRGCSSSPGTAAAGGLHQDARRSAMANSLVRIAAVEGGDHV  123

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRL  278
            +RALAAL+RPSSH QRR   F+  PSRL
Sbjct  124  RRALAALVRPSSHHQRRGTSFRALPSRL  151



>ref|XP_010109762.1| hypothetical protein L484_008438 [Morus notabilis]
 gb|EXC24667.1| hypothetical protein L484_008438 [Morus notabilis]
Length=172

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = -1

Query  565  GVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM---NSRPSIS-YPSN--RLNARRSAMT  404
            G  N + + PKKTC+C+PT+HPGSFRC LHKN      R   S + SN  R    RSAM 
Sbjct  72   GNCNSVVSKPKKTCMCAPTTHPGSFRCYLHKNSPRGGRRQQTSLFDSNSIRFCLTRSAMA  131

Query  403  NSLVRIGTVEGDLVKRA-LAALIRPSSHQQRRRGDFQPRPS  284
            NS + IG VEG+L+KR+ L ALIRPSS+Q +RR  F+PRPS
Sbjct  132  NSPITIGLVEGELMKRSLLVALIRPSSNQLQRRDTFRPRPS  172



>gb|AEX12199.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12201.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12202.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12203.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12204.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12205.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12206.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12207.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12208.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12209.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12210.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12211.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12212.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12213.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12214.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12215.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
Length=86

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%), Gaps = 7/88 (8%)
 Frame = -1

Query  517  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            SPT+HPGSFRCSLH+N N   S ++P  +LNARRSAM     RI  VEG+ V+R L ALI
Sbjct  1    SPTNHPGSFRCSLHRNSN-HSSSTHP--QLNARRSAMR----RINRVEGEWVRRVLTALI  53

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSS   R R  FQPRPSRL  M+ A++
Sbjct  54   RPSSQHMRTRTSFQPRPSRLCHMTTAQD  81



>gb|AEX12200.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
Length=86

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 7/88 (8%)
 Frame = -1

Query  517  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            SPT+HPGSFRCSLH+N N   S ++P  +LNARRSAM     RI  VEG+ V+R L ALI
Sbjct  1    SPTNHPGSFRCSLHRNSN-HSSSTHP--QLNARRSAMR----RINRVEGEWVRRVLTALI  53

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSS   R R  FQP+PSRL  M+ A++
Sbjct  54   RPSSQHMRTRTSFQPQPSRLCHMTTAQD  81



>ref|XP_003597954.1| hypothetical protein MTR_2g104380 [Medicago truncatula]
 gb|AES68205.1| hypothetical protein MTR_2g104380 [Medicago truncatula]
Length=207

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 65/126 (52%), Gaps = 34/126 (27%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP---------------------------  440
            P + C+CSPT+H GSFRC+ HK M  +                                 
Sbjct  82   PARRCMCSPTTHAGSFRCAYHKRMAEQEQQRQQKQDKVHQQHQQQKEVQQKQHQQQQRQQ  141

Query  439  ------SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRL  278
                  S  LN RRSAM NSL+RIG VEG+++KR L  LIRPS  Q RRR  FQ +PSRL
Sbjct  142  ITAMSRSRTLNLRRSAMKNSLIRIG-VEGEILKRTLTNLIRPSPQQLRRREAFQAKPSRL  200

Query  277  SRMSKA  260
            S MSKA
Sbjct  201  SVMSKA  206



>gb|EAZ05724.1| hypothetical protein OsI_27951 [Oryza sativa Indica Group]
Length=175

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 5/75 (7%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNS--RPSISYPSN--RLNARRSAMTNSLVRIGTVEG-DLV  362
            C CSPT+HPGSFRC+LH+   S  RPS++      R +ARRSAM NSLVRI  VEG D V
Sbjct  76   CACSPTTHPGSFRCALHRGAASPSRPSVAAACGGLREDARRSAMANSLVRIAAVEGGDHV  135

Query  361  KRALAALIRPSSHQQ  317
            +RA+AALIRPSSH Q
Sbjct  136  RRAVAALIRPSSHHQ  150



>ref|XP_010520684.1| PREDICTED: uncharacterized protein LOC104799741 [Tarenaya hassleriana]
Length=159

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 19/110 (17%)
 Frame = -1

Query  529  TCLCSPTSHPGSFRCSLHKN--MNSRPSISYP----------------SNRLNARRSAMT  404
            TCLCSPT+HPGSFRC+ H+   +    +++                  ++ L  RRSAM 
Sbjct  48   TCLCSPTTHPGSFRCARHRRSAIGGGKAVTTKAPSPSPSPVPIREFAVTDGLKLRRSAMV  107

Query  403  NSLVRIGTVEGDLVKRALAALIR-PSSHQQRRRGDFQPRPSRLSRMSKAE  257
            NSL RIG VEG++ KR +AAL R PSS   RRR +F+PRPSR S M + +
Sbjct  108  NSLARIGGVEGEVAKRTMAALSRPPSSQNLRRRSEFRPRPSRFSVMCRDQ  157



>ref|XP_009131795.1| PREDICTED: uncharacterized protein LOC103856443 [Brassica rapa]
Length=167

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 18/115 (16%)
 Frame = -1

Query  544  NLPKKT----CLCSPTSHPGSFRCSLH--------KNMNSRPSISYPSNR-----LNARR  416
            N PK +    CLCSPT+HPGSFRC+ H        + +NS+  ++   N      LN R+
Sbjct  47   NTPKTSAASKCLCSPTTHPGSFRCAFHRRLENEKNRTLNSQAKLNKCGNTTKNSGLNMRK  106

Query  415  SAMTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            +A+ NSL RIG+VE D VK++LAA +++PS     RR DF+PRPSR   + K ++
Sbjct  107  TALLNSLARIGSVEADRVKKSLAASMVKPSPLHISRRFDFRPRPSRFYALRKDQD  161



>gb|AFK36164.1| unknown [Medicago truncatula]
Length=207

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 64/126 (51%), Gaps = 34/126 (27%)
 Frame = -1

Query  538  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP---------------------------  440
            P + C+CSPT+H GSFRC+ HK M  +                                 
Sbjct  82   PARRCMCSPTTHAGSFRCAYHKRMAEQEQQRQQKQDKVHQQHQQQKEVQQKQHQQQQRQQ  141

Query  439  ------SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRL  278
                  S  LN RRSAM NSL+RIG VE +++KR L  LIRPS  Q RRR  FQ +PSRL
Sbjct  142  ITAMSRSRTLNLRRSAMKNSLIRIG-VESEILKRTLTNLIRPSPQQLRRREAFQGKPSRL  200

Query  277  SRMSKA  260
            S MSKA
Sbjct  201  SVMSKA  206



>gb|AFW57201.1| hypothetical protein ZEAMMB73_692989, partial [Zea mays]
Length=170

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNA-RRSAMTNSLVRIGTVE-  374
            + +C CSPT+HPGSFRC+LH+     + +  S +  S+RL+A RR++M N LVRI  VE 
Sbjct  68   RASCACSPTTHPGSFRCALHRGGQGPLPASASAALVSSRLSAPRRASMANPLVRIAAVEG  127

Query  373  GDLVKRALAALIRPSSHQQRRRGD-FQPRPSRL  278
            GD ++RALAAL+RP+  Q RRR D F+P PSRL
Sbjct  128  GDHIRRALAALVRPTPSQTRRRADAFRPTPSRL  160



>emb|CDY51848.1| BnaA03g56150D [Brassica napus]
Length=167

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 63/105 (60%), Gaps = 14/105 (13%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------------LNARRSAMTNSLVRI  386
            CLCSPT HPGSFRC+ H+ + S  + +  S               LN R++A+ NSLVRI
Sbjct  57   CLCSPTVHPGSFRCAFHRRLESEKNRTLNSQAKPNKCGNMTKNSGLNMRKTALLNSLVRI  116

Query  385  GTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
             +VE D VK++LAA ++ PS     RR DF+PRPSR   + K ++
Sbjct  117  ASVEADRVKKSLAASMVTPSPLHISRRFDFRPRPSRFYALRKDQD  161



>ref|XP_004954250.1| PREDICTED: uncharacterized protein LOC101761531 [Setaria italica]
Length=176

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 71/119 (60%), Gaps = 24/119 (20%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNS-----------------RPSISYPSNRLNARRS-A  410
            ++TC+CSPT+HPGSFRCSLHK   +                   S S  ++RL A  S  
Sbjct  56   RRTCMCSPTNHPGSFRCSLHKERKAPHGGHKPTSPPSPPSLAGSSSSMTTSRLGASASRR  115

Query  409  MTNSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEED  251
            M ++LVRIG VE G+  +RALAA +RPS     S  +RR G F+PRPSRLS +S A ++
Sbjct  116  MGSALVRIGAVEGGEWARRALAATVRPSPAAQQSQHRRRVGGFRPRPSRLSAVSMAGDN  174



>gb|KFK26276.1| hypothetical protein AALP_AA8G225800 [Arabis alpina]
Length=162

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 15/109 (14%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLH--------KNMNSRPSISYPSNR-----LNARRSAMTNSL  395
            K+ CLCSPT+HPGSFRC  H        K +NS PS     N      LN R+ A+ NSL
Sbjct  55   KRKCLCSPTTHPGSFRCGFHRRLEIEKIKTLNS-PSSPVKGNNSFGSGLNLRKVALVNSL  113

Query  394  VRIGTVEGDLVKRAL-AALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
             +IG+VE +  +++L A+L++P+    RRR DF+PR SR   + K ++D
Sbjct  114  AKIGSVEAERFRKSLMASLVKPAGLHIRRRSDFRPRLSRFCVLHKEDQD  162



>ref|XP_002873994.1| hypothetical protein ARALYDRAFT_910077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50253.1| hypothetical protein ARALYDRAFT_910077 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 15/107 (14%)
 Frame = -1

Query  547  ANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS-------------YPSNR-LNARRSA  410
            +N  K+ CLCSPT+HPGSFRCS H+ +    S +             YP N  LN R+ A
Sbjct  60   SNHQKRKCLCSPTTHPGSFRCSFHRRLEHEKSKTLASSTAKRNNRGDYPINVGLNLRKLA  119

Query  409  MTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSR  272
            + NSL +IG+VE +  +R+LAA L++PSS     R +F+PR SR  +
Sbjct  120  LMNSLAKIGSVEAERFRRSLAANLVKPSSLHSHHRSEFRPRLSRFHK  166



>gb|AEX12216.1| hypothetical protein 0_7218_01, partial [Pinus radiata]
Length=87

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = -1

Query  517  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  338
            SPT+HPGSFRCSLH+N N   S S   ++LNARRSAM     RI  VEG+ V+R   ALI
Sbjct  1    SPTNHPGSFRCSLHRNSNR--SSSSTHSQLNARRSAMR----RINRVEGEWVRRVFTALI  54

Query  337  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            RPSS   R R  FQP+PSRL  M+ A++
Sbjct  55   RPSSQHMRTRTSFQPQPSRLCHMTTAQD  82



>ref|XP_006400605.1| hypothetical protein EUTSA_v10015868mg [Eutrema salsugineum]
 gb|ESQ42058.1| hypothetical protein EUTSA_v10015868mg [Eutrema salsugineum]
Length=179

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 16/110 (15%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR--------------LNARRSAMTNS  398
            K  CLCSPT+HPGSFRCS H+ + +  + +  S+               LN R++A+ NS
Sbjct  70   KIKCLCSPTTHPGSFRCSFHRRLENEKNGTLGSSSAKRNTCGNTTRNSALNLRKAALVNS  129

Query  397  LVRIGTVEGDLVKRALAA-LIRP-SSHQQRRRGDFQPRPSRLSRMSKAEE  254
            L +IG+VE +  +++LAA +++P SS   RRR +F+PRPSR   + K ++
Sbjct  130  LAKIGSVEAERFRKSLAATMVKPNSSLHTRRRNEFRPRPSRFYALHKDQD  179



>ref|XP_010493142.1| PREDICTED: uncharacterized protein LOC104770417 [Camelina sativa]
Length=176

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 12/106 (11%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM-NSRPSISYPSNR----------LNARRSAMTNSLVR  389
            K+ CLCSPT+HPGSFRC+ H+ + + R      SNR          LN R+ A+ NSL +
Sbjct  67   KRKCLCSPTTHPGSFRCAFHRRLEHERSKTLASSNRGDDTVRVSVGLNLRKLALINSLAK  126

Query  388  IGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            IG+VE +  +R LAA L++P S    RR +F+PR SR   + K ++
Sbjct  127  IGSVEAERFRRCLAANLVKPPSFHDIRRPEFRPRLSRFFELHKDQD  172



>ref|XP_002443921.1| hypothetical protein SORBIDRAFT_07g004400 [Sorghum bicolor]
 gb|EES13416.1| hypothetical protein SORBIDRAFT_07g004400 [Sorghum bicolor]
Length=164

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 19/119 (16%)
 Frame = -1

Query  559  GNPLANLPKKTCLCSPTSHPGSFRCSLHK---------------NMNSRPSISYPSNRLN  425
            G P     + +C CSPT+HPGS+RC+LH+                + +  S +  S+RL+
Sbjct  44   GPPTKAKQRASCACSPTTHPGSYRCALHRGQGQAGGGGAAGPPLPVAAAASAAPVSSRLS  103

Query  424  A-RRSAMTNSLVRIGTVEG-DLVKRALAALIR-PSSHQQRRRGD-FQPRPSRLSRMSKA  260
            A RR++M N LVRI  VEG D ++RALAAL+R P S   RRR D F+P PSRLS MS A
Sbjct  104  APRRASMANPLVRIAAVEGSDHIRRALAALVRPPPSQTTRRRADAFRPTPSRLSAMSSA  162



>ref|NP_197537.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AED92836.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=175

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 17/103 (17%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS------NR----------LNARRSAMT  404
            K+ CLCSPT+HPGSFRCS H+ +    S +  S      NR          LN R+ A+ 
Sbjct  68   KRKCLCSPTTHPGSFRCSFHRRLEHEKSKTLASSTVKRNNRGDNTIRVNVGLNLRKLALM  127

Query  403  NSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRL  278
            NSL +IG+VE +  +R+LAA L +PSS    RR +F+PR SR 
Sbjct  128  NSLAKIGSVEAERFRRSLAANLAKPSSLHSHRRPEFRPRLSRF  170



>gb|KFK29077.1| hypothetical protein AALP_AA7G085900 [Arabis alpina]
Length=144

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 15/93 (16%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            K+ C CSPTSHPGSFRC LHK  ++       ++  + R+SA+T S+V          KR
Sbjct  66   KRPCSCSPTSHPGSFRCGLHKGSDT-----TGAHAPSVRKSAVTKSVV----------KR  110

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  257
            ALA L RPSSH Q RR +F+ +PS LS MSKA 
Sbjct  111  ALAVLTRPSSHSQSRRANFKSQPSGLSVMSKAN  143



>ref|XP_010454341.1| PREDICTED: uncharacterized protein LOC104736112 [Camelina sativa]
Length=171

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 17/111 (15%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM-NSRPSISYPSNR---------------LNARRSAMT  404
            K+ CLCSPT+HPGSFRC+ H+ + + R      SNR               LN R+ A+ 
Sbjct  61   KRKCLCSPTTHPGSFRCAFHRRLEHERSKTLASSNRGDDNNNNNTMRVSVGLNLRKLALI  120

Query  403  NSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            NSL +IG+VE +  +  LAA L++PSS    RR +F+PR SR   + K ++
Sbjct  121  NSLAKIGSVEAERFRTCLAANLVKPSSFHDIRRPEFRPRLSRFYELHKDQD  171



>gb|KJB53962.1| hypothetical protein B456_009G013600 [Gossypium raimondii]
Length=109

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  353
            +TCLCSPT+HPGSFRCSLH+N N +P    P+ R  A R A  NS       + + +K  
Sbjct  16   RTCLCSPTTHPGSFRCSLHRNFN-KP----PTGRSRAVRIA-PNSWELALQAKANSIKAL  69

Query  352  LAALIRPSSHQQRRRGDFQPRPSRLSRMS  266
            L  +I+PSSH  +RR DFQP+PSR   ++
Sbjct  70   LLQIIKPSSHDLQRRRDFQPKPSRFCMLN  98



>ref|XP_007202930.1| hypothetical protein PRUPE_ppa016664mg [Prunus persica]
 ref|XP_008242916.1| PREDICTED: uncharacterized protein LOC103341213 [Prunus mume]
 gb|EMJ04129.1| hypothetical protein PRUPE_ppa016664mg [Prunus persica]
Length=99

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 17/95 (18%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  356
            +TCLCSPTSHPGSFRCSLH+N N  +P IS P+             +V+  +++G L   
Sbjct  17   RTCLCSPTSHPGSFRCSLHRNSNKQQPIISNPA------------FVVKPNSIKGCL---  61

Query  355  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
             L  LI+PSSH  +RR  FQPRP+R   M+     
Sbjct  62   -LLQLIKPSSHDLQRRRKFQPRPTRFCLMNNTRNQ  95



>emb|CDX70925.1| BnaC03g10090D [Brassica napus]
Length=146

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 14/105 (13%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------------LNARRSAMTNSLVRI  386
            CLCSPT+HPGSFRC+ H+ + +  + +  S               L+ R++ + NSL RI
Sbjct  36   CLCSPTTHPGSFRCAFHRRLENEKNRTLNSQAKPNKCGNTTKNSGLSMRKTELLNSLARI  95

Query  385  GTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
             +VE D  +++LAA +++PS     RR DF+PRPSR   + K ++
Sbjct  96   ASVEADRFRKSLAASMVKPSPLHISRRFDFRPRPSRFYALRKDQD  140



>ref|XP_006286710.1| hypothetical protein CARUB_v10002860mg [Capsella rubella]
 gb|EOA19608.1| hypothetical protein CARUB_v10002860mg [Capsella rubella]
Length=181

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 19/113 (17%)
 Frame = -1

Query  535  KKTCLCSPTSHPGSFRCSLHKNM----------NSRPSISYPSNR--------LNARRSA  410
            K+ CLCSPT+HPGSFRCS H+ +          NS P+    SNR        LN R+ A
Sbjct  69   KRKCLCSPTTHPGSFRCSFHRRLEHDRSKTLASNSSPTKRTNSNRGDVRVCVGLNLRKLA  128

Query  409  MTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  254
            + NSL +IG+ E +  + +LAA L++PSS    R  +F+PR SR  ++   ++
Sbjct  129  LINSLAKIGSAEAERFRTSLAANLVKPSSFHILRHPEFRPRLSRFYQLRTVQD  181



>emb|CDY68410.1| BnaAnng27180D [Brassica napus]
Length=153

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -1

Query  556  NPLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------LNARRSAMTNS  398
            NP ++   + C CSPT+HPGSFRC  H+ + +  S +  SN+       L  R+ A+ NS
Sbjct  45   NPPSSSAVRKCSCSPTTHPGSFRCGFHRRLENEKSKAL-SNKSKSGDSGLYLRKLALVNS  103

Query  397  LVRIGTVEGDLVKRALA-ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
            L RIG+VE +  ++ L  ++++PSS   RRR +F+PR SR   M K  +D
Sbjct  104  LARIGSVEAERFRKYLTESIVKPSSLLIRRRFEFRPRLSRFYGMHKDPKD  153



>ref|XP_010244874.1| PREDICTED: uncharacterized protein LOC104588580 [Nelumbo nucifera]
Length=111

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 10/92 (11%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  362
            +TCLCSPT+HPGSFRCSLH+N   + +R S+   SN       + TN        + +L+
Sbjct  18   RTCLCSPTNHPGSFRCSLHRNSRKLYTRSSVHVVSN-------STTNRSDWRMVDKPNLL  70

Query  361  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMS  266
            K  L  +I+PS H  RRR +FQP+P+R   M+
Sbjct  71   KEFLMQIIKPSKHDLRRRSNFQPKPTRFCLMN  102



>gb|AEW08800.1| hypothetical protein CL1668Contig1_02, partial [Pinus radiata]
 gb|AFG50829.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50830.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50831.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50832.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50833.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50834.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50835.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50836.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50837.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50838.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50840.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50841.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50842.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50843.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
Length=48

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  403  NSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  260
            NSLV+IG+VEG+ V+RAL ALIRPS H  RRR  FQPRPSRL  M++A
Sbjct  1    NSLVKIGSVEGEWVRRALTALIRPSRHHMRRRASFQPRPSRLCHMTRA  48



>ref|XP_009126442.1| PREDICTED: uncharacterized protein LOC103851346 [Brassica rapa]
 emb|CDY45090.1| BnaA02g04860D [Brassica napus]
Length=153

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 9/102 (9%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------LNARRSAMTNSLVRIGTVE  374
            + C CSPT+HPGSFRC  H+ + S   I   SN+       +  R+ A+ NSL RIG+VE
Sbjct  53   RKCSCSPTTHPGSFRCGFHRRLES-EKIKALSNKSKSGDSGMYLRKLALANSLARIGSVE  111

Query  373  GDLVKRALA-ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  251
             +  ++ L  ++++PSS   RRR +F+PR SR   M K  +D
Sbjct  112  AERFRKYLTESIVKPSSLLIRRRFEFRPRLSRFYGMHKDPKD  153



>ref|NP_001237708.1| uncharacterized protein LOC100306623 [Glycine max]
 gb|ACU14899.1| unknown [Glycine max]
Length=108

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 15/92 (16%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  365
            +TC+CSPT+HPGSFRCS+HK     + +RP    PS+  ++  +A  NSL          
Sbjct  17   RTCMCSPTNHPGSFRCSMHKKPPRAVVARPLSRTPSSWNSSSMAAKANSL----------  66

Query  364  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRM  269
             K  L  +I+PSSH+  RR  FQP+PSR S M
Sbjct  67   -KAILLQMIKPSSHEHHRRKSFQPKPSRFSLM  97



>gb|AFG50839.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
Length=48

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  403  NSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  260
            NSLV+IG+VEG+ V+RAL ALIRPS H  RRR  FQPRPSRL  M++A
Sbjct  1    NSLVKIGSVEGEWVRRALTALIRPSRHHLRRRASFQPRPSRLCHMTRA  48



>gb|KHN47128.1| hypothetical protein glysoja_022429 [Glycine soja]
Length=108

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 15/92 (16%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  365
            +TC+CSPT+HPGSFRCS+HK     + +RP    PS+  ++  +A  NSL          
Sbjct  17   RTCMCSPTNHPGSFRCSVHKKPPRAVVARPLSRTPSSWNSSSMAAKANSL----------  66

Query  364  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRM  269
             K  L  +I+PSSH+  RR  FQP+PSR S M
Sbjct  67   -KAILLQMIKPSSHEHHRRKSFQPKPSRFSLM  97



>ref|NP_001048411.1| Os02g0799700 [Oryza sativa Japonica Group]
 dbj|BAD36711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD36066.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10325.1| Os02g0799700 [Oryza sativa Japonica Group]
 dbj|BAG89439.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  404
            C+CSPT+HPGSFRCSLHK    + S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQ--KRSVHHKAAAAPSSPPSPTSPPASGGAVRLGGARRMGG  107

Query  403  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  254
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>gb|EAZ24963.1| hypothetical protein OsJ_08744 [Oryza sativa Japonica Group]
Length=173

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  404
            C+CSPT+HPGSFRCSLHK    + S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQ--KRSVHHKAAAAPSSPPSPTSPRASGGAVRLGGARRMGG  107

Query  403  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  254
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>gb|EAY87888.1| hypothetical protein OsI_09309 [Oryza sativa Indica Group]
Length=173

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 61/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  526  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  404
            C+CSPT+HPGSFRCSLHK      S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQKR--SVHHKAAAAPSSPPSPTSPPASGGAVRLGGARRMGG  107

Query  403  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  254
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>ref|XP_009760525.1| PREDICTED: uncharacterized protein LOC104212863 [Nicotiana sylvestris]
Length=75

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 11/73 (15%)
 Frame = -1

Query  523  LCSPTSHPGSFRCSLHKNMNS------RPSISYPSNR-LN---ARRSAMTNSLVRIGTVE  374
            +C+PT+HPGSFRCSLHKN N       + + +  S++ LN    RRSAM NS+VRIG VE
Sbjct  1    MCAPTNHPGSFRCSLHKNSNQTKYAHIKTTTTKKSHQHLNLKIIRRSAMVNSVVRIGAVE  60

Query  373  -GDLVKRALAALI  338
             G+L+KR L+A I
Sbjct  61   DGELIKRKLSAFI  73



>ref|XP_007013642.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY31261.1| Serine-rich protein-related [Theobroma cacao]
Length=109

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 7/89 (8%)
 Frame = -1

Query  532  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  353
            +TCLCSPT+HPGSFRC+LH+N N       P  R    R +  +  + +   + + +K  
Sbjct  17   RTCLCSPTTHPGSFRCNLHRNFNK------PPGRTRVVRVSPNHWELAV-IAKANSIKAI  69

Query  352  LAALIRPSSHQQRRRGDFQPRPSRLSRMS  266
            L  +I+PSSH  +RR +FQP+PSR   ++
Sbjct  70   LLQIIKPSSHDMQRRRNFQPKPSRFCLLN  98



>ref|XP_010250390.1| PREDICTED: uncharacterized protein LOC104592655 [Nelumbo nucifera]
Length=109

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 11/105 (10%)
 Frame = -1

Query  571  KQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN---MNSRPSISYPSNRLNARRSAMTN  401
            + G  N     P +TCLCSPT+HPGSFRCSLH+N   + +R S+   SN   +R    T 
Sbjct  4    RTGPSNSKPQNPTRTCLCSPTNHPGSFRCSLHRNSRKLYTRSSVHVASN-PGSRSEPKT-  61

Query  400  SLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMS  266
                    + +L+K  L  +I+PS H   RR +FQP+P+R   M+
Sbjct  62   ------MDKSNLLKEFLLQIIKPSKHDMSRRRNFQPKPTRFCMMN  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890