BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039F05

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    155   2e-39   Nicotiana tomentosiformis
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    154   6e-39   Nicotiana sylvestris
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...    147   1e-38   Nicotiana sylvestris
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    145   5e-36   
ref|XP_009364630.1|  PREDICTED: probable glycerophosphoryl dieste...    138   1e-35   
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...    134   9e-34   
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    137   4e-33   Solanum tuberosum [potatoes]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    136   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    135   1e-32   Sesamum indicum [beniseed]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    135   3e-32   Fragaria vesca subsp. vesca
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                135   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    135   3e-32   Solanum lycopersicum
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    135   3e-32   Solanum tuberosum [potatoes]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    134   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    134   4e-32   Pyrus x bretschneideri [bai li]
emb|CDP13760.1|  unnamed protein product                                134   5e-32   Coffea canephora [robusta coffee]
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    134   6e-32   Gossypium arboreum [tree cotton]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    133   1e-31   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    133   1e-31   Glycine max [soybeans]
gb|KJB13799.1|  hypothetical protein B456_002G094900                    132   2e-31   Gossypium raimondii
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    132   4e-31   
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    131   5e-31   Solanum lycopersicum
ref|XP_006387051.1|  hypothetical protein POPTR_2051s00200g             124   9e-31   
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    130   1e-30   Cucumis melo [Oriental melon]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    130   1e-30   
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    130   1e-30   Vitis vinifera
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    130   2e-30   Camelina sativa [gold-of-pleasure]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    130   2e-30   Gossypium arboreum [tree cotton]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    129   5e-30   Ricinus communis
emb|CDY46687.1|  BnaA03g48210D                                          128   6e-30   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    128   7e-30   Brassica rapa
emb|CDX92806.1|  BnaC07g40640D                                          127   2e-29   
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    126   3e-29   Sesamum indicum [beniseed]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    126   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    126   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    126   3e-29   Cucumis sativus [cucumbers]
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             124   3e-29   
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   126   3e-29   Genlisea aurea
emb|CDY45656.1|  BnaC09g31980D                                          125   4e-29   Brassica napus [oilseed rape]
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    125   5e-29   Camelina sativa [gold-of-pleasure]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                125   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    125   1e-28   Fragaria vesca subsp. vesca
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    124   1e-28   Arabis alpina [alpine rockcress]
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    124   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    124   2e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17323.1|  BnaA10g09570D                                          124   2e-28   Brassica napus [oilseed rape]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    124   2e-28   Brassica rapa
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    124   2e-28   Nelumbo nucifera [Indian lotus]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   125   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAF98210.1|AC007152_6  Unknown protein                               124   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             124   3e-28   Capsella rubella
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    123   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             123   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    123   3e-28   
emb|CDX86807.1|  BnaA09g21970D                                          117   3e-28   
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    123   3e-28   Prunus mume [ume]
ref|XP_002300352.2|  hypothetical protein POPTR_0001s371702g            118   4e-28   
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     122   5e-28   Eucalyptus grandis [rose gum]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    122   8e-28   Arabis alpina [alpine rockcress]
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    122   1e-27   
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    122   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             122   1e-27   Prunus persica
emb|CDY13237.1|  BnaC09g24190D                                          122   1e-27   Brassica napus [oilseed rape]
ref|XP_002888566.1|  kinase family protein                              122   1e-27   
gb|AAP40466.1|  unknown protein                                         121   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    121   1e-27   
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    121   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDY11996.1|  BnaC03g14220D                                          121   1e-27   Brassica napus [oilseed rape]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    120   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             120   2e-27   
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             120   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    120   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             120   3e-27   Capsella rubella
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    120   3e-27   Brassica rapa
emb|CDY36746.1|  BnaA03g11400D                                          120   4e-27   Brassica napus [oilseed rape]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    120   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             120   5e-27   Eutrema salsugineum [saltwater cress]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    120   6e-27   Cicer arietinum [garbanzo]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             120   6e-27   Phaseolus vulgaris [French bean]
emb|CDX89312.1|  BnaA01g15810D                                          119   7e-27   
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    119   7e-27   Brassica rapa
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             119   8e-27   Phaseolus vulgaris [French bean]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    119   8e-27   Populus euphratica
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    119   8e-27   Populus euphratica
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             119   1e-26   Phaseolus vulgaris [French bean]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    119   1e-26   Nelumbo nucifera [Indian lotus]
emb|CDX94294.1|  BnaC01g18900D                                          119   1e-26   
gb|AAL07129.1|  unknown protein                                         118   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    118   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433459.1|  PREDICTED: glycerophosphodiester phosphodies...    113   2e-26   
ref|XP_002867546.1|  MRH5/SHV3                                          118   2e-26   
emb|CAB36515.1|  putative protein                                       118   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    117   4e-26   Brassica rapa
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             117   4e-26   
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    117   4e-26   Brassica rapa
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             116   9e-26   Capsella rubella
emb|CDY12605.1|  BnaA02g12730D                                          116   1e-25   Brassica napus [oilseed rape]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         115   2e-25   Jatropha curcas
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    115   3e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    114   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    114   4e-25   Brassica rapa
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    114   6e-25   Citrus sinensis [apfelsine]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    114   7e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010496105.1|  PREDICTED: glycerophosphodiester phosphodies...    107   7e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             114   7e-25   Citrus clementina [clementine]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             114   8e-25   Populus trichocarpa [western balsam poplar]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   114   8e-25   Citrus sinensis [apfelsine]
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...    110   9e-25   Glycine max [soybeans]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    113   1e-24   Nelumbo nucifera [Indian lotus]
emb|CDY42328.1|  BnaC02g17050D                                          108   1e-24   Brassica napus [oilseed rape]
emb|CDX92782.1|  BnaC07g40400D                                          113   2e-24   
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   Elaeis guineensis
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   Elaeis guineensis
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    111   4e-24   
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    111   4e-24   Glycine max [soybeans]
emb|CDY61647.1|  BnaCnng38120D                                          111   4e-24   Brassica napus [oilseed rape]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    111   4e-24   Glycine soja [wild soybean]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    112   5e-24   Brassica rapa
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    110   1e-23   Phoenix dactylifera
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    110   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    110   3e-23   
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    108   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    108   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    107   1e-22   Cicer arietinum [garbanzo]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    107   2e-22   
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    106   2e-22   Phoenix dactylifera
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    105   3e-22   
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    105   4e-22   Phoenix dactylifera
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    105   7e-22   
emb|CDY46667.1|  BnaA03g48410D                                          105   8e-22   Brassica napus [oilseed rape]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             104   9e-22   Phaseolus vulgaris [French bean]
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    104   9e-22   Elaeis guineensis
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    103   1e-21   
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             102   5e-21   Phaseolus vulgaris [French bean]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    102   7e-21   Populus euphratica
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    100   2e-20   Cicer arietinum [garbanzo]
gb|KJB62956.1|  hypothetical protein B456_009G445400                  99.4    4e-20   Gossypium raimondii
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...  99.8    5e-20   Phoenix dactylifera
gb|KJB62955.1|  hypothetical protein B456_009G445400                  99.4    6e-20   Gossypium raimondii
emb|CDX86766.1|  BnaA09g21560D                                        98.2    1e-19   
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...  98.6    1e-19   Glycine soja [wild soybean]
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein            98.6    1e-19   Medicago truncatula
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...  98.6    1e-19   Glycine soja [wild soybean]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g           97.1    4e-19   Phaseolus vulgaris [French bean]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  97.1    4e-19   
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...  97.1    4e-19   Glycine max [soybeans]
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...  97.1    5e-19   Triticum urartu
emb|CAH67272.1|  B0806H07.1                                           96.3    6e-19   Oryza sativa [red rice]
ref|NP_001053060.1|  Os04g0472300                                     96.3    6e-19   
emb|CDY58867.1|  BnaC09g52640D                                        96.3    7e-19   Brassica napus [oilseed rape]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...  95.9    1e-18   
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...  95.5    1e-18   Oryza brachyantha
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...  95.5    1e-18   Glycine soja [wild soybean]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...  95.1    1e-18   Tarenaya hassleriana [spider flower]
emb|CDY14478.1|  BnaC03g21170D                                        95.5    2e-18   Brassica napus [oilseed rape]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...  95.1    2e-18   Setaria italica
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...  94.4    3e-18   Ricinus communis
gb|ACF79780.1|  unknown                                               92.0    3e-18   Zea mays [maize]
gb|ACF74306.1|  putative glycerophosphoryl diesterphosphodiestera...  89.7    3e-18   Arachis hypogaea [goober]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...  93.2    7e-18   Brachypodium distachyon [annual false brome]
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...  93.2    7e-18   Medicago truncatula
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg           93.2    8e-18   Capsella rubella
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein            93.2    8e-18   
dbj|BAJ85772.1|  predicted protein                                    92.8    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...  93.2    9e-18   
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...  92.4    1e-17   Glycine max [soybeans]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...  92.4    1e-17   Triticum urartu
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...  92.4    1e-17   Glycine max [soybeans]
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg           92.0    1e-17   
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg           92.0    2e-17   
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...  92.0    2e-17   Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...  92.0    2e-17   Glycine max [soybeans]
dbj|BAD94065.1|  Glycerophosphodiesterase-like                        85.5    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...  91.3    3e-17   Zea mays [maize]
emb|CDY11832.1|  BnaC03g12580D                                        85.9    3e-17   Brassica napus [oilseed rape]
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...  91.3    3e-17   
emb|CDY29432.1|  BnaC05g32380D                                        90.9    3e-17   Brassica napus [oilseed rape]
emb|CDY02788.1|  BnaC02g11010D                                        90.9    4e-17   
emb|CDY02800.1|  BnaC02g10890D                                        90.9    4e-17   
emb|CDX82242.1|  BnaA03g35790D                                        89.4    6e-17   
gb|KHN41389.1|  Putative glycerophosphoryl diester phosphodiester...  87.0    6e-17   Glycine soja [wild soybean]
emb|CDY32730.1|  BnaA02g07920D                                        90.1    7e-17   Brassica napus [oilseed rape]
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...  90.1    7e-17   Brassica rapa
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...  90.1    7e-17   Camelina sativa [gold-of-pleasure]
dbj|BAJ87963.1|  predicted protein                                    89.7    9e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...  89.4    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|NP_001062173.1|  Os08g0503200                                     89.4    2e-16   
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...  88.6    2e-16   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...  88.6    2e-16   
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...  87.8    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...  88.6    3e-16   
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...  88.6    3e-16   
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...  88.2    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...  88.2    3e-16   
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg           88.2    3e-16   Capsella rubella
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...  88.2    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...  88.2    3e-16   Brassica rapa
emb|CDX88656.1|  BnaA03g09930D                                        88.2    3e-16   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...  88.2    4e-16   Prunus mume [ume]
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...  87.8    4e-16   Camelina sativa [gold-of-pleasure]
gb|AAO42211.1|  unknown protein                                       87.8    4e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32720.1|  BnaA02g07820D                                        87.8    4e-16   Brassica napus [oilseed rape]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...  87.4    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg           87.4    6e-16   Prunus persica
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg           87.4    6e-16   
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...  87.4    6e-16   Brassica rapa
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...  87.4    6e-16   
gb|EYU43134.1|  hypothetical protein MIMGU_mgv11b015422mg             80.9    7e-16   Erythranthe guttata [common monkey flower]
dbj|BAC42822.1|  GPI-anchored protein                                 84.7    8e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94573.1|  Glycerophosphodiesterase-like                        81.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...  86.7    1e-15   
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...  86.7    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...  86.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...  86.3    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...  85.9    2e-15   Nelumbo nucifera [Indian lotus]
dbj|BAJ93663.1|  predicted protein                                    85.1    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008336911.1|  PREDICTED: probable glycerophosphoryl dieste...  80.5    4e-15   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...  84.0    9e-15   
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7      83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  83.6    1e-14   
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...  83.6    1e-14   Pyrus x bretschneideri [bai li]
dbj|BAD94535.1|  Glycerophosphodiesterase-like                        81.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                  83.2    1e-14   Arabis alpina [alpine rockcress]
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...  83.2    1e-14   
emb|CDY36036.1|  BnaC03g41620D                                        82.8    2e-14   Brassica napus [oilseed rape]
gb|AFW58562.1|  hypothetical protein ZEAMMB73_533189                  79.7    2e-14   
emb|CBI18678.3|  unnamed protein product                              82.4    2e-14   Vitis vinifera
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...  82.4    2e-14   Vitis vinifera
ref|XP_002453429.1|  hypothetical protein SORBIDRAFT_04g005910        79.3    3e-14   
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...  81.6    4e-14   Brassica rapa
emb|CDY19634.1|  BnaA05g20420D                                        81.6    4e-14   Brassica napus [oilseed rape]
emb|CDY12599.1|  BnaA02g12670D                                        80.5    5e-14   Brassica napus [oilseed rape]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...  81.3    6e-14   
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730        80.9    7e-14   Sorghum bicolor [broomcorn]
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6      80.9    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000        80.5    1e-13   
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...  80.1    1e-13   
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...  80.1    1e-13   
ref|NP_001159159.1|  uncharacterized protein LOC100304242             75.5    2e-13   
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...  79.3    2e-13   Setaria italica
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440        79.3    3e-13   Sorghum bicolor [broomcorn]
ref|XP_007011972.1|  SHV3-like 5                                      79.3    3e-13   
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  79.3    3e-13   
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...  78.2    5e-13   Oryza brachyantha
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor   78.2    6e-13   Zea mays [maize]
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...  78.2    6e-13   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY60415.1|  BnaC02g45340D                                        78.2    6e-13   Brassica napus [oilseed rape]
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg           77.0    1e-12   
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g           76.6    2e-12   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...  76.6    2e-12   Populus euphratica
emb|CDY43885.1|  BnaC09g33580D                                        75.9    3e-12   Brassica napus [oilseed rape]
ref|NP_001170117.1|  hypothetical protein                             75.5    4e-12   Zea mays [maize]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...  75.5    4e-12   
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                  75.5    5e-12   
ref|NP_001141559.1|  hypothetical protein                             73.2    5e-12   
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...  75.1    6e-12   Phoenix dactylifera
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...  75.1    6e-12   Elaeis guineensis
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...  74.7    8e-12   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...  74.7    8e-12   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...  74.7    9e-12   
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g           74.3    9e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...  72.8    3e-11   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...  72.8    3e-11   
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...  72.4    4e-11   Populus euphratica
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...  72.4    4e-11   
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350        72.0    4e-11   
gb|EAY86479.1|  hypothetical protein OsI_07859                        72.0    5e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001047275.1|  Os02g0588500                                     72.0    5e-11   
gb|KDP38642.1|  hypothetical protein JCGZ_03995                       72.0    6e-11   Jatropha curcas
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...  71.6    7e-11   
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...  72.0    7e-11   Setaria italica
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    1e-10   
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                   70.5    2e-10   Eucalyptus grandis [rose gum]
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420        70.1    2e-10   
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...  70.1    2e-10   
emb|CDY59886.1|  BnaC02g47600D                                        66.6    3e-10   
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...  69.7    3e-10   
ref|NP_001169682.1|  hypothetical protein precursor                   69.7    3e-10   
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...  68.6    4e-10   
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...  68.2    9e-10   
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                   67.4    1e-09   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                 66.6    3e-09   
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050        66.6    3e-09   
gb|ABG22015.1|  Glycerophosphoryl diester phosphodiesterase famil...  65.9    4e-09   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...  66.2    4e-09   
ref|NP_001066731.1|  Os12g0456700                                     65.9    4e-09   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...  65.9    5e-09   
emb|CDP10204.1|  unnamed protein product                              65.9    5e-09   
ref|XP_003610370.1|  GPI-anchored protein                             65.9    5e-09   
gb|EEE53168.1|  hypothetical protein OsJ_36008                        66.2    5e-09   
ref|XP_009129031.1|  PREDICTED: probable glycerophosphoryl dieste...  64.7    6e-09   
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750        65.9    6e-09   
gb|KJB54927.1|  hypothetical protein B456_009G054700                  62.4    8e-08   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...  62.0    1e-07   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...  62.0    1e-07   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...  61.6    2e-07   
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...  61.2    2e-07   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  60.8    3e-07   
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...  60.5    4e-07   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  60.1    5e-07   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  59.7    5e-07   
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...  58.2    6e-07   
gb|KJB13801.1|  hypothetical protein B456_002G094900                  59.3    8e-07   
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...  59.3    8e-07   
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                 58.9    1e-06   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  58.9    1e-06   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...  58.5    1e-06   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  58.5    2e-06   
gb|KJB13800.1|  hypothetical protein B456_002G094900                  58.2    2e-06   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  57.8    2e-06   
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                  57.0    5e-06   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...  57.0    5e-06   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...  56.2    1e-05   
gb|EPS68532.1|  hypothetical protein M569_06231                       55.5    1e-05   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg              54.7    3e-05   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...  54.7    3e-05   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  54.7    3e-05   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  54.3    4e-05   
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg           53.1    7e-05   
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...  53.1    8e-05   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  52.0    2e-04   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  51.6    3e-04   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           50.8    5e-04   
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg           50.8    6e-04   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...  50.8    6e-04   



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ+WDFFSD  VELN+Y  GA     DGVIT +PATA RYRRNRCLG+K+ PPYM  V
Sbjct  616  FVSQSWDFFSDSSVELNNYAVGAG---IDGVITEYPATAARYRRNRCLGFKDSPPYMTSV  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PGSLL+LM+PQ+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  673  QPGSLLELMAPQFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  +ELN+Y  GA     DGVIT +PATA RYRRNRCLG K++PPYM PV
Sbjct  616  FVSQAWDFFSDSSLELNNYAVGAG---IDGVITEYPATAARYRRNRCLGLKDLPPYMSPV  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PGSLL L++PQ+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  673  QPGSLLGLIAPQFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_009794308.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2, partial [Nicotiana sylvestris]
Length=305

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  VE+N+Y+ GA     DGVIT FP TA RYRRNRCLGYK+ P Y+ PV
Sbjct  169  FVSQAWDFFSDSSVEINNYISGAG---IDGVITEFPGTAARYRRNRCLGYKDRPLYLSPV  225

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  226  EPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPPVAKI  265



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  VE+N+Y+ GA     DG+IT FP TA RYRRNRCLGYK+ P Y+ PV
Sbjct  604  FVSQAWDFFSDSSVEINNYISGAG---IDGIITEFPGTAARYRRNRCLGYKDRPLYLSPV  660

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  661  EPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPPVAKI  700



>ref|XP_009364630.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
 ref|XP_009364651.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=242

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+QAWDFFSDP VE+NS+V GA+    DGVIT FP TA RY++N CL  KEIP YM
Sbjct  102  SNEFVTQAWDFFSDPTVEINSFVSGAN---IDGVITDFPKTAARYKKNLCLRQKEIPSYM  158

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PV P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  159  SPVQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAL  201



>ref|XP_008345027.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=299

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQ WDFFSDP VE+NS+V G +    DGVIT FP TA RY++NRCLG KE+P YM
Sbjct  159  SNEFVSQPWDFFSDPTVEINSFVSGVN---IDGVITDFPKTAARYKKNRCLGRKEVPNYM  215

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P+ P SL+Q+++P YLPPAEAP P L ESDV+EPPLP V
Sbjct  216  SPIQPASLIQVVTPSYLPPAEAPNPTLRESDVIEPPLPSV  255



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  VE+N+Y  GA     DGVIT FP TA RYRRNRCL YK  P Y   V
Sbjct  615  FVSQAWDFFSDSSVEINNYFIGAG---IDGVITDFPRTAARYRRNRCLRYKVPPLYFSLV  671

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PG LLQ MS Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  672  SPGVLLQFMSRQSLPPAEAPSPILTESDVVEPPLPPVAKI  711



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+QAWDFFSDP VE+NS+V GA+    DGVIT FP TA RY++N CL  KEIP YM
Sbjct  612  SNEFVTQAWDFFSDPTVEINSFVSGAN---IDGVITDFPKTAARYKKNLCLRQKEIPSYM  668

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PV P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  669  SPVQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAL  711



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             V+Q WDFFSD YVE+N++V   S    +GV+T FPATA +YRRNRCLGYKE+P YM PV
Sbjct  621  FVAQPWDFFSDAYVEINTHV---SYMGINGVVTDFPATAAKYRRNRCLGYKEVPLYMTPV  677

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             P  L+ LM+P++LPPAEAP PVLTE+DV EPPLPPV +
Sbjct  678  QPAGLISLMAPKFLPPAEAPNPVLTENDVTEPPLPPVVE  716



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDP VE+NS+V G      DGVIT FP TA RY+RNRCL YKE P YM
Sbjct  613  SNEFVSQAWDFFSDPSVEINSFVTGPV---IDGVITDFPKTAARYKRNRCLSYKETPAYM  669

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             PV PGSL+Q++S  Y+PPAEAP P LTESDV+EPPLP
Sbjct  670  SPVQPGSLIQVISSVYMPPAEAPKPYLTESDVIEPPLP  707



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVG  524
            VSQ WDFFSD YVE+N++V   S    +GVIT +PATA RY+RNRCLGYK+IP YM PV 
Sbjct  622  VSQPWDFFSDAYVEINTHV---SYMEINGVITDYPATAARYKRNRCLGYKDIPLYMTPVQ  678

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            PG LL LM+ Q+LPPAEAP PVLTE DV EPPLP V
Sbjct  679  PGGLLTLMTSQFLPPAEAPSPVLTEDDVAEPPLPAV  714



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQAWDFFSD   E+N+YV GA     DG++T +P TA RYRRNRCL YK +PPYM PV
Sbjct  615  FISQAWDFFSDSSTEINNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKNLPPYMSPV  671

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PGSLL LM+ Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  672  QPGSLLGLMTVQSMPPVEPPSPVLDVSDVTEPPLPPVAKI  711



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD   ELN+YV GA     DG++T +P TA RYRRNRCL YK++P YM PV
Sbjct  615  FVSQAWDFFSDSSTELNNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKDLPSYMSPV  671

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PGSLL LM+ Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  672  QPGSLLGLMTVQSMPPVEPPNPVLDVSDVTEPPLPPVAKI  711



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDP VE+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM
Sbjct  612  SNEFVSQAWDFFSDPTVEINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYM  668

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P+ P SL+Q+++  YLPPAEAP P L ESDV+EPPLP V
Sbjct  669  SPIQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDP VE+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM
Sbjct  612  SNEFVSQAWDFFSDPTVEINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYM  668

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P+ P SL+Q+++  YLPPAEAP P L ESDV+EPPLP V
Sbjct  669  SPIQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPSV  708



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDPYVE+N+Y+   + N   G++T +PATA RYR+NRCLGYK+ P YM
Sbjct  609  SNEFVSQAWDFFSDPYVEINTYISNMTIN---GLVTDYPATAARYRKNRCLGYKQAPSYM  665

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            LPV PGSL+ +M    LPP EAP PVL E+DV EPPLP V
Sbjct  666  LPVQPGSLISVMDRSLLPPTEAPKPVLKENDVTEPPLPHV  705



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 76/100 (76%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
              SQAWDFFSD  VE+NS+  GA  N   GVIT FP T++RYRRNRCL    +IP YM P
Sbjct  622  FTSQAWDFFSDATVEINSFYVGAGIN---GVITDFPKTSDRYRRNRCLKRGNKIPTYMSP  678

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            V PGSLLQL++  YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  679  VPPGSLLQLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDFFSD  VE+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P Y
Sbjct  614  SNEFVSQAWDFFSDATVEINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  671  MEPVQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDFFSD  VE+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P Y
Sbjct  614  SNEFVSQAWDFFSDATVEINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  671  MEPVQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +    SQAWDFFSD  VE+NS+  GAS N   GVIT FP T++RYRRNRCL    + P Y
Sbjct  619  SNEFTSQAWDFFSDATVEINSFCAGASIN---GVITDFPKTSDRYRRNRCLKRGNKTPTY  675

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            M PV PGSLL L++  YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  676  MSPVQPGSLLSLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+QAWDFFSDP VE+N +V GA+    DGVIT FP TA RY++N CL  KEIP YM
Sbjct  612  SNEFVTQAWDFFSDPTVEINLFVSGANV---DGVITDFPKTAARYKKNPCLRQKEIPSYM  668

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             P+ P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  669  SPIPPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAV  711



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+N+Y  GA     DG+IT FP TA RYRRNRCL YK  P Y   V
Sbjct  613  FVSQPWDFFSDSSVEINNYFVGAG---IDGIITDFPRTAARYRRNRCLHYKVPPMYFSLV  669

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             PG L Q MS Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  670  SPGVLQQFMSRQSLPPAEAPSPILTESDVVEPPLPPVAKI  709



>ref|XP_006387051.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
 gb|ERP45965.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
Length=194

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  VE+NSYV GA+     GVIT FP T+ RY+RNRCLGY  +PPYM P 
Sbjct  57   FVSQAWDFFSDSTVEINSYVMGAN---ISGVITEFPLTSARYKRNRCLGYNVLPPYMSPA  113

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             PG L+QL+SP  LPPAE P PVLT  DVVE PLP
Sbjct  114  QPGGLIQLISPFALPPAEPPNPVLTAPDVVEGPLP  148



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM
Sbjct  619  SNEFVSQAWDFFSDATVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLAMKETPNYM  675

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PV PGSLLQL++P YLPP   P PVL + DV EPPLPPV+
Sbjct  676  SPVQPGSLLQLVTPNYLPPKTPPSPVLDDKDVAEPPLPPVS  716



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 75/102 (74%), Gaps = 4/102 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSD  VE+NSYV GA+    DGVIT FPATA RY+ NRCLG     P Y
Sbjct  601  SNEFVSQAWDFFSDATVEVNSYVTGANV---DGVITEFPATAARYKINRCLGLGNNTPAY  657

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSL++L++  YLPPAEAP PVLTE DV EPPLPP A
Sbjct  658  MSPVQPGSLVELITTDYLPPAEAPNPVLTEDDVSEPPLPPAA  699



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQAWDFFSD  VE+NS+V GA     DGVIT FP TA  YR+NRCL YK  P YM PV
Sbjct  618  FISQAWDFFSDATVEINSFVTGAG---IDGVITSFPQTAASYRKNRCLKYKNAPSYMSPV  674

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PGSL+Q+++   +PPA APYPVLTESDV EPPL  VA
Sbjct  675  QPGSLMQVITSDDMPPALAPYPVLTESDVAEPPLQEVA  712



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFFSD  VELNSY+ GA  N   G IT FP TA RYRRNRCLG KEIPPYMLP+
Sbjct  634  FVSQAYDFFSDATVELNSYISGAGIN---GTITEFPFTAARYRRNRCLGRKEIPPYMLPI  690

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PG LL  ++SP  LPPAEAP  ++T++D++EPPLPPV 
Sbjct  691  QPGDLLHDVVSPLSLPPAEAPNLIITDADLIEPPLPPVT  729



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +    SQAWDFFSDP VE+NS+  G   N   GVIT FP T+NRYRRNRCL    +IP Y
Sbjct  634  SNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRGNQIPGY  690

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSL QL++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  691  MSPVQPGSLYQLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  732



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSD  VE+NSYV GA+ +   GVIT FP TA RY+RN+CL      P Y
Sbjct  625  SNEFVSQAWDFFSDANVEINSYVIGANVS---GVITDFPKTAARYKRNKCLNMGNSTPAY  681

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            M PV PGSLLQL++  YLPPAEAP PVLTE+DV E PLPPV
Sbjct  682  MAPVQPGSLLQLITQDYLPPAEAPNPVLTEADVAEAPLPPV  722



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV
Sbjct  576  FVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPV  632

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LLQ+++   LPPAEAP PV T++DV EPPLPPV
Sbjct  633  QPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPV  669



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV
Sbjct  618  FVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPV  674

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LLQ+++   LPPAEAP PV T++DV EPPLPPV
Sbjct  675  QPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPV  711



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G +T FP TA R+RRNRCLG KE PPYM PV
Sbjct  576  FVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFPYTAARFRRNRCLGSKETPPYMAPV  632

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LLQ+++   LPPAEAP PV T++DV EPPLPPV
Sbjct  633  QPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPV  669



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 4/95 (4%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGP  521
            SQ +DFFSD YVE+N++ F       DGVIT +PATA R++RNRCLGYK+ PPYM+P+  
Sbjct  620  SQPYDFFSDAYVEINAHYFAG----IDGVITDYPATAARFKRNRCLGYKDTPPYMMPLQA  675

Query  520  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              L+ L+SP YLPPAEAP P+LT++DV EPPLPPV
Sbjct  676  RLLIDLISPTYLPPAEAPSPILTDNDVAEPPLPPV  710



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFFSD  VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV
Sbjct  629  FVSQAYDFFSDATVEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL +MSP  LPPA+AP     E+DV EPPL PV
Sbjct  686  NPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSPV  722



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFFSD  VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV
Sbjct  651  FVSQAYDFFSDATVEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPV  707

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL +MSP  LPPA+AP     E+DV EPPL PV
Sbjct  708  NPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSPV  744



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM
Sbjct  619  SNEFVSQAWDFFSDATVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLTMKETPTYM  675

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PV PGSLLQL++  YLPP   P PVL + DV EPPLPPV+
Sbjct  676  SPVQPGSLLQLITQPYLPPKTPPSPVLDDKDVAEPPLPPVS  716



>ref|XP_006279180.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12078.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=538

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ  DFFSDP VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+
Sbjct  410  FVSQKRDFFSDPTVEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPI  466

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PGSLL ++SP  LPPAEAP  + T++DV EP LPPV+
Sbjct  467  QPGSLLGVVSPLSLPPAEAPSLIFTDADVTEPHLPPVS  504



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGP  521
            SQ WDF+SD  VE+NSYV G   N   GV+T +P TANRYRR RCLGYK  P YMLPV P
Sbjct  583  SQPWDFYSDATVEINSYVSGVGIN---GVVTDYPGTANRYRRRRCLGYKNTPNYMLPVQP  639

Query  520  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            GSL+ L+    LPPA AP PVLTE DV+E PLPPV
Sbjct  640  GSLITLLVKNQLPPAPAPSPVLTEGDVIEAPLPPV  674



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDF SD  VE+NS+V GA  N   G IT FP TA RY+RNRCL  K++PPYM PV
Sbjct  516  FVSQPWDFLSDATVEINSHVTGAGIN---GTITEFPLTAARYKRNRCLTRKDLPPYMSPV  572

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  573  QPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  609



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  +E+N+Y+  A  N   G+IT FP TA RY+RNRC+G KE PPYM PV
Sbjct  498  FVSQPYDFFSDATIEINTYISLAGIN---GIITEFPFTAARYKRNRCMGRKETPPYMEPV  554

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG+LL  MSPQ LPPAEAP  ++T++DV+EPPLPPV +
Sbjct  555  KPGALLAYMSPQSLPPAEAPNLIITDADVIEPPLPPVTE  593



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             V+QAWDFFSD Y+E+ +YV    A   +GV+T +PATA +++RNRCLGYK  PPYM PV
Sbjct  622  FVAQAWDFFSDAYLEMLNYV---DAMNINGVVTDYPATAAKFKRNRCLGYKNRPPYMTPV  678

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG L+ LM+P  L PAEAPYPVLT  DV EPPLP V +
Sbjct  679  RPGGLISLMAPGSLTPAEAPYPVLTGDDVAEPPLPAVIE  717



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVG  524
            +SQAWDFFSDP VE+NS+V G +    DG+IT FP TA RY+RN+CL Y+E P YM P+ 
Sbjct  613  LSQAWDFFSDPTVEINSFVSGVNV---DGIITDFPKTAVRYKRNKCLFYRERPSYMKPIQ  669

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            PG L   +SP  LPP EAP PVLTESDV EPPLP
Sbjct  670  PGVLFTAISPAQLPPVEAPNPVLTESDVTEPPLP  703



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ++DFFSD  VE+NS++ GA  N   G IT FP TA R++RNRCLG KE P YM+PV
Sbjct  621  FVSQSYDFFSDATVEINSFISGAGIN---GTITEFPFTAARFKRNRCLGAKETPNYMIPV  677

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL+++SP   PPA+AP PV T++DV EPPLPPV
Sbjct  678  EPGGLLKIVSPTSFPPAQAPNPVFTDADVTEPPLPPV  714



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQA+DFFSD  VE+N+Y++GA  N   G IT FP TA RY+RNRCLG KEIPPYM P+
Sbjct  630  FISQAYDFFSDATVEINTYIYGAGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMSPI  686

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              G+LL+ L++P  LPPAEAP  ++T++D++EPPLPPV 
Sbjct  687  QAGTLLKNLVTPLSLPPAEAPKLIITDADLIEPPLPPVT  725



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFF+D  VE+NS+V GA  N   G IT FP TA RY+RN CL  K++PPYM+PV
Sbjct  629  FVSQPWDFFADATVEINSHVTGAGIN---GTITEFPLTAARYKRNSCLTRKDVPPYMIPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P  LL ++SP  LPPAEAP PV T++DV EPPLPPV+
Sbjct  686  QPAGLLTIVSPASLPPAEAPSPVFTDADVTEPPLPPVS  723



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDF SD  VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV
Sbjct  631  FVSQPWDFLSDATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPV  687

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  688  QPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  724



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDF SD  VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV
Sbjct  631  FVSQPWDFLSDATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPV  687

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  688  QPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  724



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQAWDFFSDP VE+NS+V GA     DG+IT FP TA  YR N+CL   K  P YM P
Sbjct  617  FVSQAWDFFSDPVVEINSFVMGAG---IDGIITDFPGTATAYRNNKCLKMGKNKPYYMNP  673

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            V PG+L+Q+++ ++LPPAE+P PVLTESDV EPPL  + K
Sbjct  674  VEPGALMQVITAEFLPPAESPNPVLTESDVAEPPLASITK  713



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV
Sbjct  631  FVSQPFDFFADETVEINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPV  687

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG +L L+S   LPPA+ P P+ T  DV EPPLPPV
Sbjct  688  NPGGVLTLISTSSLPPAQDPNPIFTHDDVTEPPLPPV  724



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV
Sbjct  633  FVSQPFDFFADETVEINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPV  689

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG +L L+S   LPPA+ P P+ T  DV EPPLPPV
Sbjct  690  NPGGVLTLISTSSLPPAQDPNPIFTHDDVTEPPLPPV  726



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ  DFFSDP VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+
Sbjct  632  FVSQKRDFFSDPTVEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPI  688

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PGSLL ++SP  LPPAEAP  + T++DV EP LPPV+
Sbjct  689  QPGSLLGVVSPLSLPPAEAPSLIFTDADVTEPHLPPVS  726



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VS AWDF+SDP VE+NS+V GA     DGVIT FP TA  YR+NRCL   + IP YM P
Sbjct  612  FVSSAWDFYSDPVVEINSFVMGAG---IDGVITDFPGTAIMYRKNRCLNRGDNIPSYMRP  668

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            V PG+L Q +S +YLP AEAP PVLT+SDV EPPLP V K
Sbjct  669  VQPGNLFQAISAEYLPLAEAPSPVLTDSDVAEPPLPHVIK  708



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+NS+V GA  N   G IT FP TA RY+RNRCL  K+ P YM+PV
Sbjct  631  FVSQPWDFFSDATVEINSHVSGAGIN---GTITEFPLTAARYKRNRCLTRKDPPTYMIPV  687

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL ++SP  LPPAEAP PV+TE+DV EPPLPPV
Sbjct  688  LPAGLLSIVSPTSLPPAEAPNPVITEADVTEPPLPPV  724



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +    SQAWDFFSD  VE+NS+  G   N   GVIT FP T++RYRRNRCL   +  P Y
Sbjct  619  SNEFTSQAWDFFSDATVEVNSFHVGGLIN---GVITDFPETSDRYRRNRCLNKGDNTPGY  675

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSLLQL++ +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  676  MSPVQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVA  717



>emb|CDX86807.1| BnaA09g21970D [Brassica napus]
Length=230

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 6/98 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQ +DFFSDP VE+NSY+ GA  N   G IT FP TA RY+RNRCLG +E +PPYM P
Sbjct  88   FVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFTAARYKRNRCLGTQETLPPYMAP  144

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  145  FKPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPV  180



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDP VE+NS+  G +    DGVIT FP TA RY+RNRCL  K +P YM
Sbjct  614  SNEFVSQAWDFFSDPTVEINSFATGVN---IDGVITDFPKTAARYKRNRCLSEKVLPNYM  670

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P+   SL+Q+++  YLPPAEAP P LT SDV+EPPLP V
Sbjct  671  SPIQGASLIQVVTSDYLPPAEAPNPPLTASDVIEPPLPSV  710



>ref|XP_002300352.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
 gb|EEE85157.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
Length=259

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NSYV G +     GVIT FP T+ RY+RNRCLG KE+P YM
Sbjct  119  SNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-KELPSYM  174

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             P  PG L+QL+SP  LPPAE P PVLT  DVVE PLP
Sbjct  175  SPAQPGGLMQLISPFALPPAEPPNPVLTAPDVVEGPLP  212



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM
Sbjct  499  SNEFVSQAWDFFSDATVEVNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYM  554

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PV PGSL+Q+++   LPPA+APYPVL ESDV EPPLP V
Sbjct  555  SPVQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPAV  594



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+NS+V GA  N   G IT FP TA RY+RN+CL  K+ PPYM+PV
Sbjct  627  FVSQPWDFFSDITVEINSHVTGAGIN---GTITEFPLTAARYKRNQCLTRKDPPPYMIPV  683

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  684  QPAGLLTIVSPNSLPPAEAPNPVFTDADVTEPPLPPV  720



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM
Sbjct  605  SNEFVSQAWDFFSDATVEVNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYM  660

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PV PGSL+Q+++   LPPA+APYPVL ESDV EPPLP V
Sbjct  661  SPVQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPAV  700



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NS+V GA     DG IT FP TA RY+RN CL  K+ PPYM+PV
Sbjct  630  FVSQPYDFFSDATVEINSHVTGAG---IDGAITEFPLTAARYKRNTCLTRKDPPPYMIPV  686

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL ++SP  LPPAEAP PV T++DV+EPPLPPV
Sbjct  687  QPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPPV  723



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSDP VE+NS+V   +    DGVIT FP TA RY+RNRCL  K  P YM
Sbjct  615  SNEFVSQAWDFFSDPTVEINSFVLAVN---IDGVITDFPKTAARYKRNRCLSEKVPPSYM  671

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PV   SL+Q+++  YLPPAEAP P LT +DV+EPPLP V
Sbjct  672  TPVQAASLIQVVTADYLPPAEAPNPPLTATDVIEPPLPSV  711



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQ +DFFSDP VE+NSY+ GA  N   G IT FP TA RYRRNRCLG +E +PPYM P
Sbjct  617  FVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFTAARYRRNRCLGTQETLPPYMAP  673

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            V PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPVA
Sbjct  674  VEPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPVA  710



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF D  VE+N+Y+ G   N   G IT FP TA RY+RNRCLG KEIPPYMLP+
Sbjct  611  FVSQPYDFFDDATVEINTYISGHGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMLPI  667

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL +M+P  LPPA+AP P+ T  DV EPP+PPV
Sbjct  668  QPGGLLAIMNPLALPPAQAPNPIFTYDDVTEPPVPPV  704



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFFSD  VE+N+Y++GA  N   G IT FP TA RY+RNR LG +E+PPYMLPV
Sbjct  629  FVSQAYDFFSDATVEINAYIYGAGIN---GTITEFPFTAARYKRNRYLGREEVPPYMLPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL +MSP  LPPA+AP     E+DV EPPL PV
Sbjct  686  NPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSPV  722



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFF+D  VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV
Sbjct  620  FVSQPWDFFADATVEINSHVTGAGIN---GTITDFPLTAARYKRNSCLTRKDPPPYMIPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL ++SP  LPPAEAP PV+T++DV EPPLPPV
Sbjct  677  QPAGLLTIVSPASLPPAEAPNPVITDADVTEPPLPPV  713



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV
Sbjct  630  FVSQPYDFFSDATVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPV  686

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL ++SP  LPPAEAP PV T++DV+EPPLPPV
Sbjct  687  QPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPPV  723



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFFSD  VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV
Sbjct  629  FVSQAYDFFSDATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL+++SP +LPPAEAP PV T++D+ EPPLPPV
Sbjct  686  RPAGLLEIVSPTFLPPAEAPNPVFTDADITEPPLPPV  722



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RNRCLG K IPPYM  +
Sbjct  629  FVSQAYDFFTDATVEINSYISGAGIN---GTITEFPYTAARYKRNRCLGRKVIPPYMSAI  685

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL  L+SP  LPPA+AP PV T+ DV EPPLPPV
Sbjct  686  QPGDLLNTLVSPLSLPPAQAPNPVFTDGDVTEPPLPPV  723



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV
Sbjct  545  FVSQPWDFFSDATVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPV  601

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  602  QPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPV  638



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV G   N   G IT FP TA RY+RN CLG KEIP YM PV
Sbjct  620  FVSQPYDFFSDATVEINSYVTGVGIN---GTITEFPFTAARYKRNPCLGSKEIPFYMAPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL+++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  677  PPGGLLEVVSPGSLPPAEAPKPVFTDADVTEPPLPPV  713



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSDP VE+NSYV GA  N   G IT FP TA RY+RNRCLG++E P Y  PV
Sbjct  627  FVSQPFDFFSDPTVEINSYVNGAGVN---GTITEFPLTAARYKRNRCLGFRETPSYSSPV  683

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PGSLL L +   LPPAEAP PV +++DV EPPLPPVA
Sbjct  684  QPGSLLTLATA--LPPAEAPNPVFSDADVTEPPLPPVA  719



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV
Sbjct  630  FVSQPWDFFSDATVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPV  686

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  687  QPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPV  723



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DF SD  VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV
Sbjct  629  FVSQAYDFLSDATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL+++SP +LPPAEAP PV+T++DV EPPLPPV
Sbjct  686  RPAGLLEIVSPTFLPPAEAPNPVITDADVTEPPLPPV  722



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DF SD  VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV
Sbjct  629  FVSQAYDFLSDATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCMARKDTPVYMIPV  685

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             P  LL+++SP +LPPAEAP PV T++DV EPPLPPV
Sbjct  686  RPAGLLEIVSPTFLPPAEAPNPVFTDADVTEPPLPPV  722



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV
Sbjct  632  FVSQPYDFFSDATVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPV  688

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  689  QPGGLLTIVSPASLPPAEAPNPVFTDADVTEPPLPPV  725



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DF SDP VE+NSY+ G   N   G IT FP TA RY+RNRCLG KE PPYM  V
Sbjct  626  FVSQPYDFLSDPTVEINSYISGVGIN---GTITEFPLTAARYKRNRCLGSKETPPYMAHV  682

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PG LL ++SP  LPPA+ P PV T++DV EPPLPPV 
Sbjct  683  DPGGLLTVVSPSSLPPAKPPNPVFTDADVTEPPLPPVT  720



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSDP VE+NS++  A     DGVIT FP TANRY RN+CL    ++PPY
Sbjct  614  SNEFVSQAWDFFSDPIVEINSFIQEAG---IDGVITDFPKTANRYSRNKCLNLGDKVPPY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV  GSL  ++  + LPPA AP P LT S+VVEPPLPPV KI
Sbjct  671  MQPVQAGSLYGIIPSESLPPALAPLPSLTNSEVVEPPLPPVTKI  714



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP-Y  539
            +   VSQ+WDFFSD  VE+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P Y
Sbjct  616  SNEFVSQSWDFFSDATVEINSYL-NAEGVKIDGIITDFPKTADRYRRNKCLNLGDKKPTY  674

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PG L  L++P +LPP EAP P LTES+V EP LPPV KI
Sbjct  675  MDPVQPGGLFGLITPGFLPPTEAPLPPLTESEVAEPALPPVVKI  718



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV
Sbjct  620  FVSQPFDFFSDATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL+++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  677  QPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPPV  713



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV
Sbjct  620  FVSQPFDFFSDATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL+++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  677  QPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPPV  713



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQAWDF SD  V++N++V  A     DGVITGFP TANRYRRNRCL   +  PPYM P
Sbjct  529  FVSQAWDFLSDATVQINTFVQDAG---IDGVITGFPQTANRYRRNRCLNLGDSTPPYMRP  585

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            V  G L QL+    LPPA AP P LTE+DV EPPL P +KI
Sbjct  586  VEIGGLFQLVDKSSLPPAMAPAPSLTEADVTEPPLAPFSKI  626



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM
Sbjct  614  SNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYM  669

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             P  PG L+QL+SP  LPPAE P PVLT +DVVE PLP
Sbjct  670  SPAQPGGLMQLISPYALPPAEPPNPVLTATDVVEGPLP  707



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQAWDFFSD  VE+NSYV G + +   GVIT FP T+ RY+RNRCLG  ++PPYM P 
Sbjct  617  FVSQAWDFFSDSTVEINSYVMGVNIS---GVITEFPLTSARYKRNRCLG-SDLPPYMSPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             PG L+QL+SP  LPPAE P PVLT +DVVE PLP
Sbjct  673  QPGGLMQLISPYALPPAEPPNPVLTATDVVEGPLP  707



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQAWDF SD  V++N++V  A     DGVITGFP TANRYRRNRCL   +  PPYM P
Sbjct  624  FVSQAWDFLSDATVQINTFVQDAG---IDGVITGFPQTANRYRRNRCLNLGDSTPPYMRP  680

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            V  G L QL+    LPPA AP P LTE+DV EPPL P +KI
Sbjct  681  VEIGGLFQLVDKSSLPPAMAPAPSLTEADVTEPPLAPFSKI  721



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 4/96 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQAWD FSDP VE+N++V   +    DG+I+ FP TA  YR+NRCLG  K IP YM P
Sbjct  614  FVSQAWDVFSDPTVEINTFV---TLGKIDGIISDFPGTAAAYRKNRCLGMGKNIPIYMTP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            V PGSL+Q+++P +LPPAEAP PVL +S+V EPP P
Sbjct  671  VQPGSLMQVITPDFLPPAEAPNPVLEDSNVAEPPFP  706



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV
Sbjct  620  FVSQPFDFFSDATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG LL+++SP  +PPAEAP PV T++DV EPPLPPV
Sbjct  677  QPGGLLEVVSPGSIPPAEAPNPVFTDADVTEPPLPPV  713



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P 
Sbjct  622  FLSQPYDFFADATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPA  678

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  679  QPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  715



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P 
Sbjct  622  FLSQPYDFFADATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPA  678

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  679  QPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  715



>ref|XP_010433459.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=225

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSY+ G   N   G IT FP TA RY+RN CL  KE  PYM PV
Sbjct  88   FVSQPYDFFSDATVEINSYITGPGIN---GTITEFPFTAARYKRNLCLASKENIPYMAPV  144

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PG LL L+S   LPPA+AP  V T++DV+EPPLPPV 
Sbjct  145  QPGELLTLVSSTSLPPAQAPTQVFTDADVIEPPLPPVT  182



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P 
Sbjct  619  FLSQPYDFFADATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPA  675

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG+LL L+SP  LPPA+AP PV T++DV EPPLPPV
Sbjct  676  QPGALLTLVSPTSLPPAQAPNPVFTDADVTEPPLPPV  712



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P 
Sbjct  633  FLSQPYDFFADATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPA  689

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  690  QPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  726



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+N+Y+   S    +G+IT FP TA RY+ NRCLG KE PPYM PV
Sbjct  631  FVSQPYDFFADATVEINTYI---SLVGINGIITEFPFTAARYKTNRCLGRKETPPYMEPV  687

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             P +LL  MSPQ LPPAEAP  ++T++DV+EPPLPP+ +
Sbjct  688  KPRALLAFMSPQSLPPAEAPNLIITDADVIEPPLPPITE  726



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DF SD  VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG KE P YM P+
Sbjct  619  FVSQPYDFCSDATVEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKETPSYMSPI  675

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  676  KPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  711



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY+RNRCL  K+ PPYMLP+
Sbjct  632  FVSQPYDFFTDATVEINSYINGAGIN---GTITEFPFTAARYKRNRCLARKDTPPYMLPI  688

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PGSLL + +   LPPAEAP  + T++DV EPPLPPV 
Sbjct  689  KPGSLLGVANRYLLPPAEAPSLIFTDADVSEPPLPPVT  726



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 6/99 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQ +DFFSDP VE+NSY+ GA  N   G IT FP TA RY+RNRCLG +E +PPYM P
Sbjct  616  FVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFTAARYKRNRCLGTQETLPPYMAP  672

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPV 
Sbjct  673  FKPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPVT  709



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSY+FG   N   G IT FP TA RY+RN CL  K+  PYM PV
Sbjct  620  FVSQPYDFFSDATVEINSYIFGPGIN---GTITEFPFTAARYKRNLCLSSKDNVPYMAPV  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG+LL L+S   LPPAEAP PV T++DV EPPLPPV
Sbjct  677  QPGALLALVSSASLPPAEAPNPVFTDADVTEPPLPPV  713



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DF SD  VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG K+ P YM P+
Sbjct  586  FVSQPYDFCSDATVEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKKTPSYMSPI  642

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  643  KPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  678



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSD  VE+N++V  A+ +   G+IT FP TA RY+RNRCL   K +P Y
Sbjct  617  SNEFVSQAWDFFSDATVEINTFVVEANVS---GIITDFPKTAARYKRNRCLNLGKNMPSY  673

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            M PV  G L+QL++   LPPAEAP PVLTESDV+EPPLP V
Sbjct  674  MRPVEAGGLMQLIAN--LPPAEAPNPVLTESDVMEPPLPSV  712



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQA+DFFSDP VE+NSYV GA     DGVIT FP TA +Y+RN CL  K IP YM PV
Sbjct  616  FISQAYDFFSDPIVEINSYVMGAEV---DGVITDFPKTAAQYKRNSCLKMKNIPAYMSPV  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             P  L+ LM+P  +PPA AP P+L  SDV E PLP
Sbjct  673  QPNQLMALMNPALMPPASAPQPLLDVSDVSESPLP  707



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             V+Q WDFFSD  VE+N+YV GA     DG+IT FPATA+ Y+RN C    K  P YM P
Sbjct  622  FVAQPWDFFSDATVEINTYVQGAGV---DGIITDFPATASTYKRNSCRKMGKNAPSYMSP  678

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
               G LLQL+SPQ LPPA +P PVL  SDVVEPPLPPVA
Sbjct  679  AQGGGLLQLISPQSLPPALSPMPVLDVSDVVEPPLPPVA  717



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE--IPPYML  533
             VSQ +DFFSDP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE   PPYM 
Sbjct  621  FVSQPFDFFSDPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKESLAPPYMS  677

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            PV PG  L L++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  678  PVRPGFFLNLVNA--IPPAQAPNPVFTDDDVTEPPLPPV  714



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSDP VE+N+Y  GA     DGVIT FP TA RYRRNRCL    + PPY
Sbjct  620  SNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPY  676

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            M PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  677  MNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  711



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+N+Y +G   N   G IT FP TA RY+RNRCLG K IPPYM P+
Sbjct  629  FVSQPFDFFSDATVEINTYTYGFGIN---GTITEFPFTAARYKRNRCLGRKVIPPYMSPI  685

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              G LL+ L+SP  LPP +AP PV T+ DV EPPLPPV
Sbjct  686  QAGILLKNLVSPLSLPPTQAPSPVFTDGDVTEPPLPPV  723



>ref|XP_010496105.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=177

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ  D F D  +E+N+Y +G   N   G IT +P TA RY+RNRCLG K IPPYM  +
Sbjct  50   FVSQKLDSFYDATIEINTYTYGLGIN---GTITEYPFTAARYKRNRCLGRKVIPPYMSAI  106

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG LL  L+SP  LPPAEAP  V T +DV EPPLPPVAK
Sbjct  107  EPGGLLNYLVSPLSLPPAEAPNLVFTNADVSEPPLPPVAK  146



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSDP VE+N+Y  GA     DGVIT FP TA RYRRNRCL    + PPY
Sbjct  620  SNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPY  676

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            M PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  677  MNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  711



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NSYV G +     GVIT FP T+ RY+RNRCLGY  +P YM
Sbjct  614  SNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLGYNVLPHYM  670

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             P  PG L+ L+ P  LPPAE P PVLT  DVVE PLP
Sbjct  671  SPAQPGGLMPLIPPFALPPAEPPNPVLTAPDVVEGPLP  708



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSDP VE+N+Y  GA     DGVIT FP TA RYRRNRCL    + PPY
Sbjct  667  SNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPY  723

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            M PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  724  MNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  758



>ref|XP_006603452.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=425

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            ++  VS AWDFF+D  VE+N+Y+ GA     DG+IT FP   +RYRRN+CLG  +  P Y
Sbjct  286  SSEFVSPAWDFFADATVEINTYIEGAQ---IDGIITNFPKIVDRYRRNKCLGLGDNKPTY  342

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV  G +  L++ +  PP EA +P L ES V EPPLPPVAKI
Sbjct  343  MEPVQSGGIFGLITKELFPPVEATFPPLIESKVAEPPLPPVAKI  386



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPV  527
            +SQAWDF+SDP  E+N++V GA     DG+IT FP TAN YR NRCL      P YM PV
Sbjct  618  LSQAWDFWSDPNFEINNFVMGAR---IDGIITDFPGTANAYRNNRCLKMGNRKPRYMNPV  674

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             P  LL L +P  LP  EAP PVLTESDV EPPLP V K
Sbjct  675  LPNGLLSLGNPALLPSVEAPNPVLTESDVAEPPLPSVTK  713



>emb|CDY42328.1| BnaC02g17050D [Brassica napus]
Length=258

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF D  VE+N+Y+ GA  N   G IT FP TA RY+RN+CLG K+ P YM P+
Sbjct  128  FVSQPYDFFCDATVEINTYITGAGLN---GTITEFPLTAARYKRNQCLGRKQTPSYMSPL  184

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG LL +++P+ LPPAE PY V T  DV E P PP  +
Sbjct  185  KPGGLLSIVNPKSLPPAEPPYLVFTADDVTESPQPPATE  223



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 3/89 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DF SD  VE+NSYV GA  N   G IT FP TA RYR+NRCLG KE PPYM PV
Sbjct  618  FVSQPYDFLSDATVEINSYVTGAGVN---GTITEFPFTAARYRKNRCLGSKETPPYMAPV  674

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             PG+LLQ+++P  LPPAEAP PV T++DV
Sbjct  675  QPGALLQVVNPASLPPAEAPNPVFTDADV  703



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G IT FP TA RY++NRCLG KE PPY  PV
Sbjct  617  FVSQPYDFFSDATVEINSYVRGAGVN---GTITEFPLTAARYKKNRCLGLKEPPPYSSPV  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              G+L+ L +   LPPAEAP PV T++DV EPPLPPV
Sbjct  674  QAGALVSLATA--LPPAEAPNPVFTDADVTEPPLPPV  708



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SDP VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YML
Sbjct  592  FVSQPWDFLSDPTVEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYML  647

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PV  G LL LM+P+ LPPA AP PVL  SDVVEPPLPP ++
Sbjct  648  PVQVGDLLGLMAPEALPPALAPMPVLEVSDVVEPPLPPASQ  688



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSDP VE+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P 
Sbjct  620  FVSQPYDFFSDPTVEINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPA  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG+LL L+S   LPPA+AP P+ T++DV EPPLPPV +
Sbjct  677  QPGALLTLVSSTSLPPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SDP VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YML
Sbjct  627  FVSQPWDFLSDPTVEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYML  682

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PV  G LL LM+P+ LPPA AP PVL  SDVVEPPLPP ++
Sbjct  683  PVQVGDLLGLMAPEALPPALAPMPVLEVSDVVEPPLPPASQ  723



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDFFSDP VE+N YV GA A   DG+IT FP TA  YRRN C  LG K  P YML
Sbjct  628  FVSQPWDFFSDPIVEINQYVQGAGA---DGIITDFPGTATAYRRNACSKLGDKA-PNYML  683

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV  G LL+LM P  LPPA +P PVL  SDVVEPPL P +
Sbjct  684  PVQVGGLLELMVPDALPPALSPMPVLEVSDVVEPPLMPAS  723



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +    SQAWDFFSD  VE+NS+  G   N   GVIT FP T++R+  NRCL   +  P Y
Sbjct  619  SNEFTSQAWDFFSDATVEVNSFHVGGLIN---GVITDFPETSDRW--NRCLNKGDNTPGY  673

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSLLQL++ +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  674  MSPVQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVA  715



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDFFSDP VE+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P Y
Sbjct  614  SNEFVSQAWDFFSDPTVEINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PG L  L++ ++LPPAEAP P LTES+V E PLPPVAKI
Sbjct  671  MEPVQPGGLFGLITKEFLPPAEAPLPPLTESEVAESPLPPVAKI  714



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPP-YML  533
             VSQ +DFFSDP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE IPP YM 
Sbjct  620  FVSQPFDFFSDPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKETIPPQYMS  676

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            PV PG  L L++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  677  PVPPGLFLNLVNA--IPPAQAPNPVFTDDDVTEPPLPPV  713



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDFFSDP VE+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P Y
Sbjct  614  SNEFVSQAWDFFSDPTVEINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PG L  L++ ++LPPAEAP P LTES+V E PLPPVAKI
Sbjct  671  MEPVQPGGLFGLITKEFLPPAEAPLPPLTESEVAESPLPPVAKI  714



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G IT FP TA RYRRN+CLG KE  PYM PV
Sbjct  617  FVSQPYDFFSDATVEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSKETLPYMAPV  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             PG LL+++SP  LPPAEAP PV T++DV
Sbjct  674  QPGGLLEVVSPASLPPAEAPNPVFTDADV  702



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDFFSDP VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YML
Sbjct  628  FVSQPWDFFSDPIVEINQYVQGAYV---DGIITDFPGTAAAYKRNACSKLGDKA-PNYML  683

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV  G LL LM+P+ LPPA AP PVL  SDVVEPPL P +
Sbjct  684  PVQVGGLLGLMTPEALPPALAPMPVLEASDVVEPPLMPAS  723



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P 
Sbjct  620  FVSQPYDFFSDATVEINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPA  676

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG+LL L+S   LPPA+AP P+ T++DV EPPLPPV +
Sbjct  677  QPGALLTLVSSTSLPPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+NSY+ GA  N   G IT FP TA RY++NRCL  ++IPPYM P 
Sbjct  666  FVSQPFDFFTDATVEINSYISGAGIN---GTITEFPXTAARYKKNRCLRRQDIPPYMSPF  722

Query  526  GPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG +L+L+S    LPPA+AP PV T+ DV E PLPPV
Sbjct  723  EPGGVLKLVSRSNSLPPAQAPSPVFTDGDVTESPLPPV  760



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SD  VE+N+YV GA     DG+IT FP TA+RY+RN C  LG K+ P YML
Sbjct  617  FVSQPWDFLSDATVEINAYVVGAGV---DGIITDFPRTASRYKRNSCSKLGSKK-PNYML  672

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            P+  G LL LM+P   PPA AP PVL  SDVVEPP P V 
Sbjct  673  PIEAGQLLPLMAPAVQPPALAPMPVLNASDVVEPPFPQVT  712



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ  D F D  +E+N+Y +G   N   G IT +P TA RY+RNRCLG K IPPYM  +
Sbjct  527  FVSQKLDSFYDATIEINTYTYGFGIN---GTITEYPFTAARYKRNRCLGRKVIPPYMSAI  583

Query  526  GPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG LL  L+SP  LPPAEAP  V T  DV EPPLPPVAK
Sbjct  584  QPGDLLNTLVSPLSLPPAEAPNLVFTNVDVSEPPLPPVAK  623



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SD +VE+NS+V GA  N   G+IT FP TA RY +N+CL ++   PY 
Sbjct  606  SNEFVSQAWDYYSDAFVEINSFVIGAKVN---GIITDFPKTAARYTKNKCLKHRNKAPYT  662

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             P+ PG LL+ ++  YLP    P P+L +++V EPPLP V++
Sbjct  663  RPIEPGKLLKQITQLYLPAPVPPLPILNDNNVTEPPLPSVSR  704



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQA+DFF+D  VE+NSY+ GA  N   G IT FP TA RY++NRCL  + IPPYM P 
Sbjct  647  FVSQAYDFFTDATVEINSYISGAGIN---GTITEFPYTAARYKKNRCLRRQHIPPYMSPF  703

Query  526  GPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
             PG +L+L++    LPPA+AP  V T+SDV E PL PV
Sbjct  704  EPGGVLKLVNRSNSLPPAQAPSSVFTDSDVTESPLSPV  741



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 66/101 (65%), Gaps = 6/101 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SDP  E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+
Sbjct  517  FVSQPWDFLSDPTAEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMV  572

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PV  G LL LM+P+ LPPA AP PVL  SDV EPPLPP ++
Sbjct  573  PVHVGDLLGLMAPESLPPALAPMPVLEVSDVAEPPLPPASR  613



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ  D+F D  VELN+Y +GA  N   G IT FP TA +Y+RNRCLG K IPPYM  +
Sbjct  633  FVSQKLDWFYDATVELNTYTYGAGIN---GTITEFPFTAAKYKRNRCLGRKVIPPYMSAI  689

Query  526  GPGSLLQLM--SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             PG+LL ++  SP + PPA+AP  V T +DV E PLPPVAK
Sbjct  690  QPGNLLNILVSSPAF-PPAQAPNLVFTNADVSEAPLPPVAK  729



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 66/101 (65%), Gaps = 6/101 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SDP  E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+
Sbjct  629  FVSQPWDFLSDPTAEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMV  684

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PV  G LL LM+P+ LPPA AP PVL  SDV EPPLPP ++
Sbjct  685  PVHVGDLLGLMAPESLPPALAPMPVLEVSDVAEPPLPPASR  725



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDFFSD  V++NS+  GA     DG+IT FP TA  Y+RN C  LG + +P +M 
Sbjct  537  FVSQPWDFFSDATVQINSFFKGAEV---DGIITDFPGTARTYKRNSCRNLGSR-MPVFME  592

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV PG+LLQL+     PPA AP PVL  SDVVEPPLPPVA
Sbjct  593  PVEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPPVA  632



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFFSD  VE+NSYV GA  N   G IT FP TA RYRRN+CLG  E  PYM PV
Sbjct  619  FVSQPYDFFSDATVEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSIETLPYMAPV  675

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             PG LL++++P  LPPAEAP  V T++DV
Sbjct  676  QPGGLLEVVNPASLPPAEAPNSVFTDADV  704



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP-Y  539
            +   VSQAWDF SD  VE+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P Y
Sbjct  611  SNEFVSQAWDFLSDATVEINSYL-NAEGIKIDGIITDFPKTADRYRRNKCLNLGDKKPTY  669

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV PG L  L+SP +LPPAEAP P LTES+V EP LPPVAKI
Sbjct  670  MDPVQPGGLFGLISPDFLPPAEAPLPPLTESEVAEPALPPVAKI  713



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDFFSD  V++NS+  GA     DG+IT FP TA  Y+RN C  LG + +P +M 
Sbjct  622  FVSQPWDFFSDATVQINSFFKGAEV---DGIITDFPGTARTYKRNSCRNLGSR-MPVFME  677

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV PG+LLQL+     PPA AP PVL  SDVVEPPLPPVA
Sbjct  678  PVEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPPVA  717



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ +DFF+D  VE+N+Y+ GA  +   G IT FP TA RY+RNRCLG KEIPPYMLP+
Sbjct  630  FVSQPYDFFADATVEINTYISGAGVS---GTITEFPFTAARYKRNRCLGRKEIPPYMLPI  686

Query  526  GPGSLLQLMSPQYLPPAEAPYP  461
             PG LL +M+P  LPPA+AP P
Sbjct  687  QPGGLLAIMNPLALPPAQAPNP  708



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDF SDP VE+N YV GA+    DG+IT +P TA  YRRN C  LG  + P YM 
Sbjct  635  FVSQPWDFLSDPTVEINMYVQGAAV---DGIITEYPGTAAAYRRNTCSKLG-DQAPSYMS  690

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV  G LLQ+M PQ LPP  AP P L  +DVVEPPLP V+
Sbjct  691  PVPIGGLLQIMDPQALPPTLAPMPSLHAADVVEPPLPAVS  730



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQ WDF SD YVE+N++V  A     DGVIT FP TANRYRRN+CL   E  P Y
Sbjct  624  SNEFVSQDWDFMSDAYVEINTFVQDA---EIDGVITDFPKTANRYRRNKCLNLGEKTPAY  680

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV  G LLQ M    LPPA AP P LTE +V EPPLPP++KI
Sbjct  681  MEPVAVGGLLQAMDKSLLPPAMAPAPPLTEDEVTEPPLPPLSKI  724



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWDFFSD  VE+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM
Sbjct  614  SNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYM  669

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             P  PGSL++L+SP  +PPAE P PVLT SDV E PLP
Sbjct  670  SPAQPGSLMELISPAAMPPAEPPNPVLTASDVTEGPLP  707



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQAWDFFSD  VE+NSY+ GA     DGVIT FP TA+RY RN+CL   K  PPY
Sbjct  621  SNEFVSQAWDFFSDSTVEINSYIQGAG---IDGVITDFPKTASRYSRNKCLNLGKNTPPY  677

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            M  V  G L  ++SPQ LPPA AP P LT+S+VVEPPLP V
Sbjct  678  MEAVETGGLYSIISPQSLPPALAPIPPLTKSEVVEPPLPSV  718



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPY  539
            +    SQAWDFFSDP VE+NS+  G   N   GVIT FP T+NRYRRNRCL  + +IP Y
Sbjct  463  SNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGY  519

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSL  L++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  520  MSPVQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  561



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WD+FSDP V++NS+V GA     DG+IT FP TA  Y+RN C  LG K  P +M 
Sbjct  670  FVSQPWDYFSDPIVQINSFVEGAKV---DGIITDFPRTARAYKRNSCRNLGPKA-PVFME  725

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PV  G LLQL+     PPA AP PVL  S+VVEPPLPPVA
Sbjct  726  PVEAGDLLQLIPFAAQPPALAPMPVLNVSNVVEPPLPPVA  765



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPY  539
            +    SQAWDFFSDP VE+NS+  G   N   GVIT FP T+NRYRRNRCL  + +IP Y
Sbjct  619  SNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGY  675

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            M PV PGSL  L++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  676  MSPVQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  717



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 61/98 (62%), Gaps = 9/98 (9%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+N+YV GA  N   G IT FP TA RY+RNRCL  K+ PPYM  V
Sbjct  496  FVSQPWDFFSDATVEINTYVAGAGVN---GTITEFPLTAARYKRNRCLTRKDHPPYMPLV  552

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P  LL  ++       ++P+P  T  DV EPPLPPV 
Sbjct  553  KPAGLLGFVN------HDSPHPAFTADDVTEPPLPPVT  584



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQAWDF SD  VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM P
Sbjct  623  FVSQAWDFMSDATVEINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEP  679

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            V  GSLL  M    LPPA AP P LTE+ V EPPLPP++KI
Sbjct  680  VRVGSLLLAMDKYSLPPALAPAPPLTEAKVTEPPLPPLSKI  720



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPY  539
            +   VSQA+DFFSD  VE+NS++ GA  N   GVIT FP TA+RY RN+CL      PPY
Sbjct  614  SNEFVSQAFDFFSDSTVEINSFIQGAGIN---GVITDFPKTAHRYSRNKCLNLGNSTPPY  670

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV  GSL  ++S   LPPA AP P LT+ +VVEPPLPPVAKI
Sbjct  671  MQPVEAGSLFGVISNTSLPPAMAPLPPLTKDEVVEPPLPPVAKI  714



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 68/104 (65%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VS AWDF SD  VE+N++V  A     DGVIT FP TANRYRRN+CL   E  PPY
Sbjct  620  SNEFVSSAWDFLSDSTVEINTFVQDAE---IDGVITDFPKTANRYRRNKCLNLGENTPPY  676

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV  G L + ++   LPPA AP P LTE +V EPPLP V+KI
Sbjct  677  MKPVQVGGLFKQIAKYSLPPAVAPAPALTEDEVTEPPLPSVSKI  720



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SD  +E+NS+V G   N   G+IT FP TANRYRRN CL      PYM
Sbjct  611  SNEFVSQAWDYYSDASIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNVNKAPYM  667

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG L Q +S  +LPP   P PVL +S+V E PLP V+
Sbjct  668  SPIEPGKLYQQISDFFLPPLPPPPPVLIDSNVTEAPLPSVS  708



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPP  542
            +   VSQAWDFFSD  VE+NS++ GA     DGVIT FP TA+RY RN+C  LG K  PP
Sbjct  622  SNEFVSQAWDFFSDSTVEINSFIQGAG---IDGVITDFPKTASRYSRNKCXNLG-KNTPP  677

Query  541  YMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            YM  V  G L  ++SPQ LPPA AP P LT+S+VVEPPLP V
Sbjct  678  YMEAVETGGLYSIISPQSLPPALAPIPPLTKSEVVEPPLPSV  719



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 68/100 (68%), Gaps = 4/100 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQAWDF SD  VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM P
Sbjct  623  FVSQAWDFMSDATVEINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEP  679

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            V  GSLL  M    LPPA AP P LTE+ V EPPLPP++K
Sbjct  680  VRVGSLLLAMDKYSLPPALAPAPPLTEAKVTEPPLPPLSK  719



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 51/102 (50%), Positives = 65/102 (64%), Gaps = 8/102 (8%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ WDFFSD  VE+NSY   A +   DG+IT FP T  RY+RN C G K+ P YM  V
Sbjct  633  FLSQPWDFFSDETVEINSY---AQSLKVDGLITDFPKTVRRYKRNSCTG-KDKPAYMETV  688

Query  526  GPGSLLQLM----SPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              G L+QL+    +P+  PPA AP   L E++V++PP PPVA
Sbjct  689  DVGGLVQLLQRNAAPEAQPPAVAPMRELNETEVLQPPFPPVA  730



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
              SQ +DFFSD   ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P
Sbjct  614  FASQPYDFFSDATAQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LLQ++S    PPA +P P+LT SDV EPPLPP
Sbjct  671  ARPGDLLQIISKPAQPPAMSPMPLLTGSDVAEPPLPP  707



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
              SQ +DFFSD   ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P
Sbjct  614  FASQPYDFFSDATAQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LLQ++S    PPA +P P+LT SDV EPPLPP
Sbjct  671  ARPGDLLQIISKPAQPPAMSPMPLLTGSDVAEPPLPP  707



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 61/98 (62%), Gaps = 9/98 (9%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             VSQ WDFFSD  VE+N+YV GA  +   G IT FP TA RY+RNRCL  K+ PPYM  V
Sbjct  585  FVSQPWDFFSDATVEINTYVAGAGVS---GTITEFPLTAARYKRNRCLTRKDHPPYMPLV  641

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P  LL  ++       ++P+P  T  DV EPPLPPV 
Sbjct  642  KPAGLLGFVN------HDSPHPAFTADDVTEPPLPPVT  673



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP +E+NS+V G   N   G+IT FP TANRYRRN CL +    PYM
Sbjct  608  SNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYM  664

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG L + +S  YLPP   P P+LT+S+V E PLP V+
Sbjct  665  SPIEPGKLFKQISNLYLPPLPPPLPILTDSNVTEAPLPGVS  705



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
              SQ +DFFSD   ++N+YV GA     DGVIT FPATA RY+ N C+      P +M P
Sbjct  615  FASQPYDFFSDATAQINAYVQGAGV---DGVITDFPATARRYKLNTCMNMGNNTPSFMAP  671

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG L+Q++S    PP  AP P+LT SDV EPPLPP
Sbjct  672  AHPGDLMQIISKPAQPPEMAPMPLLTGSDVAEPPLPP  708



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP +E+NS+V G   N   G+IT FP TANRYRRN CL +    PYM
Sbjct  595  SNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYM  651

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG L + +S  YLPP   P P+LT+S+V E PLP V+
Sbjct  652  SPIEPGKLFKQISNLYLPPLPPPLPILTDSNVTEAPLPGVS  692



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQA DFFSD  VE+NS+V   +    DG+IT FPATA R+RR RC         +
Sbjct  610  SNEFVSQAQDFFSDTTVEINSFV---NEMGIDGLITDFPATAARFRRKRC------DMSL  660

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            +P G   LL L + + LPPA+APYP L ESD+ EPPLP V +
Sbjct  661  VPTGREKLLDLANEKSLPPAQAPYPSLKESDIDEPPLPDVIQ  702



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 6/90 (7%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VSQ +DFF+DP VE+NSY+ GA      G I  FP TA RY+RNRCLG KE +PPYM P
Sbjct  655  FVSQPYDFFADPTVEINSYITGAG---ISGTIIEFPFTAARYKRNRCLGTKEPLPPYMSP  711

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
            V PG LL  ++ +  PPA+AP PV TE DV
Sbjct  712  VLPGGLLPFLNAK--PPAQAPNPVFTEEDV  739



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ +DFF+D  V++N+YV GA     DG+IT FPATA RY+ N C+      P +M P
Sbjct  614  FVSQPYDFFADATVQINAYVKGAGV---DGLITDFPATARRYKVNSCMNMGNSAPIFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
               G L+Q++S    PPA AP P+LT+SDV EPPLPP
Sbjct  671  PRAGDLMQIISKLAQPPALAPMPLLTDSDVAEPPLPP  707



>ref|XP_002523503.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF38842.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=753

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 6/96 (6%)
 Frame = -1

Query  691  WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPG  518
            +DFFSDP VE+ +Y+ G  A   DG+IT +PATA+RY RN C  L Y ++P  +LP+ P 
Sbjct  618  FDFFSDPTVEIATYIAGLEA---DGIITEYPATASRYLRNVCSNLNY-DLPFTVLPIEPP  673

Query  517  SLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
             LLQ ++ + LPPA AP PVL  +DVV+PPLP VAK
Sbjct  674  LLLQFINSEMLPPAAAPSPVLDVADVVDPPLPAVAK  709



>gb|ACF79780.1| unknown [Zea mays]
Length=379

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVG  524
            SQ  DFF+D   ++N+YV GA     DG+IT FP TA+RY+ N C       P +M P  
Sbjct  252  SQPNDFFADATSQINAYVQGAK---VDGIITDFPGTAHRYKLNSCTSMGNSAPLFMQPPQ  308

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            PGSLL  M+P   PPA AP P+LT++DV EP LPPV+
Sbjct  309  PGSLLLTMAPDVQPPAAAPMPLLTDADVAEPALPPVS  345



>gb|ACF74306.1| putative glycerophosphoryl diesterphosphodiesterase 2 precursor 
[Arachis hypogaea]
Length=191

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDFFSDP VE+N++V        DGVIT FP TA+RYRRN+CL   + +P Y
Sbjct  49   SNEFVSQAWDFFSDPTVEINTFV---QEGLVDGVITDFPKTADRYRRNKCLTMGDNMPVY  105

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            MLPV  G LLQ ++  YLPPA AP P L ES+V E
Sbjct  106  MLPVQIGGLLQAVTKDYLPPASAPLPPLKESEVKE  140



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             +SQ +DFFSD   ++N+YV GA     DG+IT +PATA RY+ N C    K+ P +M P
Sbjct  615  FLSQPYDFFSDATAQINAYVQGAKV---DGLITDYPATARRYKLNACKNMGKKAPSFMAP  671

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
              PG LLQ++S    PPA AP P+L +SDV EPPLP
Sbjct  672  ARPGDLLQIISKPAQPPALAPMPLLVDSDVTEPPLP  707



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP VE+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+
Sbjct  610  SNEFVSQAWDYYSDPSVEINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYI  666

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG LL+ +    LPP   P PVL +S+V EPPLP V+
Sbjct  667  SPIPPGKLLKHIPKLDLPPPTPPLPVLNDSNVTEPPLPSVS  707



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 9/100 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   +SQ +DFFSDP +E++ +V G      DG+IT FPAT  RYR+N+C  Y ++ P  
Sbjct  603  SNEFISQPFDFFSDPTLEIDCFVKGI---KIDGIITDFPATTARYRKNQC--YSKLNP--  655

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              VG G L+   +P +  PA+APYP L +SDV EPPLP V
Sbjct  656  --VGTGELITFGNPMFFGPAKAPYPFLNDSDVTEPPLPEV  693



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP VE+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+
Sbjct  633  SNEFVSQAWDYYSDPSVEINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYI  689

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG LL+ +    LPP   P PVL +S+V EPPLP V+
Sbjct  690  SPIPPGKLLKHIPKLDLPPPTPPLPVLNDSNVTEPPLPSVS  730



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ +DFFSD   ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P
Sbjct  614  FVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  671  PRPGDLLQLISKPAQPPALAPMPLLLDSDVSEPPLPP  707



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             V+Q +DFFSD   E+ +YV GA     DG+IT FPATA RY+ N C+    + P +M P
Sbjct  719  FVAQPYDFFSDATAEIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAP  775

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  776  PRPGDLLQLISKPAQPPALAPMPLLMDSDVSEPPLPP  812



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDF SD  VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPY
Sbjct  524  SNEFVSQAWDFMSDATVEINTFVKDAG---IDGVITDFPKTANRYRRNRCLNLGDRKPPY  580

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV    LL  +    LPPA AP P LTE++V EPPLPP++KI
Sbjct  581  MKPVQLPGLLSKIDNFSLPPALAPVPPLTEAEVTEPPLPPLSKI  624



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ +DFFSD   ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P
Sbjct  614  FVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPATARRYKSNTCVNMGNKTPSFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  671  PRPGDLLQLISKPAQPPALAPMPLLMDSDVSEPPLPP  707



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            +   VSQAWDF SD  VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPY
Sbjct  619  SNEFVSQAWDFMSDATVEINTFVKDAG---IDGVITDFPKTANRYRRNRCLNLGDRKPPY  675

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            M PV    LL  +    LPPA AP P LTE++V EPPLPP++KI
Sbjct  676  MKPVQLPGLLSKIDNFSLPPALAPVPPLTEAEVTEPPLPPLSKI  719



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             V+QA+DFF+D  VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+
Sbjct  609  FVAQAYDFFADATVEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPI  665

Query  526  GPGSLLQLMSPQY  488
             PG LL ++SP +
Sbjct  666  QPGGLLDIVSPLF  678



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             V+QA+DFF+D  VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+
Sbjct  632  FVAQAYDFFADATVEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPI  688

Query  526  GPGSLLQLMSPQY  488
             PG LL ++SP +
Sbjct  689  QPGGLLDIVSPLF  701



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP +E+NS+V G   N   G+IT FP TANRYRRN CL      PY 
Sbjct  608  SNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYR  664

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG L + +S  YLPP   P PVLT+S+V E PLP V+
Sbjct  665  SPIEPGKLFKQISNLYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   VSQAWD++SDP +E+NS+V G   N   G+IT FP TANRYRRN CL      PY 
Sbjct  608  SNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYR  664

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             P+ PG L + +S  YLPP   P PVLT+S+V E PLP V+
Sbjct  665  SPIEPGKLFKQISNLYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>dbj|BAD94065.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=122

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGP  521
            + A+DF+ DP +E++S+V        DG+IT FPAT  RYR+N+C G   +         
Sbjct  1    THAFDFYDDPTLEIDSFVRDVQ---IDGIITDFPATTARYRKNKCYGEFGL------TTT  51

Query  520  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  52   GELITFANPMLLPPAEAPYPALLDSDVTEPPLP  84



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVG  524
            SQ  DFF+D   ++N+YV GA     DG+IT FP TA+RY+ N C       P +M P  
Sbjct  623  SQPNDFFADATSQINAYVQGAKV---DGIITDFPGTAHRYKLNSCTSMGNSAPLFMQPPQ  679

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PGSLL  M+P   PPA AP P+LT++DV EP LPPV+ 
Sbjct  680  PGSLLLTMAPDVQPPAAAPMPLLTDADVAEPALPPVSN  717



>emb|CDY11832.1| BnaC03g12580D [Brassica napus]
Length=153

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VE+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LP 
Sbjct  18   LSIAFDYFSDPTVEIATFIAG---NGVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPA  74

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPP+A I
Sbjct  75   EAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLPPIANI  114



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 9/100 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+QA+DF+ DP +E++S+V        DG+IT FPAT  RYR+N+C G      ++
Sbjct  603  SNEFVTQAFDFYEDPTLEIDSFVRDIQ---IDGIITDFPATTARYRKNQCYG-----KFV  654

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            LP   G L    +P  LPPAEAPYP+L +SDV EPPLP V
Sbjct  655  LP-ETGELRTFGNPLLLPPAEAPYPLLGDSDVTEPPLPEV  693



>emb|CDY29432.1| BnaC05g32380D, partial [Brassica napus]
Length=596

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 8/100 (8%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   ++Q +DFFSDP VE++ +V   + N  DG+IT FPAT +RY +N+C    E     
Sbjct  463  SNEFITQPYDFFSDPTVEIDYFV--RADNEIDGIITDFPATTSRYIKNQCYSKME-----  515

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              +  G L+ L +P+ L PAEAPYP+L +S+V EPPLP V
Sbjct  516  -QIRTGELVSLANPEILSPAEAPYPLLLDSNVTEPPLPEV  554



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  608  ISIAFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPA  664

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPPVAK+
Sbjct  665  EAGALLSVAAKEAQPPAIAPSPPLNAKDVIDPPLPPVAKM  704



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPV  527
            +S  +D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+P  +LP 
Sbjct  609  LSITFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELPFAILPA  665

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ + S +  PPA AP P L   DV++PPLPPVA +
Sbjct  666  KAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLPPVANL  705



>emb|CDX82242.1| BnaA03g35790D [Brassica napus]
Length=443

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 9/100 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+Q +D FSD  VE+N +V G      DG+IT FPAT  RYR+++C  Y+E+  + 
Sbjct  319  SNEFVTQPFDLFSDSTVEINFFVQGV---KIDGIITDFPATTARYRKSQC--YREMGMFR  373

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
                 G LL   +P+ L PA+APYP+L ESDV+EPPLP V
Sbjct  374  ----TGELLPFANPRLLSPAQAPYPLLVESDVMEPPLPDV  409



>gb|KHN41389.1| Putative glycerophosphoryl diester phosphodiesterase 3, partial 
[Glycine soja]
Length=245

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPY  539
            ++  VS AWDFF+D  VE+N+Y+ GA     DG+IT FP   +RYRRN+CLG  +  P Y
Sbjct  165  SSEFVSPAWDFFADEIVEINTYIEGAQ---IDGIITNFPKIVDRYRRNKCLGLGDNKPTY  221

Query  538  MLPVGPGSLLQLMSPQYLPPAEA  470
            M PV PG +  L++ +  PP EA
Sbjct  222  MEPVQPGGIFGLITKELFPPVEA  244



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  608  ISIAFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPA  664

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPPVA I
Sbjct  665  EAGALLSVAAKEAQPPAIAPSPPLDAKDVIDPPLPPVANI  704



>ref|XP_009126795.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Brassica rapa]
Length=751

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  614  ISIAFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPA  670

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPPVA I
Sbjct  671  EAGALLSVAAKEAQPPAIAPSPPLDAKDVIDPPLPPVANI  710



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  ISVAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +  PPA AP P L   DV++PPLPPVAK+
Sbjct  673  EAGALLAVADKEAQPPASAPNPPLDAKDVIDPPLPPVAKL  712



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ +DFFSD   ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P
Sbjct  614  FVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAP  670

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG LL L+S    PPA AP P+L +SDV EPPLPP
Sbjct  671  PRPGDLLLLISKPAQPPALAPMPLLLDSDVSEPPLPP  707



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -1

Query  691  WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSL  512
            +D FSDP V++N++V  A+     GVIT FP TA+ YRRN CL     P YM+P  PG+L
Sbjct  634  FDAFSDPVVQINTFVHAANVT---GVITDFPRTADAYRRNVCLNMNNTPAYMMPAQPGAL  690

Query  511  LQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            + ++ P   PPA +P PVLT  DV +PPL  V
Sbjct  691  IGILPPGASPPAGSPTPVLTVDDVSQPPLTSV  722



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  ISVAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +  PPA AP P L   DV++PPLPPVAK+
Sbjct  673  EAGALLAVADKEAQPPAGAPNPPLDAKDVIDPPLPPVAKL  712



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLP  530
             VS  WDFFSD  VE+NSYV   S N  DG+IT FP T  RY+ N C G    +P YM P
Sbjct  636  FVSPPWDFFSDVTVEINSYV--QSVN-IDGIITDFPKTVRRYKMNSCTGLGVNMPSYMNP  692

Query  529  VGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPVA  413
               G L QL++  Q  PPA AP PVL  SDV EPP P  A
Sbjct  693  AEIGGLAQLLNGSQAQPPALAPMPVLNSSDVTEPPFPSAA  732



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  492  ISIAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  548

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ +   +  PPA AP P L   DV++PPLPPVA I
Sbjct  549  EAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLPPVANI  588



>ref|XP_009126781.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Brassica rapa]
Length=738

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPV  527
            +S  +D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP 
Sbjct  599  LSITFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPA  655

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ + S +  PPA AP P L   DV++PPLPPVA +
Sbjct  656  KAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLPPVANL  695



>ref|XP_010483369.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Camelina sativa]
Length=542

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  404  ISIAFDYFSDPTVELATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPA  460

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  461  EAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLPPVANM  500



>ref|XP_009126782.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X2 [Brassica rapa]
Length=756

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPV  527
            +S  +D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP 
Sbjct  617  LSITFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPA  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ + S +  PPA AP P L   DV++PPLPPVA +
Sbjct  674  KAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLPPVANL  713



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ WDFFSD  VE+++YV    +   DG+IT FP T  RY+RN C G   +IP YM P
Sbjct  639  FVSQPWDFFSDETVEISNYV---QSVKVDGLITDFPKTVRRYKRNSCTGLGNDIPSYMKP  695

Query  529  VGPGSLLQLMSP----QYLPPAEAPYPVLTESDVVEPPLPPV  416
            V  G L QL+         PPA AP P L  S VV+ P PPV
Sbjct  696  VSVGDLAQLIKKYAGTNAQPPALAPMPELNSSSVVQAPFPPV  737



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  ISIAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  673  EAGALLSVADKEAQPPASAPNPPLDAKDVIDPPLPPVANL  712



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
              SQ +DFFSD   ++N+YV  A     DG+IT FP TA+RY+ N C+G K  P +M P 
Sbjct  618  FTSQPYDFFSDATAQINAYVQSAKV---DGIITDFPGTAHRYKLNSCMG-KNAPDFMRPA  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PG L+ +M  +  PPA AP P+LT+SDV EPPLPPV+
Sbjct  674  QPGGLISVMDQRAQPPAAAPMPLLTDSDVAEPPLPPVS  711



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  614  ISIAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  670

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  671  EAGALLAVADKEAQPPASAPNPPLDAKDVIDPPLPPVANM  710



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  ISIAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  673  EAGALLSVADKEAQPPASAPNPPLDAKDVIDPPLPPVANM  712



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VE+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LPV
Sbjct  617  LSIAFDYFSDPTVEIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPV  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPP+A I
Sbjct  674  EAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLPPIANI  713



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VE+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LPV
Sbjct  640  LSIAFDYFSDPTVEIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPV  696

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL + + +  PPA AP P L   DV++PPLPP+A I
Sbjct  697  EAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLPPIANI  736



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPY-M  536
             VS  +D+FSDP +E+ SY         DG++T FPATAN+Y R  C  +  K   PY +
Sbjct  628  FVSLMFDYFSDPIIEIASYALEFQV---DGIVTDFPATANKYMRCPCNDMDPKATIPYPI  684

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            LPV PGSLL L+ P+ L PA+AP P L  S+VV+PPLP V K
Sbjct  685  LPVEPGSLLGLVVPEALSPAQAPSPALQASNVVDPPLPEVVK  726



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  ISIAFDYFSDPTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  673  EAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLPPVANV  712



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 9/94 (10%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVG  524
            V+ A+DF+ DP +E++S+V        DG+IT FPAT  RYR+N+C G   +        
Sbjct  607  VTHAFDFYDDPTLEIDSFVRDVQ---IDGIITDFPATTARYRKNKCYGEFGLAT------  657

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  658  TGELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>emb|CDY32720.1| BnaA02g07820D [Brassica napus]
Length=752

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPV  527
            +S  +D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP 
Sbjct  613  LSITFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPA  669

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ + S +  PPA AP P L   DV++PPLPPVA +
Sbjct  670  KAGTLVSVASKEAQPPASAPNPPLDAKDVMDPPLPPVANL  709



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 9/94 (10%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVG  524
            V+ A+DF+ DP +E++S+V        DG+IT FPAT  RYR+N+C G   +        
Sbjct  607  VTHAFDFYDDPTLEIDSFVRDVQ---IDGIITDFPATTARYRKNKCYGEFGLTT------  657

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  658  TGELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPY-M  536
             VS  +D+FSDP +E+ SYV        DG++T FPATAN+Y R  C  +  K   PY +
Sbjct  628  FVSLMFDYFSDPIIEIASYVLDYQV---DGIVTDFPATANKYMRCPCNDMDPKANIPYPI  684

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            LPV PGSLL L+ P+ L PA+AP P L  S+V +PPLP V K
Sbjct  685  LPVEPGSLLGLVVPEALSPAQAPSPALQASNVADPPLPEVVK  726



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLP  530
             VS  +D+FSDP VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP
Sbjct  616  FVSIVFDYFSDPTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILP  672

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
               G+LL + + +  PP  AP P L   DV++PPLPPVA +
Sbjct  673  AEAGALLSVAAKEAQPPTSAPNPPLDAKDVIDPPLPPVANM  713



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VE  +++ G   N  DGVIT FPATA+RY R+ C    +  PY +LP 
Sbjct  617  ISIAFDYFSDPTVEFATFIAG---NGVDGVITEFPATASRYLRSPCSDLNKEQPYAILPA  673

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+L+ + + +  PPA AP P L   DV++PPLPPVA +
Sbjct  674  EAGALISVANKEAQPPASAPNPPLDAKDVIDPPLPPVANM  713



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 5/97 (5%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLP  530
             VS  WDFFSD  VE+N+YV    +   DG IT FP T  RY+ N C+G  + +P YMLP
Sbjct  641  FVSPPWDFFSDVTVEINTYV---QSVKIDGFITDFPKTVKRYKMNSCMGLGDNMPQYMLP  697

Query  529  VGPGSLLQLMSPQYL-PPAEAPYPVLTESDVVEPPLP  422
            V    L QL++   + PPA +P PVL+ S+V EPPLP
Sbjct  698  VEIAGLAQLLNGSTVQPPALSPMPVLSSSNVTEPPLP  734



>gb|EYU43134.1| hypothetical protein MIMGU_mgv11b015422mg [Erythranthe guttata]
Length=92

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  625  FDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTES  446
             DGV+T +PATA  + RNRCLGYK+ P YM P  P  L++ M+ Q LP A+AP P+LT+ 
Sbjct  3    IDGVVTPYPATAAEFTRNRCLGYKDAPLYMRPPQPVGLIKYMTAQDLPLAKAPNPILTDK  62

Query  445  DVVEPPLPPV  416
            DV+EPPLP V
Sbjct  63   DVLEPPLPSV  72



>dbj|BAC42822.1| GPI-anchored protein [Arabidopsis thaliana]
Length=359

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP +EL +++ G+     DGVIT FPATA RY ++ C    +  PY +LP 
Sbjct  225  ISVAFDYFSDPTIELATFISGSG---VDGVITEFPATATRYLKSPCSDLNKEQPYAILPA  281

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G L+ +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  282  EAGGLVVVADKEAQPPASAPNPPLEAKDVIDPPLPPVANL  321



>dbj|BAD94573.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=132

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  694  AWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPG  518
            A+D+FSDP +EL +++ G+     DGVIT FPATA RY ++ C    +  PY +LP   G
Sbjct  1    AFDYFSDPTLELATFISGSG---VDGVITEFPATATRYLKSPCSDLNKEQPYAILPAEAG  57

Query  517  SLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
             L+ +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  58   GLVVVADKEAQPPASAPNPPLEAKDVIDPPLPPVANL  94



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 9/100 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+Q +DF+ DP +E++ +V        DG+IT FPAT  RYR+N+C G  ++P   
Sbjct  605  SNEFVTQEYDFYEDPTLEIDCFVRDIQV---DGIITDFPATTARYRKNQCYGKFDLPD--  659

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
                 G L  L +P  L PAEAPYP+L  SDV EPPLP V
Sbjct  660  ----TGELRTLGNPMILAPAEAPYPLLRISDVTEPPLPEV  695



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP VEL +++ G   N  DGV+T FPATA+RY R  C    +  PY +LP 
Sbjct  612  ISIAFDYFSDPTVELATFIAG---NGVDGVVTEFPATASRYLRTPCADLNKDQPYAILPA  668

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
             PG+LL + + +  PP  A  P L   DVV+PPLPPVA
Sbjct  669  EPGALLSVAAKEAQPPVGALNPPLEAKDVVDPPLPPVA  706



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYML  533
             VSQ WDFFSD  VE+N++V GA     DG+IT FP TA RY+RN C  LG   +P YM 
Sbjct  615  FVSQPWDFFSDATVEINAHVLGARV---DGIITDFPETARRYKRNSCRNLG-NSMPNYMQ  670

Query  532  PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            PV  G L+ LM+   LPPA AP P L  SDVVEPPLP
Sbjct  671  PVLAGGLISLMNSDSLPPALAPIPPLDVSDVVEPPLP  707



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYM  536
             VS  +D+FSDP  E+ SYV G      DG++T FP TA++Y R+ C        +P  +
Sbjct  624  FVSLMFDYFSDPITEIASYVQGFEV---DGIVTDFPGTASKYMRSPCSDTDPKASVPYAI  680

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            LPV PG+L  L+ P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  681  LPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = -1

Query  694  AWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPG  518
            A D FSDP VEL ++V G      DGV+T +PATA  Y R+ C+      PY + P  PG
Sbjct  616  AIDMFSDPIVELQTFVAGFG---IDGVVTDYPATARAYSRSPCIDLNANVPYTIFPAQPG  672

Query  517  SLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            +LL L SP  LPP  AP P LT  DV++PPLPPV 
Sbjct  673  ALLALASPDALPPVGAPAPSLTVGDVIDPPLPPVG  707



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
             +SQ WDFFSD  VE+NSY   A +   DG+IT FP T  RY+RN C   K  P YM  V
Sbjct  632  FLSQPWDFFSDETVEINSY---AQSLKVDGLITDFPKTVRRYKRNSCTE-KVKPAYMETV  687

Query  526  GPGSLLQLMS----PQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              G L QL+     PQ  PP  +P P L  ++V +PP PPVA
Sbjct  688  EVGGLAQLLERNAVPQAQPPTVSPMPGLNATEVQQPPFPPVA  729



>ref|XP_008336911.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Malus domestica]
Length=166

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYM  536
             VS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R+ C        +P  +
Sbjct  17   FVSLMFDYFSDPMTEIASYAQGFQ---VDGIVTDFPGTASKYMRSPCTDMDPKANVPYAI  73

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            LPV PGSL  L++P+ L PA+AP   L  S VV+PPLP V
Sbjct  74   LPVEPGSLSSLIAPEALSPAQAPSQALQTSKVVDPPLPEV  113



>ref|XP_008343908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
 ref|XP_008343909.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=781

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY--KEIPPY-M  536
             VS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R+ C     K   PY +
Sbjct  624  FVSLMFDYFSDPITEIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPI  680

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            LPV PG+L  L+ P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  681  LPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            +S A+D+FSDP +EL +++ G+     DGVIT FPATA RY ++ C    +  PY +LP 
Sbjct  616  ISVAFDYFSDPTIELATFISGSGV---DGVITEFPATATRYLKSPCSDLNKEQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G L+ +   +  PPA AP P L   DV++PPLPPVA +
Sbjct  673  EAGGLVVVADKEAQPPASAPNPPLEAKDVIDPPLPPVANL  712



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY--KEIPPY-M  536
             VS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R+ C     K   PY +
Sbjct  624  FVSLMFDYFSDPITEIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPI  680

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            LPV PG+L  L+ P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  681  LPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYM  536
             VS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R+ C        IP  +
Sbjct  624  FVSLMFDYFSDPITEIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANIPYAI  680

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            LPV PGSL  L++P+ + PA+AP P L  S VV+PPLP V
Sbjct  681  LPVEPGSLSSLIAPEAMSPAQAPSPALQTSQVVDPPLPEV  720



>dbj|BAD94535.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=378

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            ++ A+D+FSDP +EL +++ G      DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  241  IAIAFDYFSDPTIELATFIAGRG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPA  297

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +   PA  P P L   DV++PPLPPVAK+
Sbjct  298  DAGALLTVADKEAQLPAIPPNPPLDAKDVIDPPLPPVAKL  337



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPV  527
              +Q +DF++DP VE++S+V        DG+IT FPAT  RYR+N C    ++ P     
Sbjct  628  FTTQQFDFYADPTVEIHSFVLDI---KIDGIITDFPATTTRYRKNHCYRKLDLVP-----  679

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              G L+ L +  +L PAEAPYP L ++DV+EPPL  V
Sbjct  680  -TGVLITLPNLVHLGPAEAPYPTLVDADVIEPPLTEV  715



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ WDFF D  VE+N+Y   A +   DG+IT FP T  RY+RN C G   ++P YM  
Sbjct  634  FVSQPWDFFGDETVEINNY---AQSLNVDGLITDFPKTVRRYKRNSCTGLGNDVPSYMGN  690

Query  529  VGPGSLLQLM----SPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            V  G L QL+    +PQ  PP+ AP P L    V  PP P VA
Sbjct  691  VTVGGLAQLLKNQAAPQAQPPSVAPMPKLDAPSVQRPPFPTVA  733



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 9/100 (9%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYM  536
            +   V+Q +D FSD  VE++ +V    A   DG+IT FPAT  RYR+++C  Y+E+  + 
Sbjct  725  SNEFVTQPFDLFSDSTVEIDFFV---QAVKIDGIITDFPATTARYRKSQC--YREMSMFR  779

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
                 G LL   +P+ L PA+APYP+L ESDV+EPPL  V
Sbjct  780  ----TGELLPFGNPRLLSPAQAPYPLLVESDVMEPPLLDV  815



>gb|AFW58562.1| hypothetical protein ZEAMMB73_533189 [Zea mays]
Length=260

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             +SQ +DFFSD   ++N+YV GA     DG+IT FPATA RY+ N C+      P +M P
Sbjct  127  FLSQPYDFFSDATAQINAYVKGA---LVDGLITDFPATARRYKVNSCMNMGNSTPNFMAP  183

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
              PG L+Q +S    PPA AP P LT SDV EPPLPP
Sbjct  184  ARPGDLMQSISKSAQPPALAPVPPLTGSDVAEPPLPP  220



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            V+ A+DFFSDP VEL +YV        DGV+T +P TA+ Y R+ C        Y +LP 
Sbjct  610  VAIAFDFFSDPVVELATYVGRLG---IDGVVTDYPKTADAYLRSPCSDLNAKVAYSILPA  666

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              G+LL L  P+ LPPAEAP P LT  DVV+PPLP V+
Sbjct  667  EAGALLGLAEPEVLPPAEAPGPPLTVDDVVDPPLPQVS  704



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            V+ A+DFFSDP VEL +YV        DGV+T +P TA+ Y R+ C        Y +LP 
Sbjct  610  VAIAFDFFSDPVVELATYVGRLG---IDGVVTDYPKTADAYLRSPCSDLNAKVAYSILPA  666

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
              G+LL L  P+ LPPAEAP P LT  DVV+PPLP V+
Sbjct  667  EAGALLGLAEPEVLPPAEAPGPPLTVDDVVDPPLPQVS  704



>ref|XP_002453429.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
 gb|EES06405.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
Length=295

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = -1

Query  691  WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGS  515
            +DFF+DP +E+ +Y +   A   DG++T +PATA  Y R+ C   K    Y +LP  PG+
Sbjct  162  FDFFADPTIEVATYAYSVVA---DGIVTDYPATAASYFRSPCSDMKLNLSYSILPAQPGA  218

Query  514  LLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            L+ L +P  L PA AP P+L  +DVV+PPLPPV  +
Sbjct  219  LVNLAAPGMLAPAGAPAPLLQPTDVVDPPLPPVKAV  254



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANP-FDGVITGFPATANRYRRNRCLGYKEIPPY  539
            +   ++Q +DFFSDP VE++ +V G   +P  DG+IT FPAT +RY +N C    E    
Sbjct  595  SNEFITQPYDFFSDPTVEIDYFVRG---DPEVDGIITDFPATTSRYTKNPCYSKME----  647

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
               +  G L+ L + + L PAEAPYP L +S+V EPPLP V
Sbjct  648  --QIRTGELVSLANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = -1

Query  715  ATSLVSQAWDFFSDPYVELNSYVFGASANP-FDGVITGFPATANRYRRNRCLGYKEIPPY  539
            +   ++Q +DFFSDP VE++ +V G   +P  DG+IT FPAT +RY +N C    E    
Sbjct  595  SNEFITQPYDFFSDPTVEIDYFVRG---DPEVDGIITDFPATTSRYTKNPCYSKME----  647

Query  538  MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
               +  G L+ L + + L PAEAPYP L +S+V EPPLP V
Sbjct  648  --QIRTGELVSLANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>emb|CDY12599.1| BnaA02g12670D [Brassica napus]
Length=408

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = -1

Query  688  DFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLL  509
            +F SD  VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LL
Sbjct  296  EFVSDATVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLL  352

Query  508  QLMSP--QYLPPAEAPYPVLTESDVVEPPLPP  419
            Q ++P      P+ AP PV T+  V  PPLPP
Sbjct  353  QTVNPLSPAPAPSPAPSPVFTDDYVAGPPLPP  384



>ref|XP_008361197.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=773

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYM  536
             VS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R+ C        +P  +
Sbjct  624  FVSLMFDYFSDPMTEIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANVPYAI  680

Query  535  LPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            LPV PGSL  L++P+ L PA+AP   L  S VV+PPLP V
Sbjct  681  LPVEPGSLSSLIAPEALSPAQAPSQALQTSKVVDPPLPEV  720



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVG  524
            SQ +DFFSD   ++N+YV GA     DG+IT FPATA RY+ N C+      P +M PV 
Sbjct  618  SQPYDFFSDATAQINAYVKGALV---DGLITDFPATARRYKVNSCMNMGNNTPNFMAPVH  674

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            PG L+Q +S    PPA AP P LTESDV +PPLPP
Sbjct  675  PGDLMQSISRSAQPPALAPIPPLTESDVAQPPLPP  709



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -1

Query  703  VSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPV  527
            ++ A+D+FSDP +EL +++ G      DGVIT FPATA RY R+ C    +  PY +LP 
Sbjct  616  IAIAFDYFSDPTIELATFIAGRGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPA  672

Query  526  GPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
              G+LL +   +   PA  P P L   DV++PPLPPVAK+
Sbjct  673  DAGALLTVADKEAQLPAIPPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_002437331.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
 gb|EER88698.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
Length=744

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = -1

Query  694  AWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPG  518
             +DF+++P VE+ +Y    S+   DG++T FPATA  Y R+ C  + K +   ++P  PG
Sbjct  610  GFDFWANPMVEIVTY----SSLMADGIVTEFPATAAEYFRSPCSDFSKNLTYTIMPAKPG  665

Query  517  SLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            SLL+L  P  LPPA+ P PVL  +DVV+PPLPPV
Sbjct  666  SLLKLTDPSALPPAQGPAPVLKPADVVDPPLPPV  699



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGV-ITGFPATANRYRRNRCLGY-KEIPPYML  533
             VSQ +DFFSD   ++N+YV            IT FP TA+RY+ N C    K+ P +M 
Sbjct  526  FVSQPYDFFSDATAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMGKKTPLFMQ  585

Query  532  PVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
            P   G L+  +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  586  PPQRGGLVGTISDPSALPPAMSPMPVLTDSDVAEPPLPPV  625



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGV-ITGFPATANRYRRNRCLGY-KEIPPYML  533
             VSQ +DFFSD   ++N+YV            IT FP TA+RY+ N C    K+ P +M 
Sbjct  616  FVSQPYDFFSDATAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMGKKTPLFMQ  675

Query  532  PVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
            P   G L+  +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  676  PPQRGGLVGTISDPSALPPAMSPMPVLTDSDVAEPPLPPV  715



>ref|NP_001159159.1| uncharacterized protein LOC100304242 [Zea mays]
 gb|ACN25264.1| unknown [Zea mays]
Length=165

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -1

Query  691  WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGS  515
            +DFF+DP +E+ +Y +   A   DG++T +PATA  Y R+ C        Y +LP  PG+
Sbjct  32   FDFFADPTIEIVTYSWAVLA---DGLVTDYPATAASYFRSPCSDMNLNLSYSILPAQPGA  88

Query  514  LLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            L+ L +P  L PA AP P+L  SDVV+PPLPPV  +
Sbjct  89   LVNLAAPGTLAPAGAPAPLLQPSDVVDPPLPPVKAV  124



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ  DFF+D  VE+N YV    +    G+IT FP T  RY++N C G   ++P YM  
Sbjct  630  FVSQPLDFFADETVEINYYV---QSFNLSGIITDFPKTVRRYKKNTCTGLGNDMPNYMQR  686

Query  529  VGPGSLLQLMSP-QYLPPAEAPYPVLTESDVVEPPLPPVA  413
            +  GSL QL+ P +  PP+  P P L  S V E PLPPVA
Sbjct  687  IDVGSLYQLLQPFKAQPPSVPPMPTLNASSVEEAPLPPVA  726



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -1

Query  700  SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVG  524
            +Q  DFF+D  V++N+YV    AN  DGVIT FP TA+RY+ N C    K  PP+M P  
Sbjct  624  TQPNDFFADATVQINAYVHVRGAN-VDGVITDFPGTAHRYKLNSCTSMGKNAPPFMSPPK  682

Query  523  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            PG LL  M P   PPA AP P+LT++DV EP LPPV+ 
Sbjct  683  PGDLLTTMPPFAQPPAAAPMPLLTDADVAEPALPPVSN  720



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = -1

Query  691  WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGS  515
            +DF++DP VEL +YV   +A   DGVIT FP TA+RY R+ C+    EI   ++P  PG+
Sbjct  623  FDFYADPMVELATYV---AALEVDGVITDFPGTASRYMRSPCVDLNGEIA--IIPAEPGA  677

Query  514  LLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            LL+ + P  L PA  P P L  +DVV+PPLPPVA +
Sbjct  678  LLKQVPPMALSPANPPNPPLEVADVVDPPLPPVANV  713



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = -1

Query  688  DFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLL  509
            +F SD  VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LL
Sbjct  611  EFVSDATVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLL  667

Query  508  QLMSP--QYLPPAEAPYPVLTESDVVEPPLPP  419
            Q ++P      P+ AP PV T+  V  PPLPP
Sbjct  668  QTVNPLSPAPAPSPAPSPVFTDDYVAGPPLPP  699



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = -1

Query  706  LVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLP  530
             VSQ WDFFSD   ++N+YV        DGVIT FPATA+RY+ N C+      P +M P
Sbjct  614  FVSQPWDFFSDATQQINAYV-KRPGGGVDGVITDFPATAHRYKLNSCMNMGNNTPGFMFP  672

Query  529  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              PG L++ M     PPA AP P LTESDV EPPLP V
Sbjct  673  AQPGGLIENMPGPVQPPAIAPLPPLTESDVAEPPLPAV  710



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500